Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43128.258ON41141122200.0
AGR091W8.258ON41041118410.0
SAKL0H17138g8.258ON41941615340.0
ZYRO0C01738g8.258ON41441014860.0
KLTH0G13772g8.258ON42041714810.0
KAFR0B027008.258ON42041714780.0
Kwal_56.238328.258ON41941514760.0
KLLA0F19063g8.258ON41541414720.0
YLR085C (ARP6)8.258ON43843614540.0
Suva_10.1698.258ON43843414500.0
Skud_12.1538.258ON43843514400.0
Smik_12.1448.258ON43843514360.0
NCAS0B049908.258ON42041714210.0
TBLA0H014608.258ON44243914130.0
TDEL0F038508.258ON41941514100.0
Kpol_543.368.258ON42742314090.0
NDAI0B019608.258ON43943614010.0
CAGL0L12166g8.258ON42141513900.0
KNAG0G020108.258ON42442313670.0
TPHA0A018308.258ON42142513061e-179
Ecym_63852.117ON3774162542e-23
KLLA0E22925g2.117ON3804152357e-21
AFR051W2.117ON4054052313e-20
NDAI0G029003.161ON3913692287e-20
Ecym_15208.23ON3764102251e-19
NCAS0C037008.23ON3754082242e-19
TBLA0C004408.23ON3754082242e-19
TDEL0C004708.23ON3754082233e-19
CAGL0K12694g8.23ON3754082233e-19
Suva_6.188.23ON3754082233e-19
Smik_6.398.23ON3754082233e-19
YFL039C (ACT1)8.23ON3754082233e-19
SAKL0B00968g8.23ON3754082233e-19
SAKL0E11814g2.117ON3794182233e-19
ABR222W8.23ON3764082233e-19
KNAG0L002508.23ON3754082233e-19
KAFR0D009408.23ON3754082233e-19
TPHA0D002508.23ON3754082223e-19
ZYRO0F02772g8.23ON3754082215e-19
Skud_6.318.23ON3603462205e-19
NCAS0C035503.161ON3923692207e-19
NDAI0G030408.23ON3754082198e-19
TBLA0F008703.161ON3913772199e-19
Kpol_1058.158.23ON3754082191e-18
KLTH0G18832g8.23ON3754082181e-18
KLLA0D05357g8.23ON3754082162e-18
ZYRO0B04928g3.161ON3913592162e-18
KLLA0C03850g3.161ON3913702162e-18
Suva_4.2203.161ON3913592163e-18
Kwal_14.11098.23ON3603462153e-18
Smik_4.2063.161ON3913592135e-18
YDL029W (ARP2)3.161ON3913592135e-18
NCAS0B071302.117ON3814242128e-18
NDAI0B044602.117ON3814082101e-17
Skud_4.2223.161ON3913592101e-17
Ecym_52373.161ON3913702092e-17
TDEL0D046103.161ON3913692082e-17
SAKL0C07370g3.161ON3913692065e-17
ADR316W3.161ON3913822056e-17
CAGL0K01595g3.161ON3913692057e-17
Kwal_33.146422.117ON3834162031e-16
KLTH0B05940g2.117ON3834242022e-16
KLTH0F06490g3.161ON3913692022e-16
ZYRO0G05676g2.117ON3814022012e-16
KAFR0C01040na 1ON3373211975e-16
Kpol_479.253.161ON3913691986e-16
ZYRO0G01936g1.514ON4613151987e-16
Kwal_33.141773.161ON3373101922e-15
TDEL0B048102.117ON3734071913e-15
KAFR0F005902.117ON3864061881e-14
KNAG0K01130na 1ON3933101862e-14
TPHA0I013002.117ON3794091843e-14
KNAG0B001701.514ON4533141835e-14
KLLA0B13904g1.514ON4563811835e-14
TBLA0D036801.514ON4583551836e-14
YHR129C (ARP1)2.117ON3844021817e-14
NCAS0A122701.514ON4543141811e-13
SAKL0D12804g1.514ON4563141792e-13
TPHA0A009203.161ON3913691782e-13
CAGL0F00517g1.514ON4543141783e-13
KAFR0D037001.514ON4493471773e-13
Skud_8.1902.117ON3844061764e-13
NDAI0A039701.514ON4623541764e-13
AFR419C1.514ON4553141764e-13
Smik_8.2102.117ON3844061746e-13
TDEL0F004701.514ON4612941756e-13
YJR065C (ARP3)1.514ON4493141747e-13
Kwal_27.99581.514ON4453071739e-13
Suva_12.1541.514ON4493141731e-12
TBLA0B010702.117ON3833821721e-12
Smik_10.3551.514ON4493141721e-12
TPHA0O010401.514ON4582941721e-12
Kpol_1056.161.514ON4603141721e-12
KNAG0I018602.248ON7531611732e-12
Skud_10.2891.514ON4493141712e-12
KLTH0C02508g1.514ON4513271702e-12
Ecym_31531.514ON4583141684e-12
Suva_15.3262.117ON3844051665e-12
Kpol_1023.188.23ON3193231656e-12
CAGL0H09042g2.117ON3873761622e-11
TDEL0C041402.248ON7491611463e-09
KNAG0H036502.117ON3873641453e-09
ADL253C2.248ON7511711463e-09
KLLA0F03421g2.248ON7471651454e-09
SAKL0E08602g2.248ON7471641445e-09
KLTH0G09482g2.248ON7451651445e-09
Kwal_23.48482.248ON7451641436e-09
Ecym_32852.248ON7461721401e-08
TPHA0C031602.248ON7551611402e-08
CAGL0J10054g2.248ON7541591374e-08
YNL059C (ARP5)2.248ON7551721374e-08
Suva_14.2812.248ON7551681357e-08
Kpol_1003.162.248ON7491671348e-08
Smik_14.2672.248ON7551721341e-07
NDAI0D010602.248ON7531611312e-07
ZYRO0A01584g2.248ON7481681312e-07
AFR105C1.287ON4793261293e-07
TBLA0E038602.248ON7592161294e-07
Skud_14.2722.248ON7551721285e-07
NDAI0G055801.287ON5152121222e-06
YJL081C (ARP4)1.287ON4892101151e-05
Kwal_14.23771.287ON4812121115e-05
Smik_10.1611.287ON4892101106e-05
ZYRO0G21428g1.287ON4834981097e-05
Kpol_282.41.287ON5011081099e-05
KLTH0H09702g1.287ON4812121089e-05
Suva_6.1541.287ON4892101071e-04
KAFR0J011602.248ON7511681081e-04
Skud_10.1321.287ON4882101043e-04
Ecym_63301.287ON4803341043e-04
CAGL0M03201g1.287ON4932221017e-04
ACR184C7.448ON401881000.001
TBLA0D053601.287ON5961411000.001
SAKL0F13772g7.448ON422163970.002
NCAS0B060601.287ON497221930.006
TPHA0I010301.287ON503106930.006
KAFR0A015601.287ON485216920.009
KLLA0D02288g1.287ON520214910.012
KNAG0B019201.287ON505105870.038
SAKL0D05874g1.287ON497117860.043
NCAS0G030502.248ON743146840.10
AFL222W2.165ON732102830.11
TDEL0C031207.448ON438203820.16
Kpol_520.117.448ON488315750.97
KAFR0D010308.50ON73095731.9
TDEL0D015501.287ON480215722.5
NCAS0H010806.174ON59470722.8
ZYRO0G17182g7.448ON465336712.9
Ecym_35058.251ON305103703.2
SAKL0G12364gna 2ON224125677.1
TBLA0B084603.68ON562134688.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4312
         (411 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   859   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   713   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   595   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   577   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   575   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   573   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   573   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   571   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   564   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   563   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   559   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   557   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   551   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   548   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   547   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   547   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   544   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   540   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   531   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   507   e-179
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...   102   2e-23
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    95   7e-21
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    94   3e-20
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    92   7e-20
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    91   1e-19
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    91   2e-19
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...    91   2e-19
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    91   3e-19
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    91   3e-19
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    91   3e-19
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    91   3e-19
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    91   3e-19
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    91   3e-19
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    91   3e-19
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    91   3e-19
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    91   3e-19
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    91   3e-19
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    90   3e-19
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    90   5e-19
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    89   5e-19
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    89   7e-19
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    89   8e-19
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    89   9e-19
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    89   1e-18
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    89   1e-18
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    88   2e-18
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    88   2e-18
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    88   2e-18
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    88   3e-18
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    87   3e-18
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    87   5e-18
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    87   5e-18
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    86   8e-18
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    86   1e-17
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    86   1e-17
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    85   2e-17
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    85   2e-17
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    84   5e-17
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    84   6e-17
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    84   7e-17
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    83   1e-16
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    82   2e-16
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    82   2e-16
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    82   2e-16
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    80   5e-16
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    81   6e-16
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    81   7e-16
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    79   2e-15
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    78   3e-15
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    77   1e-14
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    76   2e-14
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    75   3e-14
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    75   5e-14
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    75   5e-14
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    75   6e-14
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    74   7e-14
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    74   1e-13
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    74   2e-13
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    73   2e-13
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    73   3e-13
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    73   3e-13
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    72   4e-13
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     72   4e-13
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    72   4e-13
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    72   6e-13
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    72   6e-13
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    72   7e-13
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    71   9e-13
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    71   1e-12
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    71   1e-12
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    71   1e-12
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    71   1e-12
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    71   1e-12
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    71   2e-12
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    70   2e-12
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    70   2e-12
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    69   4e-12
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    69   5e-12
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    68   6e-12
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    67   2e-11
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    61   3e-09
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    60   3e-09
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    61   3e-09
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    60   4e-09
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    60   5e-09
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    60   5e-09
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    60   6e-09
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    59   1e-08
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    59   2e-08
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    57   4e-08
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    57   4e-08
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    57   7e-08
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    56   8e-08
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    56   1e-07
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    55   2e-07
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    55   2e-07
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    54   3e-07
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    54   4e-07
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    54   5e-07
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    52   2e-06
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    49   1e-05
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    47   5e-05
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    47   6e-05
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    47   7e-05
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    47   9e-05
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    46   9e-05
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    46   1e-04
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    46   1e-04
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    45   3e-04
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    45   3e-04
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    44   7e-04
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    43   0.001
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    43   0.001
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    42   0.002
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    40   0.006
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    40   0.006
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    40   0.009
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    40   0.012
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    38   0.038
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    38   0.043
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    37   0.10 
AFL222W Chr6 (20289..22487) [2199 bp, 732 aa] {ON} Syntenic homo...    37   0.11 
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    36   0.16 
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    33   0.97 
KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 a...    33   1.9  
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    32   2.5  
NCAS0H01080 Chr8 (203424..205208) [1785 bp, 594 aa] {ON} Anc_6.1...    32   2.8  
ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} simi...    32   2.9  
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    32   3.2  
SAKL0G12364g Chr7 (1052416..1053090) [675 bp, 224 aa] {ON} simil...    30   7.1  
TBLA0B08460 Chr2 (2026227..2027915) [1689 bp, 562 aa] {ON} Anc_3...    31   8.0  

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/411 (100%), Positives = 411/411 (100%)

Query: 1   MGVPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPF 60
           MGVPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPF
Sbjct: 1   MGVPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPF 60

Query: 61  ELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEE 120
           ELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEE
Sbjct: 61  ELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEE 120

Query: 121 YEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIPVI 180
           YEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIPVI
Sbjct: 121 YEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIPVI 180

Query: 181 KGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYFDSF 240
           KGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYFDSF
Sbjct: 181 KGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYFDSF 240

Query: 241 QKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIANILK 300
           QKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIANILK
Sbjct: 241 QKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIANILK 300

Query: 301 PGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHL 360
           PGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHL
Sbjct: 301 PGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHL 360

Query: 361 PKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
           PKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI
Sbjct: 361 PKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/411 (78%), Positives = 369/411 (89%), Gaps = 1/411 (0%)

Query: 1   MGVPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPF 60
           M VP++++NGSYEIKFGP++L++PYRA NCL RD+YGRYHLSNQM QIR++S+CH+RRP 
Sbjct: 1   MRVPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPS 60

Query: 61  ELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEE 120
           ELGQL+SWELEE IWDYCLFN DEF W+LKDSKDVDLI SETCM+IPEISK+MDQVVFEE
Sbjct: 61  ELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120

Query: 121 YEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIPVI 180
           YEFGS+MKCPVAQ++PFD   DY + G  G  VV  K  YN+FQLVVDSGFNCTWV+PVI
Sbjct: 121 YEFGSMMKCPVAQFVPFDRARDYDIVGGAG-EVVEAKSGYNNFQLVVDSGFNCTWVMPVI 179

Query: 181 KGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYFDSF 240
           KGVPYYKA KKLDIGGRFL GLLKET+SFRHYN+MDETIL NNIKEQCCFMPPVSYFDSF
Sbjct: 180 KGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSF 239

Query: 241 QKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIANILK 300
           Q+K ETR++Y+LPDFQTSLIGYVRQPKQAIP+ SQ L LEDELFT+PETFFHPEI+NILK
Sbjct: 240 QRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEISNILK 299

Query: 301 PGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHL 360
           PGL+ET+LE +SM+PE++RPL+VSNI  +GGNFNI+NFA+RLATELQRQCPTDW VRVH 
Sbjct: 300 PGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQ 359

Query: 361 PKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
           PK D  LQGWK+M +FS TDSYK  RVTR+EYLEHG DWCTK+RFGYEQWI
Sbjct: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/416 (66%), Positives = 338/416 (81%), Gaps = 7/416 (1%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62
            PIIIDNGSYE+KFGP++  +P+RALN LARDKYG  HLSNQ+ +++++SN   RRP EL
Sbjct: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRPHEL 63

Query: 63  GQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122
           GQL SWEL+  IWDYCL+N DEF+W++ ++K   L++SE CMS+PE+SK  DQVVFEEYE
Sbjct: 64  GQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFEEYE 123

Query: 123 FGSLMKCPVAQYIPFDNMA-DYKVYGSDGLPVVRK-----KDDYNDFQLVVDSGFNCTWV 176
           FGS  K PVA ++PF+  A ++ +  +    V RK     +++YNDFQLV+DSGFNCTWV
Sbjct: 124 FGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNCTWV 183

Query: 177 IPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSY 236
           +P++KG+PYYKA+KKLDIGGRFL G LKET+SFRHYN+MDETIL NNIKE+C FM PVSY
Sbjct: 184 VPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSY 243

Query: 237 FDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIA 296
           F+SFQKK +T  +YVLPDFQTS  GYV+Q KQ IPEDSQT+ L DELF+IPETFFHPEIA
Sbjct: 244 FNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFHPEIA 303

Query: 297 NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSV 356
           ++LKPG++ET+LESISMLPE IRPLMVSN  V GGNFNI NFA RLATELQRQCPTDW V
Sbjct: 304 SLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDV 363

Query: 357 RVHLPKG-DTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
            V +P   DT L GW +M +FS T +Y+Q RVTR EY EHGVDWCTK RFGY++W+
Sbjct: 364 CVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/410 (64%), Positives = 326/410 (79%), Gaps = 2/410 (0%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63
           PI++DNGSYEIKFG   L++P+RA N LARDK+G Y+LSNQ+K I+++S+   RRP E G
Sbjct: 5   PIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRPHEFG 64

Query: 64  QLVSWELEEHIWDYCLFNSDEFS-WDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122
           QL SWELE  IWDYC FN DEF+ +DLKDSK   L+VSETCM+IPE+SK+MDQVVFEEYE
Sbjct: 65  QLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVFEEYE 124

Query: 123 FGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDD-YNDFQLVVDSGFNCTWVIPVIK 181
           F S+ K P+A + PF   +       D  P  + + D Y  FQLV+D GFNCTWV+PVIK
Sbjct: 125 FASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWVVPVIK 184

Query: 182 GVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYFDSFQ 241
           G+PYYKAVKKLDIGGRFL GLLKET+SFRHYN+MDETIL NNIKE C F+ PVSYF+SF+
Sbjct: 185 GIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSPVSYFESFK 244

Query: 242 KKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIANILKP 301
            K +T ++YVLPDFQTS +GYV+ PK+ +P+DSQT+ L+DELF++PETFFHPEI  +LKP
Sbjct: 245 HKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHPEIPQLLKP 304

Query: 302 GLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLP 361
           G+IET+LES+S+LPE +RPLM+ NI   GGNFN+ NFA+RLATELQRQ PTDW+  VHLP
Sbjct: 305 GIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHLP 364

Query: 362 KGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
            G  EL GW +M  F+N+  Y   RVTR EY EHGVDWCT++RFGY+ W+
Sbjct: 365 SGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/417 (63%), Positives = 324/417 (77%), Gaps = 8/417 (1%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62
            PI+IDNGSYEIKFG +S   P+ ALN +A+DKYG YHLSNQ++ I+++S+    RP +L
Sbjct: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPHKL 63

Query: 63  GQLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121
           GQLVSWELE  IWDYCLFN DEF  W L  +K+  LI SE+CM++PE+SK+MDQVVFEEY
Sbjct: 64  GQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVFEEY 123

Query: 122 EFGSLMKCPVAQYIPFDNMAD--YKVYGSDGLPVVRK-----KDDYNDFQLVVDSGFNCT 174
           E+ SL K PV  ++PF+   D  + +   +   VV         DY D++LV+DSGFNCT
Sbjct: 124 EYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFNCT 183

Query: 175 WVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPV 234
           WV+PVIKGVPYYKAVKKLDIGGRFL G L+E +SFRHYN+MDETIL N+IKE+C FM P 
Sbjct: 184 WVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPN 243

Query: 235 SYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPE 294
           SYFDSFQ + +T  +YVLPDF TS  GY+R+P Q +PEDSQT+ L+DELF +PETFFHPE
Sbjct: 244 SYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFFHPE 303

Query: 295 IANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDW 354
           IA++L PG+IE +LESISMLPE +RPL+V N+ V GGNFNI NFASRLATELQRQCPTDW
Sbjct: 304 IASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQRQCPTDW 363

Query: 355 SVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
           S RV +P GD  L GWK M +FS T +Y++ RV+R EY EHGVDWCT  RFGY+ W+
Sbjct: 364 SCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFGYQAWL 420

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/417 (64%), Positives = 335/417 (80%), Gaps = 8/417 (1%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62
            P++IDNGSY +KFGP+SL++PY ALN +A DKY   +LSNQ+K I+++S+  ++RP  L
Sbjct: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRPHTL 63

Query: 63  GQLVSWELEEHIWDYCLFNSDEFS-WDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121
           GQL SWE++  IWDYCL+N DEF+ +++ D+K   LI SETCM++PE+ K+MDQV+FEEY
Sbjct: 64  GQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIFEEY 123

Query: 122 EFGSLMKCPVAQYIPF-DNMADYKVYGS-DGLPVVR--KKDDYNDFQLVVDSGFNCTWVI 177
           EFGSLMK PVA Y+PF  N  D  + G  D  P V     ++Y DFQLVVDSGFNCTW+I
Sbjct: 124 EFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCTWII 183

Query: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYF 237
           PVIKG+PYYKAVKKLDIGGRFL GLLKET+SFRHYN+MDETIL NNIKE+C F+ P SYF
Sbjct: 184 PVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSPASYF 243

Query: 238 DSFQKKAETRIDYVLPDFQTSLIGYVR---QPKQAIPEDSQTLNLEDELFTIPETFFHPE 294
           DSF+ K  T  +YVLPDFQTS +GYVR   +  + +PEDSQ++ L+DELF +PETFFHPE
Sbjct: 244 DSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFFHPE 303

Query: 295 IANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDW 354
           I+ ILKPGL+ET+LES+SM+PE+IRPLMVSNI  IGGNFN+ +FASR+A ELQRQ PTDW
Sbjct: 304 ISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDW 363

Query: 355 SVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
             R+ + KG++EL GWKAM  F++TD YK  RVTR EY EHG+DWCTK+RFGY+ W+
Sbjct: 364 KCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQNWV 420

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/415 (64%), Positives = 323/415 (77%), Gaps = 7/415 (1%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63
           P+IIDNGSYEIKFG  S K P+RALN +A+DKYG YHLSNQ++ I+++S+    RP ELG
Sbjct: 5   PLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPHELG 64

Query: 64  QLVSWELEEHIWDYCLFNSDEFS-WDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122
           QLVSWELE  IWDYCLFN D+F+ W +  +K   LI SE+CM+IPE+SK+MDQVVFEEYE
Sbjct: 65  QLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVFEEYE 124

Query: 123 FGSLMKCPVAQYIPFD------NMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWV 176
           F ++ K PV  ++PF+      +M   K         V    +YNDFQLV+DSGFNC+W+
Sbjct: 125 FETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFNCSWI 184

Query: 177 IPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSY 236
           +PVIKGVPYYKAVKKLDIGGRFL G L+E +SFRHYN+MDETIL N+IKE C FM P +Y
Sbjct: 185 VPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMSPNAY 244

Query: 237 FDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIA 296
           F+SFQ +++T  +YVLPDF TS  GY+R+P Q +P +SQT+ L+DELF +PETFFHPEIA
Sbjct: 245 FESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFHPEIA 304

Query: 297 NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSV 356
           ++L  G++ET+LESISMLPE IRPLMV NI + GGNFNI NFASRLATELQRQCPTDWS 
Sbjct: 305 SLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSC 364

Query: 357 RVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
           RV LPKGD  L GWK M +FS T+ Y + RVTR EY EHGVDWCT  RFGY+ W+
Sbjct: 365 RVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/414 (63%), Positives = 326/414 (78%), Gaps = 11/414 (2%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELGQ 64
           ++IDNGSYEIKFG S    P RALNCL +DKY R+HLSNQ K++R++S   +RRP ELGQ
Sbjct: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPHELGQ 65

Query: 65  LVSWELEEHIWDYCLFNSDEFSWDL---KDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121
           LVSWELE  +WDYC +N D+F W+L    D+KD  L+VSET M+IPE+SK+MDQV+FEEY
Sbjct: 66  LVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQVIFEEY 125

Query: 122 EFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVV--RKKDDYNDFQLVVDSGFNCTWVIPV 179
           +F S+ K PVAQYIPF        Y  D +     +K   Y DFQLV+DSGFNCTW +P+
Sbjct: 126 DFKSMFKGPVAQYIPFYQGQ----YQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVPI 181

Query: 180 IKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYFDS 239
           IKGVPYYKA+KKLDIGGRFLTGLL+ET+SFRHYN+M+ETIL NNIKEQC F+PP SYF S
Sbjct: 182 IKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPPESYFSS 241

Query: 240 FQKKAETRIDYVLPDFQTSLIGYVRQP-KQAIPEDSQTLNLEDELFTIPETFFHPEIANI 298
           F  K  T+++YVLPDFQTS +GYV++P K+ + +D+QTL L DE+F++PETFFHPEIA I
Sbjct: 242 FHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVPETFFHPEIAQI 301

Query: 299 LKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRV 358
           LKPG++ET+LE I+M PE++RPL+V+NI   GGNFNI NF  RL TELQRQCP DWS +V
Sbjct: 302 LKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKV 361

Query: 359 HLPK-GDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
           H P+  D  L GW++M  F+N+D ++  RVTR EYLEHG+DWCTK RFGY+QW+
Sbjct: 362 HSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQWL 415

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/436 (61%), Positives = 330/436 (75%), Gaps = 30/436 (6%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63
           PI+IDNGSYEIKFGPS+ K P+RALN LA+DK+G  +LSN +K I+++S+   RRP ELG
Sbjct: 5   PIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELG 64

Query: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122
           QL  WELE  IWDYCLFN  EF  +DLK+ K   L+ SE+CM++PE+SKH DQV+FEEYE
Sbjct: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYE 124

Query: 123 FGSLMKCPVAQYIPFDNMADYK-----VYGSD-GLPVVR------------------KKD 158
           F SL K PVA ++PF     YK     + G D  + +VR                     
Sbjct: 125 FDSLFKSPVAVFVPF--TKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDSGS 182

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           DY+DFQLV+DSGFNCTW+IPV+KG+PYYKAVKKLDIGGRFLTGLLKET+SFRHYN+MDET
Sbjct: 183 DYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDET 242

Query: 219 ILANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQ---AIPEDSQ 275
           IL NNIKEQC F+ PVSYFDSF+ K +  ++YVLPDFQTS +GYVR P++    +PED+Q
Sbjct: 243 ILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQ 302

Query: 276 TLNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNI 335
            + L DELFTIPETFFHPEI+ I KPG++E +LES+SMLPE++RPLMV NI   GGNFN+
Sbjct: 303 IITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362

Query: 336 SNFASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEH 395
            NFA RLA ELQRQ PTDW+  V +P+GD  L GW+ M +F+ TDSY++ RVTR EY EH
Sbjct: 363 PNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEH 422

Query: 396 GVDWCTKYRFGYEQWI 411
           G DWCTK+RFGY+ WI
Sbjct: 423 GPDWCTKHRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/434 (61%), Positives = 329/434 (75%), Gaps = 26/434 (5%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63
           PI+IDNGSYEIKFGPS+ K P+RALN LA+DK+G  +LSN +K I+++S+   RRP ELG
Sbjct: 5   PIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHELG 64

Query: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122
           QL  WELE  IWDYCLFN  EF  +DLK+ K   L+ SE+CM++PE+SKH DQV+FEEYE
Sbjct: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYE 124

Query: 123 FGSLMKCPVAQYIPF--------------DNMADYKVYGSDGLPVVRKK--------DDY 160
           F SL K PVA ++PF              D  AD  +  SD      K+        +DY
Sbjct: 125 FDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDY 184

Query: 161 NDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETIL 220
           +DFQLV+DSGF+CTW+IPV+KG+PYYKAVKKLDIGGRFLTGLLKET+SFRHYN+MDETIL
Sbjct: 185 HDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETIL 244

Query: 221 ANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQ---AIPEDSQTL 277
            NNIKE+C F+ P SYFDSF+ K +  ++YVLPDFQTS IGYVR P +    +P D+Q++
Sbjct: 245 VNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSI 304

Query: 278 NLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISN 337
            L DELFTIPETFFHPEI+ I+KPG++E +LES+SMLPE++RPLM+ NI   GGNFN+ N
Sbjct: 305 TLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPN 364

Query: 338 FASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGV 397
           FA RLA ELQRQ PTDW+  V +P+GD  L GW+ M +F+ T+SY++ RVTR EY EHG 
Sbjct: 365 FAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGP 424

Query: 398 DWCTKYRFGYEQWI 411
           DWCTK+RFGY+ WI
Sbjct: 425 DWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/435 (60%), Positives = 327/435 (75%), Gaps = 28/435 (6%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63
           PI+IDNGSYEIKF PS+ + P+RALN LA+DK+G  +LSN +K I+++S+   RRP ELG
Sbjct: 5   PIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELG 64

Query: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122
           QL  WELE  IWDYC FN  EF  +DLK+ K   L+ SE+CM++PE+SKH DQV+FEEYE
Sbjct: 65  QLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYE 124

Query: 123 FGSLMKCPVAQYIPF--------------DNMADYKVYGSDGLPVVRKKD---------D 159
           F SL K PVA ++PF              D  AD  V  + G+     ++         D
Sbjct: 125 FDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADV-VTSNSGITTFTSRECGSAQNSDSD 183

Query: 160 YNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETI 219
           Y+DFQLV+DSGFNCTW+IPV+KG+PYYKAVKKLDIGGRFLTGLLKET+SFRHYN+MDETI
Sbjct: 184 YHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETI 243

Query: 220 LANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQ---AIPEDSQT 276
           L NN+KE+C F+ PVSYFDSF+ K +  ++YVLPDFQTS IGYVR P++    +PED+QT
Sbjct: 244 LVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQT 303

Query: 277 LNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNIS 336
           + L DELFTIPETFFHPEI+ I KPG++E +LES+SMLPE++RPLMV NI   GGNFN+ 
Sbjct: 304 IALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLP 363

Query: 337 NFASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
           NFA RLA ELQRQ PTDW+  V +P GD  L GW+ M +F+ T+SY++ RVTR EY EHG
Sbjct: 364 NFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEHG 423

Query: 397 VDWCTKYRFGYEQWI 411
            DWCTK RFGY+ WI
Sbjct: 424 PDWCTKQRFGYQNWI 438

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/435 (61%), Positives = 327/435 (75%), Gaps = 26/435 (5%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62
            PI+IDNGSYEIKFGPS+ + P+RALN LA+DK+G  +LSN +K I+++S+   RRP EL
Sbjct: 4   APIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHEL 63

Query: 63  GQLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121
           GQL  WELE  IWDYC FN  EF  +DLK+ K   L+ SE+CM++PE+SKH DQV+FEEY
Sbjct: 64  GQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEY 123

Query: 122 EFGSLMKCPVAQYIPF--------------DNMADYKVYGSD--GLPVVRKKD------D 159
           EF SL K PVA ++PF              D  AD  V  S+   +P    +D      D
Sbjct: 124 EFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKFDSD 183

Query: 160 YNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETI 219
           Y+DFQLV+DSGFNCTW+IPV+KG+PYYKAVKKLD+GGRFLTGLLKET+SFRHYN+MDETI
Sbjct: 184 YHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI 243

Query: 220 LANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQA---IPEDSQT 276
           L NNIKE+C F+ PVSYFDSF+ K +  ++YVLPDFQTS +GYVR  ++    + ED+QT
Sbjct: 244 LVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQT 303

Query: 277 LNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNIS 336
           + L DELFTIPETFFHPEIA I KPG++E +LES+SMLPE++RPLMV NI   GGNFN+ 
Sbjct: 304 ITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLP 363

Query: 337 NFASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
           NFA RLA ELQRQ PTDW+  V +P+ D  L GW+ M +FS+T SY+  RVTR EY EHG
Sbjct: 364 NFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHG 423

Query: 397 VDWCTKYRFGYEQWI 411
            DWCTK+RFGY+ WI
Sbjct: 424 SDWCTKHRFGYQNWI 438

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/417 (62%), Positives = 323/417 (77%), Gaps = 10/417 (2%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63
           PI IDNGSYEIKFG + L SPYRA+N  A DKY   +LSNQ+K I+++++   RRP ELG
Sbjct: 5   PIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRPHELG 64

Query: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122
           QL SWELE  IWDY LFN DEF  +DL D K   LI SETCM++PE+SK+MDQVVFEEYE
Sbjct: 65  QLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVFEEYE 124

Query: 123 FGSLMKCPVAQYIPFDNMADYKVYGS--------DGLPVVRKKDDYNDFQLVVDSGFNCT 174
           F S  K  +A +I F +  + K+           D +  VR+K+ YND+QLV+DSGFNCT
Sbjct: 125 FDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKE-YNDYQLVIDSGFNCT 183

Query: 175 WVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPV 234
           W+IPVIKGVPYYKAVKKLDIGGRFL GLLKET+SFRHY++MDETIL NNIKE C F+ P 
Sbjct: 184 WIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFVSPT 243

Query: 235 SYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPE 294
           SYFDSF+ K ET ++YVLP+FQT+ +G+VR   + +PE++QT+ L DELF++PETFFHPE
Sbjct: 244 SYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETFFHPE 303

Query: 295 IANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDW 354
           IA ILKPGL+ET+LES+SM+PEL+RPL+V N+   GGNFN+ +FA+RL +ELQRQ PTDW
Sbjct: 304 IARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPTDW 363

Query: 355 SVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
             R  +P  + EL GWKAM +F++T+SY++ RVTR EY EHG DW TK RFGY+ WI
Sbjct: 364 ICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNWI 420

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/439 (56%), Positives = 333/439 (75%), Gaps = 30/439 (6%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62
           +PI+IDNGSYEIKFG S+ + P+RA+N +A+DKY   +LSNQ+K I+++S+ + RRP+EL
Sbjct: 4   LPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRPYEL 63

Query: 63  GQLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121
           GQL SWELE  IWDYC +N +EF  + L+D+    L++SETC+S+PE S+++D ++FEEY
Sbjct: 64  GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIFEEY 123

Query: 122 EFGSLMKCPVAQYIPFDNMA----------------------------DYKVYGSDGLPV 153
            +GS+ K PVA +IPF ++                             D   Y S   P 
Sbjct: 124 NYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSEEPS 183

Query: 154 VRKKDDYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYN 213
           V K  +Y DFQL++DSGFNCTW+IPVIKG+PYYKA+KK+DIGGRFLTGLLKET+SFRHYN
Sbjct: 184 VTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHYN 243

Query: 214 LMDETILANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVR-QPKQAIPE 272
           + DETIL NNIKE+C F+ P SY +SF+ K +T ++YVLPDF T+ +GY++   K  +P+
Sbjct: 244 VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPD 303

Query: 273 DSQTLNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGN 332
           ++Q + L+DELF++ ET FHPEI+ ILKPG+IET++ES+SMLPE+IRPLMV+NI  IGGN
Sbjct: 304 NAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGN 363

Query: 333 FNISNFASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEY 392
           FN+ NF+ RL +ELQRQ PTDW+  V++PK D EL GWKAM +FS+TDSY++ R+TR EY
Sbjct: 364 FNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEY 423

Query: 393 LEHGVDWCTKYRFGYEQWI 411
           +EHGV+WCTK+RFGY+ WI
Sbjct: 424 MEHGVEWCTKHRFGYQNWI 442

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/415 (61%), Positives = 324/415 (78%), Gaps = 7/415 (1%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63
           P+++DNGSYE+KFG S+   P+RALN LARDK+G  +LSNQ+ QI+++S+   +RP E G
Sbjct: 5   PLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPHEYG 64

Query: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122
           QL SWEL+  +WDYC FN +EF  +DLKDSK   LI SETCM++PE+SK+MDQVVFEEYE
Sbjct: 65  QLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFEEYE 124

Query: 123 FGSLMKCPVAQYIPFD-NMADYKVYGSDG----LPVVRKKDDYNDFQLVVDSGFNCTWVI 177
           F SL+K P++ ++PF  +  + KV    G         +  DY  FQ+V+DSGFNCTWV+
Sbjct: 125 FDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMVIDSGFNCTWVV 184

Query: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYF 237
           P+IKGVP+YKAVKKLD+GGRF+ GLLKET+SFRHYN+MDETIL NNIKE+C FM PVSYF
Sbjct: 185 PIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSYF 244

Query: 238 DSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIAN 297
           DSF KK +T ++YVLPDFQT+ +GYV   K    +D+QT+ L DELF++PETFFHPEIA 
Sbjct: 245 DSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHPEIAQ 304

Query: 298 ILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVR 357
           +LKPG+IET+LES+S++PE +RPLMVSNI   GGNFN+ +F  RLATELQRQ PTDWS +
Sbjct: 305 LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAK 364

Query: 358 VHLPKGDT-ELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
           ++LP+  + EL GW +M  F++TD YK  RV+R EY EHGV+W TK RFGY+ WI
Sbjct: 365 IYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/423 (60%), Positives = 328/423 (77%), Gaps = 15/423 (3%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELG 63
           PI+IDNGSYE+KFG S  K P RALN LA+DKYG ++LSNQM  I+++S+  +RRP ELG
Sbjct: 5   PIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRPHELG 64

Query: 64  QLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYE 122
           QLVSWELE  +WDYC FN DEF +++LK++K   L+VSETCM++PE+S +MDQV+FEEYE
Sbjct: 65  QLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMFEEYE 124

Query: 123 FGSLMKCPVAQYIPFDNMAD-YKVYGSDGLPVVRK----------KDDYNDFQLVVDSGF 171
           F SL K PVA ++PF N+ D  K+    G  V+            K+ Y+DF LV+DSGF
Sbjct: 125 FESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVIDSGF 184

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFM 231
           NCTW+IP+IKGVPYYKAVKK+++GGRFL GL KET+S+RHY++ DETIL NNIKE+C FM
Sbjct: 185 NCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEKCLFM 244

Query: 232 PPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPK--QAIPEDSQTLNLEDELFTIPET 289
            P SY DSF+ K    +DYVLPDFQTS IGYV+  K    +PE+SQ + L DELF++PET
Sbjct: 245 SPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFSVPET 304

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            FHPE+A +LKPG++ET+LES+S++PE IRPL+V+NI  +GGNFN+ NF SRLATELQRQ
Sbjct: 305 IFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQ 364

Query: 350 CPTDWSVRVHLPKGDTELQGWKAMMRFS-NTDSYKQGRVTRAEYLEHGVDWCTKYRFGYE 408
            PTDW   +++P+ D ELQGWK+M +F+ NTD YK+ R++R EY EHG DW TK RFGY+
Sbjct: 365 LPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRFGYQ 424

Query: 409 QWI 411
            WI
Sbjct: 425 NWI 427

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/436 (59%), Positives = 330/436 (75%), Gaps = 27/436 (6%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62
            P+++DNGSYEIKFG S+ + PYRALN  A DKYG  +LSNQMK+I+EVS   +RRP EL
Sbjct: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRPHEL 63

Query: 63  GQLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121
           GQL SWELE  IWDYCL+N DEF  ++L  S    LIVSE CM++PE+SK+MDQV+FEEY
Sbjct: 64  GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIFEEY 123

Query: 122 EFGSLMKCPVAQYIPFDNMADYK-----------------------VYGSDGLPVVRKK- 157
           EF SL K P A YIPF   AD +                          +D L   +KK 
Sbjct: 124 EFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDKKKF 183

Query: 158 -DDYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMD 216
            +DY D++LV+DSGFNCTW+IP+IKGVPYYKA+KKLDIGGRFLTGLLKET+SFRHY+LMD
Sbjct: 184 SNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMD 243

Query: 217 ETILANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPK-QAIPEDSQ 275
           ET+L NNIKE+C F+ P SYFDSF+ K ET ++Y+LPD  +S +GY R+ K + +PE SQ
Sbjct: 244 ETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQ 303

Query: 276 TLNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNI 335
            + L DELF++PETFFHPEI+ ILKPG++ET+LES+SM+PE++RPL+V+NI   GGNFN+
Sbjct: 304 VVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNL 363

Query: 336 SNFASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEH 395
            +FA+RLA ELQRQ PTDW+ R+ +PK + EL  WK+M +F+NTDSYK+ R+++ EY EH
Sbjct: 364 PHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEYYEH 423

Query: 396 GVDWCTKYRFGYEQWI 411
           G DW TK++FGY+ W+
Sbjct: 424 GPDWLTKHKFGYQNWL 439

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/415 (60%), Positives = 315/415 (75%), Gaps = 8/415 (1%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELGQ 64
           I+IDNGSY++KFG +S   P  ALN LA+DKYG  HLSNQ++ I+++S+   RRP ELGQ
Sbjct: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66

Query: 65  LVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYEFG 124
           L SWELE  IWDYCL+N DEF  D +  ++  +++SETCM++PE+SK+ DQV+FEEYE  
Sbjct: 67  LTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEVD 126

Query: 125 SLMKCPVAQYIPF----DNMADYKVYGSDGLPVVRKK----DDYNDFQLVVDSGFNCTWV 176
           SL K P A YIPF    +N+         G   + +K     +YNDF LV+DSGFNCTWV
Sbjct: 127 SLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNCTWV 186

Query: 177 IPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSY 236
           IP++KGVPYYKAVKKLD+GGRFL GLLKET+SFRHYN+MDE+IL NNIKEQC ++ PVSY
Sbjct: 187 IPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDPVSY 246

Query: 237 FDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIA 296
           F++F+ K + +ID+VLPDFQTS  GYVR PK A+P+++Q L L DE F++PE FFHPEI+
Sbjct: 247 FEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPEIS 306

Query: 297 NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSV 356
             LKPG+IETVLESI MLPEL+RPLM SNI  +GGNFN+  F  RL +ELQRQ PTDW  
Sbjct: 307 QSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVC 366

Query: 357 RVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
           R  +  GD  L GW AM +F++TD+YK+ RVT+ +Y EHG+DW TK RFGY+ W+
Sbjct: 367 RAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/423 (59%), Positives = 323/423 (76%), Gaps = 14/423 (3%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62
           VP +IDNGSYEIKFG ++L +P+RA N +A+DKYG  +LSN MK IR++S+  +RRP EL
Sbjct: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61

Query: 63  GQLVSWELEEHIWDYCLFNSDEF-SWDLKD-SKDVDLIVSETCMSIPEISKHMDQVVFEE 120
           GQLVSWELE  IWDYCL+N DEF  + L D +++ DLI++ETC ++PE+SK+ DQVVFEE
Sbjct: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121

Query: 121 YEFGSLMKCPVAQYIPFDNMADYK----VYGSDGLP----VVRKKDDYNDFQLVVDSGFN 172
           YEF ++ K P + ++PF N+   K    + G D             +Y DFQLV+DSGFN
Sbjct: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRDFQLVIDSGFN 181

Query: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMP 232
           CTWV+P+IKGVP+YKA+KK+DIGGRFL GLLKET+SFRHYN+MDETIL NNIKE+C F+ 
Sbjct: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVS 241

Query: 233 PVSYFDSFQKKAETRIDYVLPDFQTSLIGYV--RQPKQAIPEDS-QTLNLEDELFTIPET 289
           PVSYFDSF+ K +  ++YVLPDFQTS +GY+     ++ I   S QT+ L DE F +PET
Sbjct: 242 PVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPET 301

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
           FFHPE+ANILKPGL+ET+LE+ISM+PE +RP++VSNI  +GGNF + + +SRL +ELQRQ
Sbjct: 302 FFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQ 361

Query: 350 CPTDWSVRVHLP-KGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYE 408
            PTDW+ RV +P   D EL  W AM +FS+TD YK  RVTR EYLEHG DWC+K+RF Y+
Sbjct: 362 LPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQ 421

Query: 409 QWI 411
            WI
Sbjct: 422 NWI 424

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  507 bits (1306), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 240/425 (56%), Positives = 324/425 (76%), Gaps = 18/425 (4%)

Query: 1   MG-VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRP 59
           MG  P++IDNGSYEIKFG S+ ++P+ ALN LA+DKY  Y+LSNQ+  I+++S+  ++RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 60  FELGQLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVF 118
            +LGQLVSWELE  IWDYC +N D+F  +++ +  +  L+++ET M++PE+S++ DQVVF
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 119 EEYEFGSLMKCPVAQYIPF---DNMADYKVYGS-----DGLPVVRKKDDYNDFQLVVDSG 170
           EEY F SL K P A +IPF   D+ +  ++ G      DG     K+++Y DF LV+DSG
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDG----SKENNYQDFNLVIDSG 176

Query: 171 FNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCF 230
           +NC+W+IP+IKGVPYYKAVKK+D+GGRFL GLLKET+S+RHY++ DE++L NNIKE C F
Sbjct: 177 YNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMF 236

Query: 231 MPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQ--AIPEDSQTLNLEDELFTIPE 288
           + PVSY +SF+KKA T+++YVLPDFQTS +GYVR  K+   +PE SQ++ LEDELF++PE
Sbjct: 237 ISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPE 296

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
            FFHPE+AN+LKPG+IET+LES+ +LPE +R LMV+NI   GGNFNI NF SR+ TELQ+
Sbjct: 297 GFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQK 356

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFS--NTDSYKQGRVTRAEYLEHGVDWCTKYRFG 406
           Q  T+W   V +PK + ELQ WKAM  F+  N + YK  RVT+ EY EHG +W TK RFG
Sbjct: 357 QVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFG 416

Query: 407 YEQWI 411
           Y+ W+
Sbjct: 417 YQNWL 421

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 104/416 (25%), Positives = 181/416 (43%), Gaps = 62/416 (14%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP----YRALNCLARDKY------GRYHLSNQMKQIREVSN 53
           PI++DNGS  IK G S  + P    Y  +  +  +K       G   + NQ +++R +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W   EHIW Y +FN    S  L++ +D  ++++E  ++     + M
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSY-VFNK---SLQLQNVEDHPILITEAPLNPRNNRERM 122

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            +++FE +   +L       Y+     A   +Y S                 VVD G  C
Sbjct: 123 CELLFESFNVPAL-------YVSIQ--AVLSLYASG-----------RTTGCVVDCGDGC 162

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGR----FLTGLLKETVSFRHYNLMDETILANNIKEQCC 229
              +PV  G     +++++DI GR    FL  LL++T      +  +  ++   IKE+ C
Sbjct: 163 CHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREVV-RIIKEKAC 221

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           ++    +        E +   + P++           K  +P D +T++L  E F  PE 
Sbjct: 222 YVAKDPHI-------EEQNFSINPNYT----------KFKLP-DGKTIDLGQEKFRAPEI 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F PE+       L +   +SI  +   +R L+ SN+ + GG   +  F  RL +EL+  
Sbjct: 264 LFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSILPGFGDRLLSELKSL 323

Query: 350 CPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
             +   +++  P  + +   W      S   ++K+  VTRAE+ E   D C   RF
Sbjct: 324 SDSQTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKLWVTRAEW-EEAAD-CIHSRF 376

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 95.1 bits (235), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 100/415 (24%), Positives = 174/415 (41%), Gaps = 60/415 (14%)

Query: 4   PIIIDNGSYEIKFG------PSSLKSPYRALNCLARDKYGRYH----LSNQMKQIREVSN 53
           PI++DNGS  IK G      P   +     +   ++   GR+     + NQ ++IR +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G +  W   E +W +      E    L   +D  ++V+E  ++  +  + M
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVF----EKGLQLSSLQDHPVLVTEAPLNPKKNREQM 125

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            +++FE +          A Y+     A   +Y S                 V+DSG  C
Sbjct: 126 CELLFETFSV-------PAVYVSIQ--AVLSLYASG-----------RTTGCVLDSGDGC 165

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETV-SFRHYNLMD--ETILANNIKEQCCF 230
           +  +PV  G     A++++DI GR ++ LL+  +      +L+   E  +   IKE+ C+
Sbjct: 166 SHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIRKSTGVSLLSSSEREIVRIIKEKACY 225

Query: 231 MPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETF 290
           +       +   K E + +Y +   QT      R P      D + + L++E F  PE  
Sbjct: 226 I-------ALDPKEEEK-NYTMHGKQTMF----RLP------DGKQIELDNEKFRAPEIL 267

Query: 291 FHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQC 350
           F+P++       L E + ESI  +   +R  + SNI   GG   I  F  R+  EL+  C
Sbjct: 268 FNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGDRVLKELKLSC 327

Query: 351 PTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
                +++  P  + +   W      S   ++K+  VT+ E+ E+    C   RF
Sbjct: 328 EPQTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKIWVTKKEWEEN--PRCVHARF 379

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 99/405 (24%), Positives = 173/405 (42%), Gaps = 60/405 (14%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP----YRALNCLARDKY------GRYHLSNQMKQIREVSN 53
           P+++DNGS  IK G S  + P    Y  +     +K       G   + NQ +++R +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P + G + +W   E +W Y +FN    S  L++ +D   +V+E  ++  +  + M
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGY-VFNK---SLQLQNVEDHPNLVTEAPLNPHKNREKM 150

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            +++FE +   +L       Y+     A   +Y S                 VVD G  C
Sbjct: 151 CELLFESFNVPAL-------YVSVQ--AVLSLYASG-----------RTTGCVVDCGDGC 190

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGR----FLTGLLKETVSFRHYNLMDETILANNIKEQCC 229
              +PV  G     +++++DI GR    FL  LL++T      +  +  I+   IKE+ C
Sbjct: 191 CHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREIV-RTIKEKAC 249

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           F+       +   K E +   + P F           K  +P D +T+ L  E +  PE 
Sbjct: 250 FV-------TKDPKLEEQNFPMNPSFS----------KFKLP-DGKTIELGQERYRAPEI 291

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F PE+       L +   +SI  +   +R L+ SNI + GG   +  F  RL  EL+  
Sbjct: 292 LFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLPGFGDRLLKELKSL 351

Query: 350 CPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLE 394
             +   +++  P  + +   W      S   ++K+  VT++E+ E
Sbjct: 352 SGSRTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKLWVTKSEWEE 395

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 92.4 bits (228), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 92/369 (24%), Positives = 156/369 (42%), Gaps = 60/369 (16%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLARDKYGRYHLSNQMKQIREV----------S 52
           PI++D G+  +K G +    P Y   + + R        +N    +R++          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVRS 65

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  FN       L ++    ++++E  M+  +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ----MKLNNTSGGKILLTEPPMNPLKNREK 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D +T+ +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTKLARETTTLVESYELP------DGRTIKVGQERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P + ++ +PG+ E +  +I      +R  +   I + GG+       SRL  EL++ 
Sbjct: 264 LFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQL 323

Query: 350 CPTDWSVRV 358
               W  RV
Sbjct: 324 ----WYTRV 328

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 92/410 (22%), Positives = 164/410 (40%), Gaps = 69/410 (16%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHV-------- 56
           ++IDNGS   K G +   +P      +     GR      M  + +  +C+V        
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIV----GRPRHQGIMVGMGQ-KDCYVGDEAQSKR 63

Query: 57  -----RRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISK 111
                R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     +
Sbjct: 64  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNRE 118

Query: 112 HMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
            M Q++FE +   +        Y+     A   +Y S                +V+DSG 
Sbjct: 119 KMTQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGD 158

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCC 229
             T V+P+  G     A+ ++D+ GR +T  L + +S R Y+     E  +  +IKE+ C
Sbjct: 159 GVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLC 218

Query: 230 FMPPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTI 286
           ++  + Y    Q  A++      Y LPD Q   IG                   +E F  
Sbjct: 219 YVA-LDYDQEMQTAAQSSAIEKSYELPDGQVITIG-------------------NERFRA 258

Query: 287 PETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATEL 346
           PE  FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+
Sbjct: 259 PEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEI 318

Query: 347 QRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
               P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 319 TALAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 367

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 92/408 (22%), Positives = 166/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP I ++   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 166/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP + ++   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMEVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 165/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 165/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 165/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 165/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 165/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 90/408 (22%), Positives = 165/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQILFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR +T  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSAIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 97/418 (23%), Positives = 176/418 (42%), Gaps = 66/418 (15%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP----YRALNC------LARDKYGRYHLSNQMKQIREVSN 53
           PI++DNGS  IK G S  + P    Y  +        +A    G   + NQ +++R +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL-- 68

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W   E IW++    S      L + ++  ++ +E  ++  +  + M
Sbjct: 69  LKLRYPLEHGIVKNWSDMELIWNHVFHKS----LQLNNIEEHPVLATEAPLNPLKNREAM 124

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            +++FE +          A Y+     A   +Y S                 V+D G  C
Sbjct: 125 CEMLFETFNV-------PAVYVSIQ--AVLSLYASG-----------RTTGCVLDCGDGC 164

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGR----FLTGLLKETVSFRHYNLMDETILANNIKEQCC 229
              +PV  G     +++++D+ GR    FL  LL++T      +  +  I+   IKE+ C
Sbjct: 165 CHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREIV-RIIKEKAC 223

Query: 230 FMP--PVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIP 287
           ++   P++   ++     + I + LPD                    + L+L++E F  P
Sbjct: 224 YVARDPLTEEQTYHLTPTSTI-FKLPD-------------------GKVLDLKNEKFRAP 263

Query: 288 ETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQ 347
           E  F P++       + E   +SIS +   +RP ++SNI + GG      F  RL TEL+
Sbjct: 264 EVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMFPGFGDRLLTELR 323

Query: 348 RQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
                   +++  P  + +   W      S   ++K+  VT++E+ E+    C   RF
Sbjct: 324 NLSEPQTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKIWVTKSEWQEN--PDCVHSRF 378

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 90/408 (22%), Positives = 165/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 65

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 120

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 121 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 160

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR +T  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 161 THVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 220

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 221 A-LDFEQEMQTAAQSSAIEKSYELPDGQVITIG-------------------NERFRAPE 260

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 261 ALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 320

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 321 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 367

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 165/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAET---RIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 165/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAET---RIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 166/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP + ++   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 91/408 (22%), Positives = 166/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSVEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP + ++   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 89.4 bits (220), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 79/346 (22%), Positives = 143/346 (41%), Gaps = 51/346 (14%)

Query: 56  VRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQ 115
           +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M Q
Sbjct: 52  LRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKMTQ 106

Query: 116 VVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTW 175
           ++FE +   +        Y+     A   +Y S                +V+DSG   T 
Sbjct: 107 IMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGVTH 146

Query: 176 VIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFMPP 233
           V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++  
Sbjct: 147 VVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA- 205

Query: 234 VSYFDSFQKKAET---RIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETF 290
           + +    Q  A++      Y LPD Q   IG                   +E F  PE  
Sbjct: 206 LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEAL 246

Query: 291 FHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQC 350
           FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+    
Sbjct: 247 FHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALA 306

Query: 351 PTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
           P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 307 PSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 351

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 89.4 bits (220), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 93/369 (25%), Positives = 159/369 (43%), Gaps = 60/369 (16%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQI------REV-S 52
           PI++D G+  +K G +    P Y   + + R       R +++  +K I       EV S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  F        L  + +  ++++E  M+  +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPTTSNGKILLTEPPMNPTKNREK 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D +T+ +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTKLARETTTLVESYELP------DGRTIKVGQERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P + ++ +PG+ E + +++      +R  +   I + GG+       SRL  EL++ 
Sbjct: 264 LFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQL 323

Query: 350 CPTDWSVRV 358
               W  RV
Sbjct: 324 ----WFTRV 328

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 89.0 bits (219), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 90/408 (22%), Positives = 166/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  +++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTASQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG+      A R+  E+  
Sbjct: 260 ALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 89.0 bits (219), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 98/377 (25%), Positives = 159/377 (42%), Gaps = 62/377 (16%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQI------REV-S 52
           PI++D G+  +K G +    P Y   + + R       R  +S  +K I       EV S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEASEVRS 65

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  FN       L  +    ++++E  M+  +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ----MKLPTTSGGKVLLTEPPMNPVKNRER 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFERYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKVC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D + + +  E F  PE 
Sbjct: 221 Y---VSY--------DLNLDTKLARETTTLVQEYELP------DGRIIKVGQERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P++ ++  PG+ E +  +I      +R  +   I + GG+       SRL  EL++ 
Sbjct: 264 LFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRLERELKQL 323

Query: 350 CPTDWSVRVHLPKGDTE 366
               W  R+   KGD E
Sbjct: 324 ----WFTRIL--KGDAE 334

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 90/408 (22%), Positives = 164/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G      + ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAET---RIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 89/408 (21%), Positives = 164/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQILFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G      + ++D+ GR +T  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTAAQSSAIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/408 (21%), Positives = 166/408 (40%), Gaps = 65/408 (15%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKNNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQILFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G     A+ ++D+ GR +T  L + ++ R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  +++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 A-LDFEQEMQTASQSSAVEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             FHP + ++   G+ +T   SI      +R  +  NI + GG       A R+  E+  
Sbjct: 260 ALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITA 319

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
             P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 320 LAPSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 91/359 (25%), Positives = 155/359 (43%), Gaps = 56/359 (15%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQI---REVSNC-- 54
           PI++D G+  +K G +    P Y   + + R       R  +S  +K I    E S+   
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEASDVRS 65

Query: 55  --HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W+  EH+WDY  +N  +F      +    ++++E  M+  +  + 
Sbjct: 66  YLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFP----STSGGKILLTEPPMNPLKNREL 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+  
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLS 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T L+     P      D + + +  E F  PE 
Sbjct: 221 Y---VSY--------DLNLDTKLARETTVLVENYELP------DGRVIKVGQERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
            F P++ ++ +PG+ E +  +I      IR  +   I + GG+       SRL  EL++
Sbjct: 264 LFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 96/370 (25%), Positives = 154/370 (41%), Gaps = 60/370 (16%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQI------REV- 51
            PI++D G+  +K G +    P Y   + + R       R H S  +K I       EV 
Sbjct: 5   TPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR 64

Query: 52  SNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISK 111
           S   +  P E G + +W   E +WDY  F        L  +    ++++E  M+  +  +
Sbjct: 65  SYLQISYPMENGIIRNWADMELLWDYAFFE----QMKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 112 HMDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSG 170
            M +V+FE+Y+FG         Y+     +A Y    S G              +VVDSG
Sbjct: 121 QMCEVMFEKYDFG-------GTYVAIQAVLALYAQGLSSG--------------VVVDSG 159

Query: 171 FNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQC 228
              T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ 
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 229 CFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
           C+   VSY        +  +D  L    T+L+     P      D + + +  E F  PE
Sbjct: 220 CY---VSY--------DLDLDTKLARETTTLVESYELP------DGRVIKVGPERFEAPE 262

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             F P + ++ +PG+ E +  +I      IR  +   I + GG+       SRL  EL++
Sbjct: 263 CLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

Query: 349 QCPTDWSVRV 358
                W  RV
Sbjct: 323 L----WFTRV 328

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 90/359 (25%), Positives = 155/359 (43%), Gaps = 56/359 (15%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQIR---EVSNC-- 54
           PI++D G+  +K G +    P Y   + + R       R  ++  +K I    E S+   
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 55  --HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  F        L+ + +  ++++E  M+  +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLQSTSNGKILLTEPPMNPLKNREK 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D +T+ +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTKLARETTTLVESYELP------DGRTIKVGQERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
            F P + ++ +PG+ E +  ++      IR  +   I + GG+       SRL  EL++
Sbjct: 264 LFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/346 (22%), Positives = 142/346 (41%), Gaps = 51/346 (14%)

Query: 56  VRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQ 115
           +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M Q
Sbjct: 52  LRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKMTQ 106

Query: 116 VVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTW 175
           ++FE +   +        Y+     A   +Y S                +V+DSG   T 
Sbjct: 107 ILFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGVTH 146

Query: 176 VIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFMPP 233
           V+P+  G      + ++D+ GR +T  L + +S R Y+     E  +  +IKE+ C++  
Sbjct: 147 VVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA- 205

Query: 234 VSYFDSFQKKAETRI---DYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETF 290
           + +    Q  A++      Y LPD Q   IG                   +E F  PE  
Sbjct: 206 LDFEQEMQTAAQSSAIEKSYELPDGQVITIG-------------------NERFRAPEAL 246

Query: 291 FHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQC 350
           FHP +  +   G+ +T   SI      +R  +  NI + GG       A R+  E+    
Sbjct: 247 FHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALA 306

Query: 351 PTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396
           P+   V++  P  + +   W      ++  +++Q  +++ EY E G
Sbjct: 307 PSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 351

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 86.7 bits (213), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 90/359 (25%), Positives = 154/359 (42%), Gaps = 56/359 (15%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQIR---EVSNC-- 54
           PI++D G+  +K G +    P Y   + + R       R  ++  +K I    E S+   
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 55  --HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  F        L  + +  ++++E  M+  +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPSTSNGKILLTEPPMNPLKNREK 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D +T+ +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTKLARETTALVESYELP------DGRTIKVGQERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
            F P + ++ +PG+ E +  ++      IR  +   I + GG+       SRL  EL++
Sbjct: 264 LFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 86.7 bits (213), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 91/359 (25%), Positives = 154/359 (42%), Gaps = 56/359 (15%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQI------REV-S 52
           PI++D G+  +K G +    P Y   + + R       R  ++  +K I       EV S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRS 65

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  F        L  + +  ++++E  M+  +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPSTSNGKILLTEPPMNPLKNREK 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D +T+ +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTKLARETTALVESYELP------DGRTIKVGQERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
            F P + ++ +PG+ E +  ++      IR  +   I + GG+       SRL  EL++
Sbjct: 264 LFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 100/424 (23%), Positives = 173/424 (40%), Gaps = 74/424 (17%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPY-RALNCLARDKYGRYHLSNQMKQ--IREVSN------- 53
           P+++DNGS  IK G S    P     N +   KY +  L+N +    +  + N       
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 54  -CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVD---LIVSETCMSIPEI 109
              +R P   G + +W+  E +W +  FN      D+    D D   L+++E  ++  + 
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHT-FN------DILKINDFDEHPLLITEAPLNPEKN 122

Query: 110 SKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDS 169
              M +V FE+++F        A YI   N +   +Y S                 V+D 
Sbjct: 123 RDKMCEVFFEKFDF-------AAVYIA--NPSTLSLYASG-----------RTTGCVLDC 162

Query: 170 GFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMD-----ETILANNI 224
           G      +P+ +G     +++++D+GGR +T  L+     R Y  +      E  +  N+
Sbjct: 163 GDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQIRKYTGISLYSSSEHEIVKNV 220

Query: 225 KEQCCFMPPVSYFD---SFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLED 281
           KE+ C++      D   S     + R  + LPD                    + L L+ 
Sbjct: 221 KEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPD-------------------GKDLILDK 261

Query: 282 ELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASR 341
             F  PE  F P+I  +    + +   ESIS +   +RP + S+I + GG+     F  R
Sbjct: 262 ARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGGSTMFRGFGDR 321

Query: 342 LATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCT 401
           L  ELQ +      +++  P  + +   W      +   ++KQ  +T+AE+ E   D   
Sbjct: 322 LLKELQIRTGNKNLIKIIAPP-ERKYTSWIGGSILTGLSTFKQLWMTKAEWQE---DNNL 377

Query: 402 KYRF 405
           +YRF
Sbjct: 378 RYRF 381

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 93/408 (22%), Positives = 176/408 (43%), Gaps = 62/408 (15%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYR-ALNCLARDKYGRYHLSNQMKQI-REVSN-------- 53
           PI+IDNGS  IK G S    P     N     KY +  ++ Q++ + + + N        
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             ++ P   G + +W+  E +W + +FN    + ++++ ++  L+++E  ++I +    M
Sbjct: 71  LRLQHPMNRGVVDNWDDMELLW-WHIFND---TLNVQNIEEHPLLITEAPLTIEKQRHIM 126

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            + +FE +   SL       Y+   N +   +Y S            N    VVD G   
Sbjct: 127 CERLFETFNIPSL-------YVA--NPSVLSLYASG-----------NTTGCVVDCGDGY 166

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLL----KETVSFRHYNLMDETILANNIKEQCC 229
               P+ +G     +++K+++GGR +T  L    +++     Y+  +E  +   IKE+ C
Sbjct: 167 CSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYS-SNEKEIVRTIKEKVC 225

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIP---EDSQTLNLEDELFTI 286
           ++      + F K  E+               Y+RQ + +      D + L L  E F  
Sbjct: 226 YIS-----EDFNKSEESY--------------YLRQDEMSCKFKLPDGKELTLNKERFRS 266

Query: 287 PETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATEL 346
           PE  F+P++  +    +     ESIS +   +RP + SNI + GG+     F SRL  +L
Sbjct: 267 PEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFKGFGSRLLGDL 326

Query: 347 QRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLE 394
           Q        +++  P  + +   W      +   ++K   VT++++ E
Sbjct: 327 QELTNNRAKIKILAPP-ERKYTSWIGGSILTGLSTFKNLWVTKSDWEE 373

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 90/359 (25%), Positives = 153/359 (42%), Gaps = 56/359 (15%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQIR---EVSNC-- 54
           PI++D G+  +K G +    P Y   + + R       R  ++  +K I    E S+   
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVRS 65

Query: 55  --HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  F        L  + +  ++++E  M+  +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPSTSNGKILLTEPPMNPLKNREK 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T L+     P      D +T+ +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTKLARETTVLVESYELP------DGRTIKVGQERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
            F P + ++ +PG+ E +  ++      IR  +   I + GG+       SRL  EL++
Sbjct: 264 LFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 93/370 (25%), Positives = 158/370 (42%), Gaps = 60/370 (16%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSP-YRALNCLARD--KYG-RYHLSNQMKQIR---EVSNC- 54
           VPI++D G+  +K G +    P Y   + + R   + G R ++S  +K I    E SN  
Sbjct: 5   VPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVR 64

Query: 55  ---HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISK 111
               +  P E G + +W   E +WDY  ++       +  +    ++++E  M+  +  +
Sbjct: 65  SYLQISYPMENGIIKNWADMEQLWDYAFYDQ----MKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 112 HMDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSG 170
            M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG
Sbjct: 121 QMCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSG 159

Query: 171 FNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQC 228
              T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ 
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKL 219

Query: 229 CFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
           C+   VSY        +  +D  L    T+L+     P      D + + +  E F  PE
Sbjct: 220 CY---VSY--------DLDLDTKLAHETTTLVETYELP------DGRVIKVGSERFEAPE 262

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             F P + ++ + G+ E +  +I      I   +   I + GG+       SRL  EL++
Sbjct: 263 CLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYPGLPSRLEKELKQ 322

Query: 349 QCPTDWSVRV 358
                W  RV
Sbjct: 323 L----WFTRV 328

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 91/369 (24%), Positives = 154/369 (41%), Gaps = 60/369 (16%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKY----GRYHLSNQMKQIR---EVSNC-- 54
           PI++D G+  +K G +    P      +          R ++S  +K I    E S+   
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVRS 65

Query: 55  --HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  F+       L  + +  ++++E  M+  +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFDQ----MKLPTTSNGKILLTEPPMNPVKNREQ 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKVC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D + + +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTKLARETTTLVENYELP------DGRVIKVGQERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P + ++ + G+ E +  +I      IR  +   I + GG+       SRL  EL++ 
Sbjct: 264 LFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGLPSRLEKELKQL 323

Query: 350 CPTDWSVRV 358
               W  RV
Sbjct: 324 ----WFTRV 328

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 90/369 (24%), Positives = 154/369 (41%), Gaps = 60/369 (16%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQIR---EVSNC-- 54
           PI++D G+  +K G +    P Y   + + R       R  ++  +K I    E S+   
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRS 65

Query: 55  --HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  +        L  +    ++++E  M+     + 
Sbjct: 66  YLQISYPMENGIIKNWADMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPMNPLRNREQ 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      K+LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D + + +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTKLARETTTLVENYELP------DGRVIKVGSERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P + ++ +PG+ E +  ++      +R  +   + + GG+       SRL  EL++ 
Sbjct: 264 LFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEKELKQL 323

Query: 350 CPTDWSVRV 358
               W  RV
Sbjct: 324 ----WFTRV 328

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 83.6 bits (205), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 95/382 (24%), Positives = 158/382 (41%), Gaps = 61/382 (15%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQI-------REVS 52
           PI++D G+  +K G +    P Y   + + R       R ++S  +K I       +  S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVRS 65

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G +  W   E +WDY  +        L  +    ++++E  M+     + 
Sbjct: 66  YLQISYPMENGIIRDWADMELLWDYAFYE----QMKLPSTSGGKVLLTEPPMNPLRNREQ 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G              +VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVGIQAVLALYAQGLSSG--------------VVVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D + + +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTRLAQETTTLVEQYELP------DGRVIKVGSERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P + ++ +PG+ E +  +I      I   +   I + GG+       SRL  EL++ 
Sbjct: 264 LFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMYPGLPSRLEKELKQL 323

Query: 350 CPTDWSVRVHLPKGDTELQGWK 371
               W  RV L    T L+ +K
Sbjct: 324 ----WFTRV-LKNDPTRLEKFK 340

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 83.6 bits (205), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 89/369 (24%), Positives = 153/369 (41%), Gaps = 60/369 (16%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLARDKYGRYHLSNQMKQIREV----------S 52
           PI++D G+  +K G +    P Y   + + R        +   K ++++          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVRS 65

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  FN       L  +    ++++E  M+  +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ----MQLPTTSGGKILLTEPPMNPVKNREQ 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D + + +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTKLARETTTLVENYELP------DGRIIKVGQERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P + ++ + G+ E +  +I      +R  +   I + GG+       SRL  EL++ 
Sbjct: 264 LFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSRLEKELKQL 323

Query: 350 CPTDWSVRV 358
               W  RV
Sbjct: 324 ----WFTRV 328

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 94/416 (22%), Positives = 178/416 (42%), Gaps = 58/416 (13%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP----YRALNCLARDKYGRYHLSNQMKQI-----REVSNC 54
           P+++DNGS  IK G S  + P    Y  +     DK     LS++ + +     ++    
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 55  HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMD 114
            ++ P E G +  W   E +W +  ++S      L +  D  ++V+E  ++  E    M 
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYSS----LKLNNIGDHPMLVTEAPLNPLENRDKMC 126

Query: 115 QVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
           ++++E +          A Y+     +A Y    + G               V+D G  C
Sbjct: 127 EMLYETFNV-------PAVYVSIQAVLALYAGGRTTGC--------------VIDCGDGC 165

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGR----FLTGLLKETVSFRHYNLMDETILANNIKEQCC 229
              +PV  G     A++++D+ GR    FL  LL++++     +  +  I+   IKE+ C
Sbjct: 166 CQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREIV-RMIKEKAC 224

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           ++ P    +  QK A +R    L  F+             +P D + L+L  E F  PE 
Sbjct: 225 YVAPEVAAEE-QKYASSRGSEELTKFK-------------LP-DGKILSLGAEKFRAPEI 269

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P++       + +   +SIS +   +R  + S++ + GG+   + F  RL  EL+ +
Sbjct: 270 LFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAGFGDRLLNELRSR 329

Query: 350 CPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
           C  +  +++  P  + +   W      +   ++++  VTR+E+ E+    C   RF
Sbjct: 330 CEPNVKIKIFAPP-ERKYSVWIGGSILAGLSTFEKIWVTRSEWQEN--PQCVHSRF 382

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 97/424 (22%), Positives = 176/424 (41%), Gaps = 74/424 (17%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPY-RALNCLARDKYGRYH----------LSNQMKQIREVS 52
           P+++DNGS  IK G S  + P     + +   KY +            + N+ +++R + 
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQLIGNEAQKMRGLL 70

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
             H   P E G +  W   E +W +  +NS      L + ++  ++++E  ++  +    
Sbjct: 71  KLHY--PLEHGVVQDWPGLEQLWTHVFYNS----LKLANIEEHPMLITEAPLNPMKNRNK 124

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +++FE   FGS      A Y+     +A Y    + G               V+D G 
Sbjct: 125 MCEMLFET--FGS-----PAVYVSIQAVLALYAGGRTTGC--------------VIDCGD 163

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGR----FLTGLLKETVSFRHYNLMDETILANNIKEQ 227
            C   +PV  G     A++++D+ GR    FL  LL+++      +  +  I+   IKE+
Sbjct: 164 GCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREIV-RMIKEK 222

Query: 228 CCFMPP------VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLED 281
            CF+         +Y  +   + ETR  + LPD                    + L L  
Sbjct: 223 ACFVATDVGNEEQNYEGANSAELETR--FKLPD-------------------GKILTLGA 261

Query: 282 ELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASR 341
           E F  PE  F P +       + E   +SIS +   +R  + S+I + GG+   S F  R
Sbjct: 262 EKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFGDR 321

Query: 342 LATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCT 401
           L +E+++    +  +++  P  + +   W      +   ++++  VTRAE+ E+    C 
Sbjct: 322 LLSEIRKTSEPNTKIKIFAPP-ERKYSTWIGGSILAGLSTFEKLWVTRAEWQEN--PQCI 378

Query: 402 KYRF 405
             RF
Sbjct: 379 HSRF 382

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 87/369 (23%), Positives = 153/369 (41%), Gaps = 60/369 (16%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLARDKYGRYHLSNQMKQIREV----------S 52
           PI++D G+  +K G +    P Y   + + R        +N +  ++++          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  ++       L  +    ++++E  M+     + 
Sbjct: 66  YLQISYPMENGVIKNWSDMELLWDYAFYDQ----MKLPSTSGGKVMLTEPPMNPLRNREQ 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+  
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLS 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D + + +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTKLARETTTLVENYELP------DGRVIKVGSERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P + ++ +PG+ E +  +I      +R  +   I + GG+       SRL  EL++ 
Sbjct: 264 LFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQL 323

Query: 350 CPTDWSVRV 358
               W  RV
Sbjct: 324 ----WFTRV 328

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 92/402 (22%), Positives = 168/402 (41%), Gaps = 53/402 (13%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLARDKYGRYHLSNQ-------MKQIREVSNCH 55
           P+++DNGS  +K G S    P +   + +   ++G  + S++       + Q R  S   
Sbjct: 12  PVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERR-SILQ 70

Query: 56  VRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQ 115
           +R P + G + +W   E IWDY   +       LKD  +  ++++E  ++       M  
Sbjct: 71  LRHPVDHGVVKNWNDMELIWDYMFKDK----LKLKDVDEHPVLITEAPLNPVSNRDEMCD 126

Query: 116 VVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTW 175
           ++FE +   +L    VA        A  K+ G                  V+D G   + 
Sbjct: 127 LLFESFGVQALY---VANPAVLSLYASGKISGC-----------------VLDCGDGYSC 166

Query: 176 VIPVIKGVPYYKAVKKLDIGGRFLTGLLK---ETVSFRHYNLMDETILANNIKEQCCFMP 232
            +PV +G     A+K++D+GGR LT  L+      +        E  L   IKE+ C++ 
Sbjct: 167 SVPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIKEKSCYV- 225

Query: 233 PVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFH 292
                D  ++K     D V   F+             +P D + + L  + F +PE  F 
Sbjct: 226 -AVDLDIEEEKCNYEGDQVGLKFK-------------LP-DGKFITLSKDRFQVPEILFQ 270

Query: 293 PEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPT 352
           P + +     + E + +S+S L   +RP M S+I + GG   +  F +RL  EL +    
Sbjct: 271 PSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFGNRLVQELDKLNQA 330

Query: 353 DWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLE 394
              V++  P  + +   W      +   ++++  VT++++ E
Sbjct: 331 QSRVKIWAPP-ERKYTSWIGGSILAELSTFQKIIVTKSQWQE 371

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 136/321 (42%), Gaps = 51/321 (15%)

Query: 41  LSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVS 100
           +  +  ++R  S   +  P E G + +W   E +WDY  +        L D+ +  ++++
Sbjct: 2   IGGEASEVR--SYLQISYPMENGIIKNWTDMELLWDYAFYEQ----MKLPDTSNGKILLT 55

Query: 101 ETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDD 159
           E  M+  +  + M +V+FE+Y FG +       Y+     +A Y    S G+        
Sbjct: 56  EPPMNPIKNREKMCEVMFEKYNFGGV-------YVAIQAVLALYAQGLSSGV-------- 100

Query: 160 YNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDE 217
                 VVDSG   T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +
Sbjct: 101 ------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTAD 154

Query: 218 TILANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTL 277
                 IKE+ C+   VSY        +  +D  L    T+L+     P      D + +
Sbjct: 155 FETVRQIKEKLCY---VSY--------DLDLDTKLARETTTLVESYELP------DGRVI 197

Query: 278 NLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISN 337
            +  E F  PE  F P + ++ + G+ E +  +I      IR  +   I + GG+     
Sbjct: 198 KVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSGGSSMYPG 257

Query: 338 FASRLATELQRQCPTDWSVRV 358
             SRL  EL++     W  RV
Sbjct: 258 LPSRLEKELKQL----WFTRV 274

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 92/369 (24%), Positives = 153/369 (41%), Gaps = 60/369 (16%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQI------REV-S 52
           PI++D G+  +K G +    P Y   + + R       R  +S  +K I       EV S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEVRS 65

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  +        L  +    ++++E  M+  +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPMNPLKNREQ 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D + + +  E F  PE 
Sbjct: 221 Y---VSY--------DLDLDTRLARETTTLVEKYELP------DGRIIKVGQERFEAPEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P + ++   G+ E +  +I      +R  +   I + GG+       SRL  EL++ 
Sbjct: 264 LFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSRLEKELKQL 323

Query: 350 CPTDWSVRV 358
               W  RV
Sbjct: 324 ----WFTRV 328

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 142/315 (45%), Gaps = 41/315 (13%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     + +N  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 107 FYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIF-----KYLRTEPEDHFFL 161

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 162 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVV------------ 209

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R    +D +
Sbjct: 210 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL--RERGEVDTS 267

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F + AE    YV+ +   +     RQ         +
Sbjct: 268 LRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYVVENQDKT-----RQ---------K 313

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVL-ESISMLPELIRPLMVSNIAVIGGN 332
            +++  E F  PE FF+PEIA  + L P  + TVL ++I   P  +R  + +NI + GG+
Sbjct: 314 VVDIGYERFLAPEIFFNPEIASSDFLTP--LPTVLDQTIQACPIDVRKGLYNNIVLSGGS 371

Query: 333 FNISNFASRLATELQ 347
               +F  RL  +L+
Sbjct: 372 TMFKDFGRRLQRDLK 386

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 132/310 (42%), Gaps = 49/310 (15%)

Query: 52  SNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISK 111
           S   +  P E G + +W   E +WDY  ++  +    L  +    ++++E  M+  +  +
Sbjct: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYDQMQ----LPSTSGGKVMLTEPPMNPVKNRE 66

Query: 112 HMDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSG 170
            M +V+FE+Y+FG +       Y+     +A Y    S G+              VVDSG
Sbjct: 67  QMCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSG 105

Query: 171 FNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQC 228
              T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ 
Sbjct: 106 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 165

Query: 229 CFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
            +   VSY        +  +D  L    T+L+     P      D + + +  E F  PE
Sbjct: 166 SY---VSY--------DLDLDTKLARETTTLVENYELP------DGRVIKVGSERFEAPE 208

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             F P + ++ +PG+ E +  +I      +R  +   I + GG+       SRL  EL++
Sbjct: 209 CLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 268

Query: 349 QCPTDWSVRV 358
                W  RV
Sbjct: 269 L----WFTRV 274

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 90/407 (22%), Positives = 163/407 (40%), Gaps = 60/407 (14%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARD-KYGRYHLS---------NQMKQIREVSN 53
           P++IDNGS  +K G    + P      L  D  Y +  +          N+ +++R +  
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL-- 68

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             ++ P E G +  W+  E +W + LF+S + +  ++      L+++E  ++     + M
Sbjct: 69  LKLKHPMERGVVSDWDDMELLWSHILFDSLQLTSGMEHP----LLITEAPLNPESNKEKM 124

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            +V FE +   +     +   IP        +Y S                 VVD G   
Sbjct: 125 LEVFFETFNIPA-----ICVSIP----GVLSLYASG-----------RTTGCVVDCGEGY 164

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTG-----LLKETVSFRHYNLMDETILANNIKEQC 228
              +PV +G     ++K++++GG  +T      L KE+  +   +   E  L   +KE+ 
Sbjct: 165 CSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLRKESGVWLFSS--GERELVRTMKEKS 222

Query: 229 CFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
           C      Y    Q K E +  +      T+           +P D   L L    F  PE
Sbjct: 223 C------YVSLNQLKDEEKFTFEPGKMNTNF---------KLP-DGNMLTLSKSRFRAPE 266

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             F P+I    +P L E  L+SI  +   +RP ++S I + GG      F  R   ELQ 
Sbjct: 267 ILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGFGDRFLQELQI 326

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEH 395
                 ++R+  P  + +   W      +   ++++   T++++ EH
Sbjct: 327 STCKKSNIRILAPP-ERKYTAWIGGSMLAGLTTFRKMLTTKSDWREH 372

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 99/406 (24%), Positives = 161/406 (39%), Gaps = 59/406 (14%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRAL--NCLARDKYGRYHLSNQMKQIREVSN-------- 53
           PI+IDNG+  IK G +    P R L  + +   KY +   SN ++    + N        
Sbjct: 14  PIVIDNGTNVIKGGFTGETKP-RCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGI 72

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P   G + +W+  E IW Y +F+   +   L++  +  ++++E  ++     + M
Sbjct: 73  LKLRHPMLRGVVQNWDDMETIWQY-VFDDTLY---LENLNEHPILITEPPLNNMANRQKM 128

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            + +FE + F        A YI                PV+            VD G   
Sbjct: 129 CEALFEIFGF-------PAVYISVS-------------PVLSLYASGQTTGCAVDCGDGY 168

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLT-----GLLKETVSFRHYNLMDETILANNIKEQC 228
              IPV  G     +VKK+DIGG  +T      +LK T  F + +   E  +   IKE+ 
Sbjct: 169 CTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMYSS--SEREIVRTIKEKV 226

Query: 229 CFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
           C++                 DY L + +  L    +   Q    D + LN+    +T  E
Sbjct: 227 CYIA---------------TDYNL-ETEKYLFNEEKMASQFKLPDGKMLNISQGKYTSTE 270

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             F PE+       L E   +SI  +   +R  + SNI + GG      F SRL  ELQ 
Sbjct: 271 ILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMCPGFGSRLLKELQT 330

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLE 394
               D  +R+  P  + +   W      S   ++ +  VT++ + E
Sbjct: 331 LTGYDTKIRIIAPP-ERKYTSWIGGSILSGLSTFSKIWVTKSMWEE 375

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 128/310 (41%), Gaps = 49/310 (15%)

Query: 52  SNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISK 111
           S   +  P E G +  W   E +WD+  F        L  +    ++++E  M+  +  +
Sbjct: 67  SYLQISYPMENGIIKHWTDMELLWDHAFFEK----MKLPSTSGGKILLTEPPMNPLKNRE 122

Query: 112 HMDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSG 170
            M QV+FE+Y+FG +       Y+     +A Y    S G+              VVDSG
Sbjct: 123 MMCQVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VVDSG 161

Query: 171 FNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQC 228
              T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ 
Sbjct: 162 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 221

Query: 229 CFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
            +   VSY   F  K        L    T+L+     P      D + + +  E F  PE
Sbjct: 222 SY---VSYDLDFDTK--------LARETTTLVENYELP------DGRIIKVGQERFEAPE 264

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             F P + ++ +PG+ E +  +I      IR  +   I + GG+       SRL  EL++
Sbjct: 265 CLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 324

Query: 349 QCPTDWSVRV 358
                W  RV
Sbjct: 325 L----WFTRV 330

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/409 (19%), Positives = 173/409 (42%), Gaps = 66/409 (16%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYG--------------RYHLSNQMKQIR 49
           P++IDNG+  +K G      P     C   +  G                ++ N+ ++ R
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKP----KCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENR 65

Query: 50  EVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEI 109
            +    +R P E G++  W+  E +W + L +      +++  ++  ++++E  ++  + 
Sbjct: 66  GL--LRLRHPMEHGEVKHWDEMEAVWKHTLLHD----LNIQHIEEHPILITEAPLNSSKN 119

Query: 110 SKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDS 169
            +HM +++FE +   +         I  +N A   +Y                   V+D 
Sbjct: 120 REHMCEILFESFNIPA---------IHVENPAVLALYSGG-----------RTTGCVIDC 159

Query: 170 GFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLL----KETVSFRHYNLMDETILANNIK 225
           G      +P+ +G     +++++DIGGR +T  L    +++V    ++  +E  +   IK
Sbjct: 160 GEGYCSAVPIYEGFALTPSIRRIDIGGREITEQLQFQIRKSVGMSLFS-SNEKEIVRTIK 218

Query: 226 EQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFT 285
           E+ C++      D   K+      Y+L     S        K  +P D ++L++ +  F 
Sbjct: 219 ERACYVA-----DDISKEEH---KYILDSESNS-------SKFKLP-DGKSLSIGNVRFR 262

Query: 286 IPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATE 345
             E  F+P +       + E V +++S +   +RP++  ++ + GG   +  F +R+  E
Sbjct: 263 ATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGNRILKE 322

Query: 346 LQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLE 394
           LQ     D  +R+ +   + +   W      +   ++++  VT++ + E
Sbjct: 323 LQILTKQDTKLRI-IASPERKYTTWIGGSILAGLSTFQKILVTKSNWNE 370

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 137/314 (43%), Gaps = 39/314 (12%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     + ++  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 99  FYIGNEALIASQGASYSLSYPIRHGQVENWDHMERFWENSIF-----KYLRTEPEDHFFL 153

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 154 LTEPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVV------------ 201

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R     D +
Sbjct: 202 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTS 259

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F +  E    YV+ + + +                +
Sbjct: 260 LRTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVENQEKT--------------QKK 305

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V ++I   P  +R  + +NI + GG+ 
Sbjct: 306 VVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGST 364

Query: 334 NISNFASRLATELQ 347
              +F  RL  +L+
Sbjct: 365 MFKDFGRRLQRDLK 378

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 87/381 (22%), Positives = 158/381 (41%), Gaps = 58/381 (15%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     +  +  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 102 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFL 156

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 157 LTEPPLNPPENRQQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKV------------T 204

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R     D +
Sbjct: 205 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQDAS 262

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F + +E    +++ + +       R  K+ +     
Sbjct: 263 LRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKE-------RTTKKVV----- 310

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
             ++  E F  PE FF+PEIA  + L P L   V E+I   P  +R  + +NI + GG+ 
Sbjct: 311 --DVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLYNNIVLSGGST 367

Query: 334 NISNFASRLATELQ----------------RQCPTDWSVRVHLPKGDTELQGWKAMMRFS 377
              +F  RL  +L+                R    D SV  H  + +     W      +
Sbjct: 368 MFKDFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAV---WFGGSLLA 424

Query: 378 NTDSYKQGRVTRAEYLEHGVD 398
            T  +K    T+ +Y E+G D
Sbjct: 425 QTGEFKSYCHTKQDYEEYGPD 445

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 82/355 (23%), Positives = 153/355 (43%), Gaps = 50/355 (14%)

Query: 9   NGSYEIKFGPSSLKSPYRALN----CLARDKYGR-------YHLSNQMKQIREVSNCHVR 57
           NGS    FG S+  + +  L      L+ +  G+       +++ N+     +  +  + 
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTGGKMLLSNNLAGKRGTEDLDFYIGNEALVAAQSPSYSLS 122

Query: 58  RPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVV 117
            P   GQ+ +W+  E  W+  +F      +   + +D   +++E  ++ PE  + + ++ 
Sbjct: 123 YPIRHGQVENWDHMERFWENSIF-----KYLRTEPEDHYFLLTEPPLNPPENREQVAEIF 177

Query: 118 FEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVI 177
           FE +    L     A      +    KV             D +    V+DSG   T VI
Sbjct: 178 FESFNCAGLYIAVQAVLALAASWTSSKVI------------DRSLTGTVIDSGDGVTHVI 225

Query: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETI-LANNIKEQCCFMPP--V 234
           PV +G     A+K + I GR +T  ++  +  R     D ++  A  IK++ C++ P  V
Sbjct: 226 PVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RERGEADTSLRTAERIKQEYCYVCPDIV 283

Query: 235 SYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPE 294
             F+ F ++ E         F   ++    + KQ +      +++  E F  PE FF+PE
Sbjct: 284 KEFNKFDRQPE--------KFAQFIVESQEKTKQKV------VDVGYERFLAPEIFFNPE 329

Query: 295 IA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQ 347
           IA  + L P L   V ++I   P  +R  + +NI + GG+    +F+ RL  +++
Sbjct: 330 IASSDYLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDMK 383

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 88/402 (21%), Positives = 169/402 (42%), Gaps = 52/402 (12%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARD-KY---------GRYHLSNQMKQIREVSN 53
           P++IDNGS  IK G S  + P     CL  + KY         G   + N  +++R +  
Sbjct: 14  PVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL-- 71

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P + G +  W+  E IW Y L    +    L++  +  L+++E  M+  +  + M
Sbjct: 72  LKLRYPIKHGVVEDWDSMELIWSYVLNEVLQ----LQNIGEHPLLITEAPMNPLKNREQM 127

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            QV+FE ++  +L       Y+   N A   +Y S                 VVD G   
Sbjct: 128 AQVLFETFDVSAL-------YV--SNPAVLSLYASG-----------RTTGCVVDCGEGY 167

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMP- 232
              +P+  G     ++ ++DIGG  +T    E + F+       ++ +++ +E    M  
Sbjct: 168 CSTVPIYDGFALPASMMRMDIGGADIT----EQLQFQLRKSAGVSLFSSSEREIVRTMKE 223

Query: 233 PVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFH 292
            V Y     KK E +      D    LI   + P      D + + + ++ +  PE  F 
Sbjct: 224 KVCYLAKNIKKEEEKYLQGTQD----LISTFKLP------DGRCIEVGNDRYRAPEILFS 273

Query: 293 PEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPT 352
           P+I  +   GL +  ++SI  +   +R  ++S+I + GG   +  F  R+  +L+     
Sbjct: 274 PQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLEALTKG 333

Query: 353 DWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLE 394
              +++  P  + +   W      +   ++++    ++++LE
Sbjct: 334 TSKIKIIAPS-ERKYTTWIGGSILTGLSTFQRLWTKKSDWLE 374

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 137/314 (43%), Gaps = 39/314 (12%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     +  +  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 100 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIF-----KYLRTEPEDHFFL 154

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 155 LTEPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKV------------T 202

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R     D +
Sbjct: 203 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTS 260

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F +  E    +V+ + +++                +
Sbjct: 261 LRTAERIKQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST--------------RKK 306

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V ++I   P  +R  + +NI + GG+ 
Sbjct: 307 IVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGST 365

Query: 334 NISNFASRLATELQ 347
              +F  RL  +L+
Sbjct: 366 MFKDFGRRLQRDLK 379

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 137/314 (43%), Gaps = 39/314 (12%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+        +  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 102 FYIGNEALAASRGPSYSLSYPIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFL 156

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 157 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKV------------T 204

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R    +D +
Sbjct: 205 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTS 262

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F + A     +++ + +++                +
Sbjct: 263 LRTAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSEST--------------KKK 308

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V ++I   P  +R  + +NI + GG+ 
Sbjct: 309 IVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGST 367

Query: 334 NISNFASRLATELQ 347
              +F  RL  +L+
Sbjct: 368 MFKDFGRRLQRDLK 381

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/369 (22%), Positives = 150/369 (40%), Gaps = 60/369 (16%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNC------LARDKYGRYHLSNQMKQIREVSNC--- 54
           PI++D G+  +K G +    P            L  ++ G  ++  +   I E ++    
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVRS 65

Query: 55  --HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +  P E G + +W   E +WDY  +        L  +    ++++E  ++  +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPLNPLKNREK 121

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDN-MADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
           M +V+FE+Y+FG +       Y+     +A Y    S G+              V+DSG 
Sbjct: 122 MCEVMFEKYDFGGV-------YVAIQAVLALYAQGLSSGV--------------VIDSGD 160

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCC 229
             T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           +   VSY        +  +D  L    T+L+     P      D + + +  E F   E 
Sbjct: 221 Y---VSY--------DLELDTKLARETTTLVENYELP------DGRVIKVGQERFEAAEC 263

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P + ++   G+ E +  +I      +R  +   I + GG+       SR+  EL++ 
Sbjct: 264 LFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQL 323

Query: 350 CPTDWSVRV 358
               W  RV
Sbjct: 324 ----WYTRV 328

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 136/314 (43%), Gaps = 39/314 (12%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     +  +  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 100 FYIGNEALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFL 154

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 155 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSPKV------------T 202

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  +++ +  R     D +
Sbjct: 203 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQDTS 260

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F + A     +V+   + +                +
Sbjct: 261 LKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVVESQEKTR--------------KK 306

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V E+I   P  +R  + +NI + GG+ 
Sbjct: 307 IVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSGGST 365

Query: 334 NISNFASRLATELQ 347
              +F  RL  +++
Sbjct: 366 MFKDFGRRLQRDMK 379

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 76/347 (21%), Positives = 149/347 (42%), Gaps = 49/347 (14%)

Query: 16  FGPSSLKSPYRALNC---LARDKYGR-------YHLSNQMKQIREVSNCHVRRPFELGQL 65
           FG S+  + + +LN    L+ +  G+       +++ N+     +  +  +  P   GQ+
Sbjct: 62  FGNSTSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSYSLSYPIRHGQI 121

Query: 66  VSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEYEFGS 125
            +W+  E  W+  +F      +   + +D   +++E  ++ PE  + + ++ FE +    
Sbjct: 122 ENWDHMERFWENSIF-----KYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAG 176

Query: 126 LMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIPVIKGVPY 185
           L     A      +    KV             D +    V+DSG   T VIPV +G   
Sbjct: 177 LYIAVQAVLALAASWTSSKV------------TDRSLTGTVIDSGDGVTHVIPVAEGYVI 224

Query: 186 YKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETI-LANNIKEQCCFMPP--VSYFDSFQK 242
             A+K + I GR +T  ++  +  R     D ++  A  IK++ C++ P  V  F+ F +
Sbjct: 225 GSAIKNIPIAGRDITLFIQSLL--RERGETDTSLRTAERIKQEYCYVCPDIVKEFNKFDR 282

Query: 243 KAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIA--NILK 300
             +    +++ + + +                + +++  E F  PE FF+PEIA  + L 
Sbjct: 283 NPDKFAQFIVENQEKT--------------QKKIVDVGYERFLAPEIFFNPEIASSDFLT 328

Query: 301 PGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQ 347
           P L   V  +I   P  +R  + +NI + GG+    +F  RL  +++
Sbjct: 329 P-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDIK 374

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 91/406 (22%), Positives = 169/406 (41%), Gaps = 60/406 (14%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRAL--NCLARDKY---------GRYHLSNQMKQIREVS 52
           PI+IDNGS  IK G S  + P +AL  + +   KY         G   + N+ +++R + 
Sbjct: 14  PIVIDNGSGIIKVGFSGEERP-KALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL- 71

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +R P   G +  W+  E IW Y L         L++ ++  L+++E  M+  +  + 
Sbjct: 72  -LRLRYPMTHGVVEDWDSMELIWSYMLNEV----LQLQNIEEHPLLITEAPMNPLKNREV 126

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFN 172
           M QV+FE +   +L       YI   N A   +Y S                 VVD G  
Sbjct: 127 MAQVLFETFNLPAL-------YI--SNPAVLSLYASG-----------RTTGCVVDCGEG 166

Query: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTGLL----KETVSFRHYNLMDETILANNIKEQC 228
               +P+  G     ++ ++DIGGR +T  L    +++     ++   E  +   IKE+ 
Sbjct: 167 YCSTVPIYDGFALPASIMRMDIGGRDITEQLQFQLRKSAGISLFS-SSELEVVRMIKEKV 225

Query: 229 CFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
           C      Y     KK E R      D  +            +P D + + + ++ +  PE
Sbjct: 226 C------YLAKNIKKEEDRYLQGHHDLGSVF---------KLP-DGKCIEIGNDRYRAPE 269

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             F P+I      GL +  ++SI  +   +R  ++S+I + GG   +  F  R+  +L+ 
Sbjct: 270 ILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTTLRGFGERMLHDLEA 329

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLE 394
                  +++  P  + +   W      +   ++++    ++++LE
Sbjct: 330 LSKGTCKIKIIAPP-ERKYTTWVGGSILTGLSTFQKLWTKKSDWLE 374

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 80/354 (22%), Positives = 152/354 (42%), Gaps = 49/354 (13%)

Query: 9   NGSYEIKFGPSSLKSPYRALN---CLARDKYGR-------YHLSNQMKQIREVSNCHVRR 58
           N S    FG S+  + +  LN    L+ +  G+       +++ N+     +  +  +  
Sbjct: 68  NSSATPYFGNSTSATSFNNLNKNMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSYSLSY 127

Query: 59  PFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVF 118
           P   GQ+ +W+  E  W+  +F      +   + +D   +++E  ++ PE  + + ++ F
Sbjct: 128 PIRHGQVENWDHMERFWENSIF-----KYLRTEPEDHFFLLTEPPLNPPENREQIAEIFF 182

Query: 119 EEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIP 178
           E +    L     A      +    KV             D +    V+DSG   T VIP
Sbjct: 183 ESFNCAGLYIAVQAVLALAASWTSSKV------------TDRSLTGTVIDSGDGVTHVIP 230

Query: 179 VIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETI-LANNIKEQCCFMPP--VS 235
           V +G     A+K + I GR +T  ++  +  R    +D ++  A  IK++ C++ P  V 
Sbjct: 231 VAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERIKQEYCYVCPDIVK 288

Query: 236 YFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEI 295
            F+ F +       +++ + +        Q ++ +      +++  E F  PE FF+PEI
Sbjct: 289 EFNKFDRDGSKFAQFIVENQE--------QTRKKV------VDVGYERFLAPEIFFNPEI 334

Query: 296 A--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQ 347
           A  + L P L   V  +I   P  +R  + +NI + GG+    +F  RL  +L+
Sbjct: 335 ASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 387

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 135/314 (42%), Gaps = 39/314 (12%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     +  +  +  P   GQ+  W   E  W+  +F      +   + +D   +
Sbjct: 101 FYIGNEALAAAQGPSYSLSYPIRHGQVEDWNHMERFWENSIFK-----YLRTEPEDHFFL 155

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 156 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKV------------T 203

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R    +D +
Sbjct: 204 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVDTS 261

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F + A     +++ + + +                +
Sbjct: 262 LRTAERIKQEYCYVCPDIVKEFNKFDRDATKFAQFIVENKEKT--------------QKK 307

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V ++I   P  +R  + +NI + GG+ 
Sbjct: 308 VVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGST 366

Query: 334 NISNFASRLATELQ 347
              +F  RL  +L+
Sbjct: 367 MFKDFGRRLQRDLR 380

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 86/406 (21%), Positives = 171/406 (42%), Gaps = 60/406 (14%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRAL--NCLARDKY---------GRYHLSNQMKQIREVS 52
           PI+IDNGS  IK G S  + P +AL  + +   KY         G   + N+ +++R + 
Sbjct: 14  PIVIDNGSGIIKAGFSGEERP-KALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL- 71

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +R P + G +  W+  E IW Y L         L++ ++  L+++E  M+  +  + 
Sbjct: 72  -LRLRYPMKHGVVEDWDSMELIWSYVLNEV----LQLQNIEEHPLLITEAPMNPLKNREM 126

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFN 172
           + QV+FE +   +         I   + A   +Y S                 VVD G  
Sbjct: 127 IAQVMFETFNLSA---------IYVSDPAVLSLYASG-----------RTTGCVVDCGEG 166

Query: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTGLL----KETVSFRHYNLMDETILANNIKEQC 228
               +P+  G     ++ ++DIGG  +T  L    +++     ++  +  I+   IKE+ 
Sbjct: 167 YCSSVPIYDGFALPASIMRMDIGGGDITEQLQFQIRKSAGVSLFSSSEREIV-RTIKEKV 225

Query: 229 CFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
           C++          K A+   D  L   Q  LI   + P      D +++ + ++ +  PE
Sbjct: 226 CYLA---------KDAKKEEDKYLQGTQ-DLISAFKLP------DGKSIEVGNDRYRAPE 269

Query: 289 TFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348
             F P+I      GL    ++SI  +   +R  ++S++ + GG   +  F  R+  +L+ 
Sbjct: 270 ILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLKGFGDRMLHDLEA 329

Query: 349 QCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLE 394
                  +++  P  + +   W      +   ++++    ++++LE
Sbjct: 330 LTKGTSKIKIIAPP-ERKYTAWIGGSILTGLSTFQKLWTKKSDWLE 374

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 128/294 (43%), Gaps = 39/294 (13%)

Query: 59  PFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVF 118
           P   GQ+ +W+  E  W+  +F      +   + +D   +++E  ++ PE  + + ++ F
Sbjct: 127 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHCFLLTEPPLNPPENREQVAEIFF 181

Query: 119 EEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIP 178
           E +    L     A      +    KV             D +    V+DSG   T VIP
Sbjct: 182 ESFNCAGLYIAVQAVLALAASWTSSKVI------------DRSLTGTVIDSGDGVTHVIP 229

Query: 179 VIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETI-LANNIKEQCCFMPP--VS 235
           V +G     A+K + I GR +T  +++ +  R     D ++  A  IK++ C++ P  V 
Sbjct: 230 VAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEEDTSLRTAERIKQEYCYVCPDIVK 287

Query: 236 YFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEI 295
            F+ F + +E    +V+   + +                + +++  E F  PE FF+PEI
Sbjct: 288 EFNKFDRDSEKFAQFVVESQEKT--------------RRKVVDVGCERFMAPEIFFNPEI 333

Query: 296 A--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQ 347
           A  + L P L   V  +I   P  +R  + +NI + GG+    +F  RL  +L+
Sbjct: 334 ASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 386

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 135/314 (42%), Gaps = 39/314 (12%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     +  +  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFL 149

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 150 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKV------------T 197

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R     D +
Sbjct: 198 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTS 255

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F K       +V+ + + +                +
Sbjct: 256 LRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKT--------------RRK 301

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V ++I   P  +R  + +NI + GG+ 
Sbjct: 302 VVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGST 360

Query: 334 NISNFASRLATELQ 347
              +F  RL  +L+
Sbjct: 361 MFKDFGRRLQRDLK 374

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 132/307 (42%), Gaps = 39/307 (12%)

Query: 59  PFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVF 118
           P   GQ+ +W+  E  W+  +F      +   + +D   +++E  ++ PE  + + ++ F
Sbjct: 111 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHYFLLTEPPLNPPENREQVAEIFF 165

Query: 119 EEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIP 178
           E +    L     A      +    KV             D +    V+DSG   T VIP
Sbjct: 166 ESFNCAGLYIAVQAVLALAASWTSSKVV------------DRSLTGTVIDSGDGVTHVIP 213

Query: 179 VIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETI-LANNIKEQCCFMPP--VS 235
           V +G     A+K + I GR +T  ++  +  R     D T+  A  IK++ C++    V 
Sbjct: 214 VAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTAERIKQEYCYVCSDIVK 271

Query: 236 YFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEI 295
            F+ F + +E    +++ + + +                + +++  E F  PE FF+PEI
Sbjct: 272 EFNKFDRDSEKFAQFIVENSEKT--------------RRKVIDVGYERFLAPEIFFNPEI 317

Query: 296 A--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTD 353
           A  + L P L   V ++I   P  +R  + +NI + GG+    +F  RL  +L+      
Sbjct: 318 ASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGIVNNR 376

Query: 354 WSVRVHL 360
            ++  HL
Sbjct: 377 IALSEHL 383

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 135/314 (42%), Gaps = 39/314 (12%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     +  +  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFL 149

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 150 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKV------------T 197

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R     D +
Sbjct: 198 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTS 255

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F +       +V+ + + +                +
Sbjct: 256 LRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKT--------------RRK 301

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V ++I   P  +R  + +NI + GG+ 
Sbjct: 302 AVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGST 360

Query: 334 NISNFASRLATELQ 347
              +F  RL  +L+
Sbjct: 361 MFKDFGRRLQRDLK 374

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 90/382 (23%), Positives = 156/382 (40%), Gaps = 77/382 (20%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP----YRALNCLARDKY-------GRYHLSNQMKQIREVS 52
           PI++DNGS  +K G      P    Y  +     DK        G++ + N  ++ R + 
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKF-VGNLAQEYRGL- 70

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
              +R P + G + +WE  E +WD+   +  + S    +  +  L+V+E  ++     + 
Sbjct: 71  -LKLRYPMDHGIIENWEHMETVWDHIFKDCLKVS----NLGEHPLVVTEAPLNPKPNREK 125

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFN 172
           M + +FE +   +L       YI   N A   +Y S                 VV++G  
Sbjct: 126 MCETLFESFNIPAL-------YIA--NPAVLSLYASG-----------RTTGCVVEAGDG 165

Query: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTG----LLKETVSFRHYNLMDETILANNIKEQC 228
               +P+ +G     +++++DIGGR +T      L+++     Y+  ++ I+   IKE  
Sbjct: 166 YCSSVPIYEGFALTPSIRRIDIGGRDITKHLQLQLRKSTGMWLYSSSEQEIV-RLIKENG 224

Query: 229 CFMPPVSYFDSFQKKAETR---------IDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNL 279
           C      Y  S  KK E +         I + LPD +  +IG  R               
Sbjct: 225 C------YICSNHKKEEEKFLLDQEKKSISFKLPDGKNLVIGPGR--------------- 263

Query: 280 EDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFA 339
               F  PE  F+P +       L + +++SIS +   +R  +++NI + GG+     F 
Sbjct: 264 ----FRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGSTMFQGFC 319

Query: 340 SRLATELQRQCPTDWSVRVHLP 361
            RL TEL         VR+  P
Sbjct: 320 DRLITELDFSVDKTTKVRILAP 341

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 135/314 (42%), Gaps = 39/314 (12%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     +  +  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFL 149

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 150 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKV------------T 197

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R     D +
Sbjct: 198 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTS 255

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F +       +V+ + + +                +
Sbjct: 256 LRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKT--------------RRK 301

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V ++I   P  +R  + +NI + GG+ 
Sbjct: 302 VVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGST 360

Query: 334 NISNFASRLATELQ 347
              +F  RL  +L+
Sbjct: 361 MFKDFGRRLQRDLK 374

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 130/294 (44%), Gaps = 39/294 (13%)

Query: 59  PFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVF 118
           P   GQ+ +W+  E  W+  +F      +   + +D   +++E  ++ PE  + + ++ F
Sbjct: 124 PIRHGQVENWDHMERFWENSIF-----KYLRAEPEDHFFLLTEPPLNPPENREQVAEIFF 178

Query: 119 EEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIP 178
           E +    L     A      +    +V             D +    V+DSG   T VIP
Sbjct: 179 ESFNCAGLYIAVQAVLALAASWTSAQV------------TDRSLTGTVIDSGDGVTHVIP 226

Query: 179 VIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETI-LANNIKEQCCFMPP--VS 235
           V +G     A+K + I GR +T  ++  +  R     D ++  A  IK++ C++ P  V 
Sbjct: 227 VAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEADSSLKTAERIKQEYCYVCPDIVK 284

Query: 236 YFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEI 295
            F+ F ++ E    +++ +          Q K       + +++  E F  PE FF+PEI
Sbjct: 285 EFNKFDRQPEKFAQFIIEN----------QDKTT----KKVIDIGYERFLAPEIFFNPEI 330

Query: 296 A--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQ 347
           A  + L P L   V ++I   P  +R  + +NI + GG+    +F+ RL  +++
Sbjct: 331 ASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDVK 383

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 138/314 (43%), Gaps = 39/314 (12%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     +  +  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 106 FYIGNEALIASQGPSYSLSYPIRHGQIENWDHMERFWENSIFK-----YLRAEPEDHFFL 160

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    +V             
Sbjct: 161 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQV------------T 208

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R     D +
Sbjct: 209 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTS 266

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F ++ E    +++ +   +        KQ +     
Sbjct: 267 LRTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIENQDKT--------KQKV----- 313

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V  +I   P  +R  + +NI + GG+ 
Sbjct: 314 -VDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGST 371

Query: 334 NISNFASRLATELQ 347
              +F+ RL  +++
Sbjct: 372 MFKDFSRRLQRDIK 385

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 75/161 (46%), Gaps = 12/161 (7%)

Query: 257 TSLIGYVRQPKQAIPED---SQTLNLEDELFTIPETFFHPEIANILKPGLIE----TVLE 309
           ++L  ++R P+    ED      L+L  E   +PE  F P IA   + G+ E     +L+
Sbjct: 585 STLHLFLRGPRPHDSEDVHQQHQLHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLK 644

Query: 310 SISMLP---ELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPKGDTE 366
                P         MV+N+ + GGN  I    +R+  E     P    + VH+ + D  
Sbjct: 645 KFGSKPGNLSAASSRMVNNVWITGGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSE-DPS 703

Query: 367 LQGWKAMMRFSNTDS-YKQGRVTRAEYLEHGVDWCTKYRFG 406
           L  WK M + +N ++ YK   VTR EY E+G D+  +++ G
Sbjct: 704 LDAWKGMAKLANNETDYKNTAVTRKEYEEYGPDYIKEHKLG 744

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 48/238 (20%), Positives = 90/238 (37%), Gaps = 33/238 (13%)

Query: 5   IIIDNGSYEIKFGPSSLKSP-----YRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRP 59
           I ID GSY I+ G ++  +P      R      R     +        + +      + P
Sbjct: 39  IAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQKTFTFIGNDTLLDQTIRSQSKSP 98

Query: 60  FELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFE 119
           F+   L +W+  E + +Y   +         +     LI++E    +        Q++FE
Sbjct: 99  FDGTLLTNWDYVEDMLEYTFHH---LGVSGNNGVSNPLIINERLACLQSQRNSWYQLLFE 155

Query: 120 EYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIPV 179
            ++            + F   + +  YG+        K+D     LV++ G   T VIP+
Sbjct: 156 TFDLPE---------VSFGIDSLFSFYGNS------TKED----GLVINCGNEETDVIPI 196

Query: 180 IKGVPYYKAVKKLDIGG----RFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPP 233
           + G       K+++ GG     FL+ LL  T+ + ++     T+    + E  C+  P
Sbjct: 197 VGGRGILSECKRINWGGSQSTNFLSSLL--TLKYPYFPAKLSTLQYTQMYEDYCYTSP 252

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 135/314 (42%), Gaps = 39/314 (12%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     +  +  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFL 149

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 150 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKV------------T 197

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R     D +
Sbjct: 198 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTS 255

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F +       +V+ + + +                +
Sbjct: 256 LRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKT--------------RRK 301

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V ++I   P  +R  + +NI + GG+ 
Sbjct: 302 VVDIGYERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGGST 360

Query: 334 NISNFASRLATELQ 347
              +F  RL  +L+
Sbjct: 361 MFKDFGRRLQRDLK 374

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/327 (22%), Positives = 139/327 (42%), Gaps = 39/327 (11%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     +  +  +  P   GQ+ +W+  E  W+  +F      +   + +D   +
Sbjct: 97  FYIGNEALAASQGPSYSLSYPIRHGQVENWDHMERFWENSIF-----KYLRTEPEDHFFL 151

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 152 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVV------------ 199

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R     D T
Sbjct: 200 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTT 257

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++    V  F+ F +  +    +++ + + +                +
Sbjct: 258 LRTAERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKT--------------KRK 303

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V ++I   P  +R  + +NI + GG+ 
Sbjct: 304 VIDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGST 362

Query: 334 NISNFASRLATELQRQCPTDWSVRVHL 360
              +F  RL  +L+       ++  HL
Sbjct: 363 MFKDFGRRLQRDLKGIVNNRIALSEHL 389

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 134/314 (42%), Gaps = 39/314 (12%)

Query: 39  YHLSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLI 98
           +++ N+     +     +  P + GQ+ +W   E  W+  +F      +   + +D   +
Sbjct: 104 FYIGNEALTAAQGPAYSLSYPIKHGQVENWNHMERFWENSIFK-----YLRTEPEDHFFL 158

Query: 99  VSETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKD 158
           ++E  ++ PE  + + ++ FE +    L     A      +    KV             
Sbjct: 159 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKV------------T 206

Query: 159 DYNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDET 218
           D +    V+DSG   T VIPV +G     A+K + I GR +T  ++  +  R    +D +
Sbjct: 207 DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTS 264

Query: 219 I-LANNIKEQCCFMPP--VSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQ 275
           +  A  IK++ C++ P  V  F+ F +       +++ +          Q K       +
Sbjct: 265 LKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFIIEN----------QGKT----QKK 310

Query: 276 TLNLEDELFTIPETFFHPEIA--NILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNF 333
            +++  E F  PE FF+PEIA  + L P L   V  +I   P  +R  + SNI + GG+ 
Sbjct: 311 IVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYSNIVLSGGST 369

Query: 334 NISNFASRLATELQ 347
              +F  RL  +L+
Sbjct: 370 MFKDFGRRLQRDLR 383

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 84/405 (20%), Positives = 169/405 (41%), Gaps = 58/405 (14%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP----YRALNCLARDKY------GRYHLSNQMKQIREVSN 53
           PI+IDNGS  IK G S  + P    Y  +     DK       G   + N+ +++R +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGL-- 71

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             ++ P E G +  W+  E IW + L         L++ ++  L+++E  M+  +  + M
Sbjct: 72  LRLQYPIEHGVVEDWDSMELIWAHILNEV----LQLQNIEEHPLLITEAPMNPLKNREVM 127

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            QV+FE +   +L       Y+   N A   +Y S                 V+D G   
Sbjct: 128 AQVLFETFNLPAL-------YV--SNPAVLSLYASG-----------RTTGCVIDCGEGY 167

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLL----KETVSFRHYNLMDETILANNIKEQCC 229
              +P+  G     ++ ++DIGGR +T  L    +++     ++  +  I+   IKE+ C
Sbjct: 168 CSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREIV-RTIKEKVC 226

Query: 230 FMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET 289
           ++         +K+  T +          L    + P      D + + + ++ +  PE 
Sbjct: 227 YLAT-----DIKKEENTYMQE-----SQDLTSVFKLP------DGKCIEIGNDRYRAPEI 270

Query: 290 FFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
            F P+I      GL +  ++SI  +   +R  ++S+I + GG   +  F  R+  +L+  
Sbjct: 271 LFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTLRGFGDRMLHDLEAF 330

Query: 350 CPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLE 394
                 +++  P  + +   W      +   ++++    ++++LE
Sbjct: 331 TKGTSKIKIIAPP-ERKYTTWVGGSILTGLSTFQRLWTKKSDWLE 374

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 73/323 (22%), Positives = 129/323 (39%), Gaps = 64/323 (19%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN 53
           ++IDNGS   K G           PS +  P      +   +   Y + ++ +  R +  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY-VGDEAQSKRGI-- 64

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             +R P E G + +W+  E IW +  +N    +      ++  ++++E  M+     + M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA-----PEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE +   +        Y+     A   +Y S                +V+DSG   
Sbjct: 120 TQIMFETFNVPAF-------YVSIQ--AVLSLYSSG-----------RTTGIVLDSGDGV 159

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNL--MDETILANNIKEQCCFM 231
           T V+P+  G      + ++D+ GR LT  L + +S R Y+     E  +  +IKE+ C++
Sbjct: 160 THVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV 219

Query: 232 PPVSYFDSFQKKAET---RIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPE 288
             + +    Q  A++      Y LPD Q   IG                   +E F  PE
Sbjct: 220 -ALDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPE 259

Query: 289 TFFHPEIANILKPGLIETVLESI 311
             FHP +  +   G+ +T   SI
Sbjct: 260 ALFHPSVLGLESSGIDQTTYNSI 282

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/376 (21%), Positives = 157/376 (41%), Gaps = 64/376 (17%)

Query: 4   PIIIDNGSYEIKFGPSSLKSP-------------YRALNCLARDKYGRYHLSNQMKQIRE 50
           P+I+DNGS  IK G +  + P              R++  ++  +    ++ N   + R 
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKET---YIGNSAYERR- 67

Query: 51  VSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEIS 110
            +  H+  P+    ++SW+  E +WDY L N  E    ++  ++  ++++ +  +  +  
Sbjct: 68  -ATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLE----IEQLQEHPVVLTNSMSTSKKEE 122

Query: 111 KHMDQVVFEEYEFGSL--MKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVD 168
           + M +V+FE++   ++   + P+        M+ Y +  + G  V               
Sbjct: 123 EKMCEVLFEKFSIPAIYCSRDPI--------MSLYGLGRTTGCSV--------------S 160

Query: 169 SGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH---YNLMDETILANNIK 225
            G     +  VI G+    + +  + GG  +T  + + +   H    N  +   L  +IK
Sbjct: 161 CGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIK 220

Query: 226 EQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFT 285
           E+CC +    Y        E R  Y L   +TS   Y R P      D   + +  E F 
Sbjct: 221 ERCCVLSKDFY-------NEIRA-YELITSKTSNNKY-RLP------DGNIIEIGSERFE 265

Query: 286 IPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATE 345
            PE  F+P+     +  L + ++ SIS    L R  ++ +I + GG+  I  F  RL  E
Sbjct: 266 APEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGERLTKE 325

Query: 346 LQRQCPTDWSVRVHLP 361
           ++++   +  + ++ P
Sbjct: 326 IRKEIDGNQKIMLNAP 341

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 74/161 (45%), Gaps = 12/161 (7%)

Query: 257 TSLIGYVRQPKQAIPEDSQ---TLNLEDELFTIPETFFHPEIANILKPGLIE----TVLE 309
           ++L  ++R P+    E+S     ++L  E   +PE FF P +    + G+ E     +L 
Sbjct: 584 STLHLFLRGPRPHDSENSHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLS 643

Query: 310 SISMLPELIRPL---MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPKGDTE 366
                P  +  +   M  N+ V GGN  I     R+  E     P + S  V++   D  
Sbjct: 644 KFGASPRQMSSITSEMAKNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNI-SSDPS 702

Query: 367 LQGWKAMMRFS-NTDSYKQGRVTRAEYLEHGVDWCTKYRFG 406
           L  W+ M +++ N   YK+  +++ EY E+G D+  +++ G
Sbjct: 703 LDAWRGMAKYAQNETDYKKSFISKKEYEEYGPDYIKEHKLG 743

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/214 (19%), Positives = 79/214 (36%), Gaps = 38/214 (17%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN--------- 53
           VPI +D GS +++ G  +  +P         ++  R+     MK +  + N         
Sbjct: 37  VPIAVDFGSNQLRAGLINRATPSHVFT----NRITRFRDRKLMKTMTFIGNDVNLDQAVR 92

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
              + PF+   + +W+  E I +Y     +       +     ++V+E   ++       
Sbjct: 93  AQSKSPFDGPMVTNWDYVEDILEYTF---NHLGSTPNNGISNPILVTERLATLQTQRSSW 149

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            QV+FE +    +                   +G D L    +    N   LV+  G   
Sbjct: 150 YQVLFECFNVPGV------------------TFGIDSLFAYYQNTTANSTGLVIGCGNED 191

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGR----FLTGLL 203
           T +IPV+ G       K+++ GG     +LT L+
Sbjct: 192 TNIIPVVDGQGMLTEAKRINWGGSQAADYLTNLM 225

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/364 (19%), Positives = 148/364 (40%), Gaps = 41/364 (11%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN--------CH 55
           P+++DNGS  +K G S  ++P      +A     +  ++  ++    V N          
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLRGLLA 72

Query: 56  VRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQ 115
           +RRP   G++ +W+  E +W +  ++  +         D  L+++E  ++  +  + M +
Sbjct: 73  LRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGDHPLLITEAPLNSTKNRETMCE 132

Query: 116 VVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTW 175
           +++E + F +L    VA        A  +  G                  V++ G   + 
Sbjct: 133 ILYETFNFDALY---VAHPAVLSLYATGQTTGC-----------------VLECGEGYSA 172

Query: 176 VIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVS 235
             PV +G     +++++DIGGR +T    + + F        ++ +N+ +E    +   +
Sbjct: 173 STPVYQGFALPSSIRRIDIGGRDIT----QELQFYIRKSTGLSLFSNSEQEIVRTIKEKA 228

Query: 236 YFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEI 295
            + +   K E    ++     TS    V+ P      D Q L      +   E  F P++
Sbjct: 229 NYVALDYKFEEEKFFIHERENTST---VKLP------DGQELTFGKGKYRTSEILFQPQL 279

Query: 296 ANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWS 355
                  + E +LESI+ +   +R  ++ NI + GG   +  F  R  +E ++  P    
Sbjct: 280 IGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTTMLKGFDQRTMSETKKMLPKHTK 339

Query: 356 VRVH 359
           V++ 
Sbjct: 340 VKIR 343

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 80/171 (46%), Gaps = 22/171 (12%)

Query: 257 TSLIGYVRQPKQAIPEDSQTLNLEDEL------FTIPETFFHPEIANILKPGLIE---TV 307
           ++L  ++R P+   P DS+ ++ + ++        +PE  F P I  + + G++E   TV
Sbjct: 586 STLHLFLRGPR---PHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVELCETV 642

Query: 308 LESISMLPELIRPL------MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLP 361
           L  +       R L      M  N+ + GGN  +     R+  E     P    ++V L 
Sbjct: 643 L--LKKFDSSRRALSATCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTELKVTLA 700

Query: 362 KGDTELQGWKAMMRF-SNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
           K D  L  WK M +F S+  SYK   +T+ EY E+G ++  ++  G  +++
Sbjct: 701 K-DPSLSAWKGMAKFASDPTSYKSSILTKREYEEYGPEYIKEHNLGNAKFM 750

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 82/213 (38%), Gaps = 34/213 (15%)

Query: 2   GVPIIIDNGSYEIKFGPSSLKSPY-----RALNCLARDKYGRYHLSNQMKQIREVSNCHV 56
           G PI ID GSYE++ G  + K P      R      R     Y    +   +        
Sbjct: 40  GGPIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDRKASRTYTFVGRDTGLDASIRTQS 99

Query: 57  RRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDV--DLIVSETCMSIPEISKHMD 114
           R PF+   + +W+  + +  Y   +       ++    V   ++++E   ++     +  
Sbjct: 100 RSPFDGPMVTNWDYVDDMLAYTFHH-----LGVRGGGGVPNAVVLTERLATLQSQRANWY 154

Query: 115 QVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCT 174
           ++++E Y           Q + F   + +  YG  G              LVV SG   T
Sbjct: 155 ELLYEAYNL---------QEVTFGIDSLFSFYGERGP---------GSTGLVVSSGNEDT 196

Query: 175 WVIPVIKGVPYYKAVKKLDIGGR----FLTGLL 203
            V+PV+ G       K+++ GG+    +LTGLL
Sbjct: 197 CVVPVVDGRGVVSEAKRINWGGQQAVDYLTGLL 229

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 78/165 (47%), Gaps = 14/165 (8%)

Query: 254 DFQTSLIG-YVRQPKQAIPED---SQTLNLEDELFTIPETFFHPEIANILKPGLIETVLE 309
           D++ S++  ++R P+    ED      L+L  E    PE  F P +  + + G+ E + +
Sbjct: 579 DWRNSVLHLFLRGPRPHNGEDVHQQHQLHLNIERIRAPEVIFQPSMGGLDQAGIAE-LAD 637

Query: 310 SI------SMLPELIRPL--MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLP 361
            I      S   +L +    M SNI + GGN  I N   R+  E     P +  + V+  
Sbjct: 638 GILTKKFGSGSSKLSQQCLDMASNIFITGGNTKIPNLRERIVNEFTGFLPVNTPLNVNYA 697

Query: 362 KGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFG 406
           + +  L  WK M +F+ +D+Y    VT+ EY E G ++  +++ G
Sbjct: 698 Q-NVSLDAWKGMAKFARSDTYSSTCVTKVEYEEFGPNYIKEHKLG 741

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 84/219 (38%), Gaps = 34/219 (15%)

Query: 2   GVPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN-------- 53
             PI +D GSYE++ G +S  +P          K  RY      K +  + N        
Sbjct: 39  NTPIALDFGSYEVRAGFTSQDTPSHVFPT----KIVRYKERKIQKALTFIGNDCSLDNAV 94

Query: 54  -CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
             H R P++   + +WE  E +  Y   +         D     +I++E   ++     +
Sbjct: 95  RSHSRSPYDGSLITNWEYMEDMLSYTFHH---LGVQPNDGISNPMILTEKMATVQAQRSN 151

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFN 172
             Q++FE Y    +                   +G DGL      +  +   L+++SG  
Sbjct: 152 WYQLLFECYGIPQV------------------TFGIDGLFSFYANNSPDSTGLIINSGHE 193

Query: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
            T +IPVIKG       K++D GG      LK  +S ++
Sbjct: 194 DTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 78/164 (47%), Gaps = 18/164 (10%)

Query: 257 TSLIGYVRQPKQAIPEDSQ---TLNLEDELFTIPETFFHPEIANILKPGLIETVLESISM 313
           ++L  ++R P+    ED+     ++L  E   +PE  F P +  + + G+IE + E+I M
Sbjct: 582 STLHLFLRGPRPHDSEDAHEQHQMHLNVERIRVPEVIFQPPMGGLDQAGIIE-LSETIIM 640

Query: 314 LP--------ELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCP--TDWSVRVHLPKG 363
                       +   M +N+ + GGN  +     R+  E     P  T ++++V     
Sbjct: 641 NKFGSSRRQLSSVSQEMANNVFLTGGNVRVPGLRDRIVREFTEFLPVGTKYNIKV---AS 697

Query: 364 DTELQGWKAMMRFSNTDS-YKQGRVTRAEYLEHGVDWCTKYRFG 406
           D  +  WK M +F+ + + YK   VT+ EY E+G D+  +++ G
Sbjct: 698 DPAIDAWKGMAKFAQSSTDYKGSYVTKKEYEEYGPDYIKEHKLG 741

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 78/211 (36%), Gaps = 30/211 (14%)

Query: 2   GVPIIIDNGSYEIKFG--PSSLKS---PYRALNCLARDKYGRYHLSNQMKQIREVSNCHV 56
            VPI ID GS E++ G    SL S   P R      R     +        + +      
Sbjct: 36  NVPIAIDFGSSEVRAGYTNQSLPSHVFPTRLTRHRDRKINKTFTFVGNDTNLEQTLRTQS 95

Query: 57  RRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQV 116
           R PF+   + +W+  E + +Y     +       D     ++++E   ++     +  Q+
Sbjct: 96  RSPFDGPMITNWDYVEDMMEYTF---NHLGVVGHDGISNPILLTEKMATLQSQRSNWYQL 152

Query: 117 VFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWV 176
           +FE +    L                   +G D L      +  +   LV+ SG   T V
Sbjct: 153 MFECFGVPKL------------------TFGIDSLFSYFANNQSDSTGLVISSGNEDTNV 194

Query: 177 IPVIKGVPYYKAVKKLDIGGR----FLTGLL 203
           IPV+ G       K+++ GGR    + T LL
Sbjct: 195 IPVVCGKGILSEAKRINWGGRHSVEYTTNLL 225

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 20/165 (12%)

Query: 257 TSLIGYVRQPKQAIPEDSQTLN------LEDELFTIPETFFHPEIANILKPGLIETVLES 310
           ++L  ++R P+   P DS+ +N      L  E   +PE  F P +A + + G+ E    +
Sbjct: 581 STLHLFLRGPR---PHDSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICETN 637

Query: 311 I--------SMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPK 362
                    S L E  + L  +N+ + GGN  +     R+  E     P   ++ V +  
Sbjct: 638 FLKKFGSTRSQLSEGSKKL-AANVFLTGGNMRLPGVRERIVREFTGMLPMGSNLNVRMA- 695

Query: 363 GDTELQGWKAMMRFSNTDS-YKQGRVTRAEYLEHGVDWCTKYRFG 406
            D+ +  W+ M + S   S YK   +TR EY E G D+  ++  G
Sbjct: 696 SDSAVDAWRGMAKLSQAGSQYKGSYITRKEYQELGADYIKEHNLG 740

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/253 (20%), Positives = 101/253 (39%), Gaps = 41/253 (16%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN--------- 53
           VPI ID GS E++ G  +   P         ++  R+    + + +  + N         
Sbjct: 37  VPIAIDFGSSEVRAGFGNQDQPSHIFT----NRISRWRDRRKNRNLTFIGNDTNLDLSVR 92

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
              + P++   + +W+  E I +Y   +      +  D     ++++E   ++    ++ 
Sbjct: 93  SQAKSPYDGAIVSNWDYTEEIMEYTFHH---LGVNGNDGVSNPILMTEKLATLQSQRENW 149

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            Q++FE         C     + F         G D L      +D     LV++SG   
Sbjct: 150 YQLLFE---------CFGVPQVTF---------GIDSLFSFYANNDATASGLVINSGNED 191

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGR----FLTGLLKETVSFRHYNLMDETILANNIKEQCC 229
           T VIPV+ G       K+++ GGR    +L+ LL   + + ++ +   T    ++ E  C
Sbjct: 192 THVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL--ALKYPYFPIKPSTHQFQSLYEDFC 249

Query: 230 FMPPVSYFDSFQK 242
           ++  V Y D  +K
Sbjct: 250 YV-SVDYQDEIRK 261

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 18/164 (10%)

Query: 257 TSLIGYVRQPKQAIPEDSQTLN------LEDELFTIPETFFHPEIANILKPGLIETVLES 310
           ++L  ++R P+   P DS+ +N      L  E   +PE  F P +  + + G+IE    +
Sbjct: 581 STLHLFLRGPR---PHDSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIEICETN 637

Query: 311 I-------SMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPKG 363
                         I   + SN+ + GGN  +     R+  E +   P    + V +   
Sbjct: 638 FLKKFGSSRSELSSISRSLASNVFLTGGNMRLPGMRERVVREFRGLLPIGTELNVRMA-N 696

Query: 364 DTELQGWKAMMRFSNTDS-YKQGRVTRAEYLEHGVDWCTKYRFG 406
           D  L  W+ M + S TDS ++   VTR EY E+G D+  ++  G
Sbjct: 697 DCALDAWRGMAKLSRTDSLFRDTYVTRQEYHEYGPDYIKEHNLG 740

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 102/251 (40%), Gaps = 37/251 (14%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRAL-NCLARDKYGRYHLSNQMKQIREVSNCHV----- 56
             I ID GS E++ G  + + P     N +AR  +    L+  +  I   +N  +     
Sbjct: 37  TAIAIDFGSSEVRAGYGNQERPSHIFPNRIAR--WRDRKLNRNLTFIGNDTNLDLSVRSQ 94

Query: 57  -RRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQ 115
            R P++   + +W+  E I +Y   +         D     +I++E   ++     +  Q
Sbjct: 95  SRSPYDGALVTNWDYTEDIMEYTFHH---LGVKGTDGIPNPIIMTEKLGALHSQRDNWYQ 151

Query: 116 VVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTW 175
           ++FE         C  A  + F         G D L      +D +   LV+ SG   T 
Sbjct: 152 LLFE---------CFGAPQVTF---------GLDSLFSFYANNDASASGLVISSGNEDTH 193

Query: 176 VIPVIKGVPYYKAVKKLDIGGR----FLTGLLKETVSFRHYNLMDETILANNIKEQCCFM 231
           +IPV+ G       K+++ GGR    +L+ LL   + + ++ +   T     + ++ C++
Sbjct: 194 IIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL--ALKYPYFPIKPSTHQFKALYDEFCYV 251

Query: 232 PPVSYFDSFQK 242
            P  Y D  Q+
Sbjct: 252 SP-DYQDEIQR 261

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 85/172 (49%), Gaps = 17/172 (9%)

Query: 254 DFQTSLIG-YVRQPK----QAIPEDSQTLNLEDELFTIPETFFHPEIANILKPGLIETVL 308
           D++ S++  ++R P+    ++I E  Q ++L  E   +PE  F P I  + + G++E + 
Sbjct: 577 DWRNSVLHLFLRGPRSHDSESIHEQHQ-MHLNVERIRVPEVIFQPSIGGLDQAGIVE-LC 634

Query: 309 ESI------SMLPEL--IRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHL 360
           E++      S   EL  I  +M  NI + GGN  +     R+  E     P   ++ V L
Sbjct: 635 ETLLLKKFGSNRRELSEISKMMAKNIFITGGNAKLPGIRERVVREFTGFLPVGTNLNVKL 694

Query: 361 PKGDTELQGWKAMMRFSNTDS-YKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411
            + D  +  W+ M +F+N  S Y+   +T+ EY E G ++  ++  G  +++
Sbjct: 695 AE-DPSMSAWRGMAKFANNTSLYETSIMTKKEYEELGPEYIKEHNLGNAKFV 745

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 85/216 (39%), Gaps = 30/216 (13%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRAL-NCLAR---DKYGR-YHLSNQMKQIREVSNCHVR 57
            PI ID GSYE++ G  +   P     N LAR    K  R Y        + +      +
Sbjct: 37  TPIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYTFVGNDTNLDQSIRTQSK 96

Query: 58  RPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVD--LIVSETCMSIPEISKHMDQ 115
            PF+   + +W+  + I  Y   +      D++ +  V   ++++E   ++     +  +
Sbjct: 97  SPFDGSMITNWDYVDDILAYTFHH-----LDVRGNGGVPNPVLITERMAALQSQRSNWYE 151

Query: 116 VVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTW 175
           ++FE         C   Q + F   + +  YG                 + ++SG   T 
Sbjct: 152 LLFE---------CYNLQKVTFGIDSLFSFYGEHPPGTT---------GIAINSGNEDTS 193

Query: 176 VIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           VIPV+ G       K+++ GG+   G L   +S ++
Sbjct: 194 VIPVVNGKGILTEAKRINWGGQQSVGYLNGLLSLKY 229

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 76/161 (47%), Gaps = 12/161 (7%)

Query: 257 TSLIGYVRQPKQAIPEDSQ---TLNLEDELFTIPETFFHPEIANILKPGLIE----TVLE 309
           ++L  ++R P+    E+S     +++  E   +PE  F P +    + G+IE     +L+
Sbjct: 590 STLHLFLRGPRPFDSENSHEQHQMHMNIERPRVPEILFQPRMGGCDQAGIIELSETMLLK 649

Query: 310 SISMLPELIR---PLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPKGDTE 366
                P  +      M  N+ + GG+  +    +R+  E     P D    V++ K  + 
Sbjct: 650 KFGSKPSKLSDQAEAMAKNVWITGGHAQLPGLKTRIVKEFTSFLPNDAKFSVNISKHPS- 708

Query: 367 LQGWKAMMRFSNTDS-YKQGRVTRAEYLEHGVDWCTKYRFG 406
           L  WK M +FS+ D+ +K   +++ EY E+G ++  ++R G
Sbjct: 709 LDAWKGMAKFSSDDADFKSSLISKKEYEEYGPEYIKEHRLG 749

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 45/217 (20%), Positives = 80/217 (36%), Gaps = 30/217 (13%)

Query: 2   GVPIIIDNGSYEIKFGPSSLKSPYRALNCLAR-DKYGRYHLSNQMKQIREVSN------C 54
            +PI ID G+  +K G  +   P  A N   R  ++    +S  M  I   +N       
Sbjct: 37  SIPIAIDFGTCSVKAGYVNKADP--AFNFPTRLTRFRDRKMSRTMTFIGNDTNLDYAVRS 94

Query: 55  HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMD 114
             + PF+   + +WE  E I +Y                   LI++E   ++     +  
Sbjct: 95  QSKTPFDGPFVTNWEYAEDILEYTF---KHLGVTANHGISNPLIMTEKLATLQSQRANWY 151

Query: 115 QVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCT 174
           Q++FE +   ++                   +G D +       D +   LV       T
Sbjct: 152 QLLFETFNTSNV------------------SFGIDNVFAFYANTDKHSSGLVFGLNNQDT 193

Query: 175 WVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
            VIP+I G P     K+++ GG    G L + ++ ++
Sbjct: 194 NVIPIIDGKPVLTDTKRINWGGSQSVGYLSDLMTLKY 230

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 73/159 (45%), Gaps = 18/159 (11%)

Query: 262 YVRQPKQAIPEDSQTLNLEDEL------FTIPETFFHPEIANILKPGLIET----VLESI 311
           ++R P+   P DS+ ++ + ++        +PE  F P +    + G+ E     + +  
Sbjct: 594 FLRGPR---PHDSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKF 650

Query: 312 SMLPELIRPL---MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPKGDTELQ 368
              P  +      M  N+ ++GGN  +    SR+  E     P+D  + V++ +  T L 
Sbjct: 651 GSTPRNLSQQSLDMAKNVWLVGGNAQVPGLKSRVVKEFTEFLPSDTKINVNISEAPT-LD 709

Query: 369 GWKAMMRFSNTDS-YKQGRVTRAEYLEHGVDWCTKYRFG 406
            W  M R +NT+  Y++  VT  EY E GVD+  +++  
Sbjct: 710 VWNGMYRLANTEEDYQRTIVTSEEYDECGVDYLKEHKLS 748

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 90/215 (41%), Gaps = 38/215 (17%)

Query: 2   GVPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQI---------REVS 52
            +PI ID GSYE++ G +++  P    + +  +++ +Y      K +          + +
Sbjct: 40  NIPIAIDFGSYELRAGYTNISRP----SHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTT 95

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
               R PF+   +V+W++ E I  Y   +         +     +I++E    +     +
Sbjct: 96  RSQARSPFDGPLVVNWDMVEDILQYTFHH---LGVQPDNGVTNPIIINEKLACLQSQRSN 152

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFN 172
             Q +FE   FG          +P  +MA       +G+      +  +   +V+D G+ 
Sbjct: 153 WYQTLFES--FG----------VPKVSMA------VEGMLAFYGHNGGSSTGIVIDCGYE 194

Query: 173 CTWVIPVIKGVPYYKAVKKLDIGGR----FLTGLL 203
            T VIP+++G       K+++ GG     +L+ LL
Sbjct: 195 DTNVIPIVEGQGMMLDAKRINWGGHSSIDYLSNLL 229

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 81/172 (47%), Gaps = 19/172 (11%)

Query: 254 DFQTSLIG-YVRQPKQAIPEDSQT------LNLEDELFTIPETFFHPEIANILKPGLIE- 305
           D++ S++  ++R P+   P DS+       ++L  E   +PE  F P +    + G+ E 
Sbjct: 585 DWRNSILHLFLRGPR---PHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICEL 641

Query: 306 ---TVLESISMLPELIRPL---MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVH 359
               +L+     P  +      MV+N+ + GGN  +     R+  E     PT  ++ V+
Sbjct: 642 SETILLKKFGSQPGKLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVN 701

Query: 360 LPKGDTELQGWKAMMRFS-NTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQW 410
           +   D  L  WK M   + N + Y++  +++ EY E+G ++  +++ G  ++
Sbjct: 702 M-SSDPSLDAWKGMAALARNEEQYRKTVISKKEYEEYGPEYIKEHKLGNTKY 752

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 43/213 (20%), Positives = 80/213 (37%), Gaps = 25/213 (11%)

Query: 4   PIIIDNGSYEIKFGPSSLKSPYRAL-NCLA--RDKY--GRYHLSNQMKQIREVSNCHVRR 58
           PI ID GS +++ G  +  +P     N L   RD+     +        + +      R 
Sbjct: 39  PIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQAVRSQSRS 98

Query: 59  PFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVF 118
           PF+   + +W L E I DY   +         +     ++++E   ++     +  Q++F
Sbjct: 99  PFDGPFVTNWNLTEEILDYTFHH---LGVVPDNGIPNPILLTERLATVQSQRTNWYQILF 155

Query: 119 EEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIP 178
           E Y    +           D++  +  Y   G          N   LV+  G   T VIP
Sbjct: 156 ETYNVPGVT-------FGIDSLFSFYNYNPSG----------NKTGLVISCGHEDTNVIP 198

Query: 179 VIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           V+ G       K+++ GG      L + ++ ++
Sbjct: 199 VVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 77/168 (45%), Gaps = 19/168 (11%)

Query: 254 DFQTSLIG-YVRQPKQAIPEDSQT------LNLEDELFTIPETFFHPEIANILKPGLIE- 305
           D++ S++  ++R P+   P DS+       ++L  E   +PE  F P +    + G+ E 
Sbjct: 585 DWRNSILHLFLRGPR---PHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICEL 641

Query: 306 ---TVLESISMLPELIRPL---MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVH 359
               +L+     P  +      MV+N+ + GGN  +     R+  E     P   +  V+
Sbjct: 642 SETILLKKFGSQPGKLSSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVN 701

Query: 360 LPKGDTELQGWKAMMRFS-NTDSYKQGRVTRAEYLEHGVDWCTKYRFG 406
           +   D  L  WK M   + N + YK+  +++ EY E+G D+  +++ G
Sbjct: 702 M-SSDPSLDAWKGMAALAQNKEEYKKTVISKKEYEEYGPDYIKEHKLG 748

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 45/215 (20%), Positives = 81/215 (37%), Gaps = 27/215 (12%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRAL-NCLA--RDKY--GRYHLSNQMKQIREVSNCHVR 57
           VPI ID GS +++ G  +  +P     N L   RD+     +        + +      R
Sbjct: 38  VPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQSR 97

Query: 58  RPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVV 117
            PF+   + +W   E I DY   +         +     ++++E   ++     +  Q++
Sbjct: 98  SPFDGPFVTNWNFTEEIMDYTFHH---LGVSPNNGVRNPILLTERMATVQSQRANWYQIM 154

Query: 118 FEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGL-PVVRKKDDYNDFQLVVDSGFNCTWV 176
           FE Y    +                   +G D L     +    N   LV+D G   T V
Sbjct: 155 FETYNVPGV------------------TFGIDSLYGFYNQNTSGNKTGLVIDCGHEDTNV 196

Query: 177 IPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           IPV+ G       K+++ GGR     L + ++ ++
Sbjct: 197 IPVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKY 231

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 77/167 (46%), Gaps = 18/167 (10%)

Query: 254 DFQTSLIG-YVRQPKQAIPEDS------QTLNLEDELFTIPETFFHPEIANILKPGLIE- 305
           D++ S++  ++R P+   P DS        ++L  E   +PE  F P +    + G+ E 
Sbjct: 581 DWRNSILHLFLRGPR---PHDSDDVHEQHQMHLNIERIRVPEVLFQPTMGGCDQAGVAEL 637

Query: 306 ---TVLESISMLPELIRPL---MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVH 359
               +L+     P  +      M +NI + GGN  +    +R+  E     P    + V+
Sbjct: 638 CETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAKVPGLKNRIVKEFTSFLPVGTKLSVN 697

Query: 360 LPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFG 406
           +   D  L  WK M +++ ++ Y +  +T+ EY E+G ++  +++ G
Sbjct: 698 M-SSDPLLDSWKGMAKWAKSEDYNKSFITKKEYEEYGPEYIKEHKMG 743

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 80/172 (46%), Gaps = 19/172 (11%)

Query: 254 DFQTSLIG-YVRQPKQAIPEDSQT------LNLEDELFTIPETFFHPEIANILKPG---L 303
           D++ S++  ++R P+   P DS+       ++L  E   +PE  F P +    + G   L
Sbjct: 585 DWRNSILHLFLRGPR---PHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICEL 641

Query: 304 IETVL-ESISMLPELIRPL---MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVH 359
            ET+L +     P  +      M +N+ + GGN  +     R+  E     P   ++ ++
Sbjct: 642 AETILLKKFGSQPGKLSQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININ 701

Query: 360 LPKGDTELQGWKAMMRFS-NTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQW 410
           +   D  L  WK M   + N + YK+  ++R EY E+G D+  +++ G  ++
Sbjct: 702 M-SSDPSLDAWKGMAALAQNEEEYKRTIISRKEYEEYGPDYIKEHKLGNTKY 752

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 40/214 (18%), Positives = 81/214 (37%), Gaps = 25/214 (11%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRAL-NCLA--RDKY--GRYHLSNQMKQIREVSNCHVR 57
           +PI ID GS +++ G  +  +P     N L   RD+     +        + +      +
Sbjct: 38  LPIAIDFGSSKLRAGFVNQSAPTHVFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQSK 97

Query: 58  RPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVV 117
            PF+   + +W   E I DY   +        ++     ++++E   ++     +  Q++
Sbjct: 98  SPFDGPFVTNWNFTEEILDYTFHH---LGIVPENGISNPILLTERMATVQSQRANWYQIL 154

Query: 118 FEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVI 177
           FE Y    +           D++  +  Y   G              LV+D G   T VI
Sbjct: 155 FETYNVPGVT-------FGIDSLYGFYNYYPSGKQT----------GLVIDCGHEDTNVI 197

Query: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           P++ G       K+++ GG      L + ++ ++
Sbjct: 198 PIVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 72/161 (44%), Gaps = 12/161 (7%)

Query: 257 TSLIGYVRQPKQAIPED---SQTLNLEDELFTIPETFFHPEIANILKPGLIE----TVLE 309
           ++L  ++R P+    ED      ++L  E   +PE  F P +  + + G+ E     +L 
Sbjct: 588 STLHLFLRGPRPHDSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLR 647

Query: 310 SISMLPELIRPL---MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPKGDTE 366
                P+ +  L   M +NI + GGN  I     R+  E +   P +    V++   D  
Sbjct: 648 KFGSEPKHLSELSLTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNTQFNVNMT-SDPT 706

Query: 367 LQGWKAMMRFS-NTDSYKQGRVTRAEYLEHGVDWCTKYRFG 406
              W  M + + N   YK+  +++ EY E+G ++  +++ G
Sbjct: 707 FDAWNGMAKLAQNETDYKKTIISKKEYEEYGPEYIKEHKLG 747

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 77/168 (45%), Gaps = 19/168 (11%)

Query: 254 DFQTSLIG-YVRQPKQAIPEDSQTLNLEDEL------FTIPETFFHPEIANILKPG---L 303
           D++ S++  ++R P+   P D ++++ + ++        +PE  F P +    + G   L
Sbjct: 579 DWRNSVLHLFLRGPR---PHDGESIHHQHQMHMNIERIRVPEVLFQPNMGGEDQAGIPEL 635

Query: 304 IETVL----ESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVH 359
            ET+L     S       +   M  N+ + GGN  +     R+  E     P+     + 
Sbjct: 636 CETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAKLPGLRERIVKEFSEFLPSGSPFSIR 695

Query: 360 LPKGDTELQGWKAMMRFS-NTDSYKQGRVTRAEYLEHGVDWCTKYRFG 406
             + D  L  W+ M + + NT+ +K G +T+ EYLE+G ++  ++  G
Sbjct: 696 KSQ-DPSLDAWRGMAKLAQNTEDFKHGYITKQEYLEYGPEYIKEHNLG 742

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 74/326 (22%), Positives = 128/326 (39%), Gaps = 54/326 (16%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRAL-NCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL- 62
           ++ID GS+    G S    P   L +C     YG+Y    + +   E S    R+ +E+ 
Sbjct: 17  VVIDPGSFTTNIGYSGTDCPQAILPSC-----YGKYTEGEKDELFSEQSIGLPRKDYEIH 71

Query: 63  -----GQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVV 117
                G++V WE  E  WD+ + +   F    + +  +  +++E   +  E  K   +V+
Sbjct: 72  NIVQNGEVVDWEKAEKQWDWAIRSELRF----ETNSGMPALLTEPIWNSEENRKKSLEVL 127

Query: 118 FEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVI 177
            E  +F +    P A  + F          + G P            LVVD G + T V 
Sbjct: 128 LESMDFSACYLVPTATAVSF----------AMGRPTC----------LVVDIGHDVTSVC 167

Query: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKE-----------TVSFRHYNLMDETILANNIKE 226
           PV+ G+   K+  +  I G  L  L++             V+ R    M+          
Sbjct: 168 PVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIHPS 227

Query: 227 QCCFMPPVSYFDSFQKK----AETRIDYVLPDFQTSLIGYVRQP--KQAIPEDSQTLNLE 280
              F+    +F  F++     A T I     + +T+    +  P  ++ + +  Q L   
Sbjct: 228 LQKFVNERQFFQEFKETMLQVAPTSISKFKSEIETTSKRSIEAPWGEELVYDSLQRLEFA 287

Query: 281 DELFTIPETFFHPEIANILKPGLIET 306
           ++LFT P+    PE   I K G++ET
Sbjct: 288 EQLFT-PDLSQFPEDWPISKDGVVET 312

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 302 GLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPT-DWSVRVHL 360
           GL + +  SI      +R  +  N+ + GG  ++     R++ EL R  P   + +    
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 361 PKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
              + + QGW      ++  ++ Q  V + EY E G D   K RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 94/216 (43%), Gaps = 27/216 (12%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRAL-NCLARDKYGRYHLSNQMKQIREVSNC------H 55
           +PI ID GSY +K G ++   P     N L R  Y    L+  M  I   +N        
Sbjct: 37  IPIAIDFGSYNVKAGYTNQSLPTHVFTNKLTR--YRDRKLAKTMTFIGNDTNLDQPLRIQ 94

Query: 56  VRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQ 115
            +RP++   + +WE  E I+DY L +    + +   S  + L     C+     + +  Q
Sbjct: 95  AKRPYDGLFIANWEYAEEIFDYTLHHLGVQTTNGSISNPIILTEKMACLQSQRANWY--Q 152

Query: 116 VVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTW 175
           ++FE ++  S      + Y  ++N A+   + SDGL              V++ G   T 
Sbjct: 153 LLFETFDVPSATFGLDSLYAFYNNCAN--PFESDGL--------------VINCGHEDTN 196

Query: 176 VIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           ++P+++G       K+++ GGR  T  L   ++ ++
Sbjct: 197 IVPIVQGKGILTEAKRINWGGRHSTEYLSSLLTLKY 232

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 76/165 (46%), Gaps = 13/165 (7%)

Query: 254 DFQTSLIG-YVRQPKQAIPED---SQTLNLEDELFTIPETFFHPEIANILKPGLIET--- 306
           D++ S++  ++R P+    ED      +++  E   +PE  F P I    + G+ E    
Sbjct: 590 DWRNSVLHLFLRGPRPHDSEDPHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSET 649

Query: 307 -VLESISMLPELIRPL---MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPK 362
             L   +  P  +  +   M++N+ + GG+  +     R+  E     P    + +++  
Sbjct: 650 LFLRKFNSSPRKLSSISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINI-S 708

Query: 363 GDTELQGWKAMMRF-SNTDSYKQGRVTRAEYLEHGVDWCTKYRFG 406
            D  L  WK M +  SNTD  K+ +VT+ +Y E+G ++  ++  G
Sbjct: 709 NDPSLDTWKGMAKLASNTDYLKKIQVTKKDYEEYGPEYMMEHNLG 753

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 80/172 (46%), Gaps = 19/172 (11%)

Query: 254 DFQTSLIG-YVRQPKQAIPEDSQT------LNLEDELFTIPETFFHPEIANILKPG---L 303
           D++ SL+  ++R P+   P DS+       ++L  E   +PE  F P +    + G   L
Sbjct: 585 DWRNSLLHLFLRGPR---PHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICEL 641

Query: 304 IETVLESI--SMLPELIRPL--MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVH 359
            ET+L     S   +L      MV+NI + GGN  +     R+  E     P   +V V+
Sbjct: 642 SETILMKKFGSQRGKLSSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVN 701

Query: 360 LPKGDTELQGWKAMMRFS-NTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQW 410
           +   +  L  W+ M   + N   YK+  +++ EY E+G D+  +++ G  ++
Sbjct: 702 I-SSNPSLDAWRGMAALARNKAEYKKTVISKEEYEEYGPDYIKEHKLGNTKY 752

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 39/214 (18%), Positives = 78/214 (36%), Gaps = 25/214 (11%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRAL-NCLA--RDKY--GRYHLSNQMKQIREVSNCHVR 57
           +PI ID GS  ++ G  +  +P     N L   RD+     +        + +      R
Sbjct: 38  LPIAIDFGSSRLRAGFVNQATPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQSR 97

Query: 58  RPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVV 117
            PF+   + +W   E I DY   +         +     ++++E   ++     +  Q++
Sbjct: 98  SPFDGPFVTNWNFTEEIMDYTFHHLGVLP---NNGISNPILLTERMATVQSQRANWYQIL 154

Query: 118 FEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVI 177
           FE Y    +     + Y  ++N       G                 LV+D     T V+
Sbjct: 155 FETYNVPGVTFGIDSLYSFYNNNPSGNKTG-----------------LVIDCSHEDTSVV 197

Query: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           P++ G       K+++ GG      L + ++ ++
Sbjct: 198 PIVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 89/212 (41%), Gaps = 40/212 (18%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVS------------ 52
           I+ID GSY    G S    P      +    YG+Y  + + +  ++              
Sbjct: 15  IVIDPGSYTTNIGYSGSDCP----ESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARP 70

Query: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
           +  ++R  E G++  W+  +  WD+ L N + F   LK +  + ++++E   +  E  K 
Sbjct: 71  DYEIKRIVENGEIADWDTAQEQWDWVLKN-ELF---LKSNSGIPVLLTEPIWNSVENRKK 126

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFN 172
             +V+ E  +F +    PV+  + F          + G P            LVVD G +
Sbjct: 127 SLEVLLEGMDFEACYLSPVSTCVSF----------AAGRPNC----------LVVDIGHD 166

Query: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLK 204
            T V PVI G+   K+  +  I GR++  L++
Sbjct: 167 TTSVSPVIDGMTLSKSSTRNFIAGRYINHLIE 198

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 86/210 (40%), Gaps = 35/210 (16%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQI-REVSNCHVRRPFEL- 62
           ++ID GSY    G S    P   L  +    YG+Y      K+I  E S    R+ +EL 
Sbjct: 17  VVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKDYELK 72

Query: 63  -----GQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVV 117
                G ++ W+  +  W + L N       L  +  +  +++E   +  E  K   +V+
Sbjct: 73  PIIENGLVIDWDTAQEQWQWALQNE----LYLNSNSGIPALLTEPVWNSTENRKKSLEVL 128

Query: 118 FEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVI 177
            E  +F +    P +  + F          + G P            LVVD G +   V 
Sbjct: 129 LEGMQFEACYLAPTSTCVSF----------AAGRPNC----------LVVDIGHDTCSVS 168

Query: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETV 207
           P++ G+   K+ ++  I G+F+  L+K+ +
Sbjct: 169 PIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 5/107 (4%)

Query: 302 GLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLP 361
           GL + V  SI      +R  +  N+ + GG  +I   + RL TEL +  P+    R+ L 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS-LKFRI-LT 441

Query: 362 KGDT---ELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
            G T   + Q W      ++  ++ Q  V + EY E GV+     RF
Sbjct: 442 TGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 83/212 (39%), Gaps = 30/212 (14%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNC-----LARDKYGRYHLSNQMKQIREVSNCHVRRP 59
           ++ID GSY    G S   SP   +          +K G+   ++Q   +    +  ++R 
Sbjct: 17  VVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFEIKRI 75

Query: 60  FELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFE 119
            E G +V WE  +  W + + +  +F       K     ++E   +  E  K   +V+ E
Sbjct: 76  LEDGCVVDWEAAQEQWTWAIRDELKFG----SFKGTPAFLTEAIWNSEENRKKSLEVLLE 131

Query: 120 EYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIPV 179
             EF +    P A  + F          + G P            LVVD G +   V PV
Sbjct: 132 GMEFEACYIAPTATCVSF----------AMGRPTC----------LVVDIGHDVASVCPV 171

Query: 180 IKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           + G+   K+  +  + G+ L  L+++ +  R 
Sbjct: 172 VDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 9/112 (8%)

Query: 295 IANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPT-D 353
           +AN++   ++ET ++        +R  +  N+ V GG+ +I   A RL TEL ++ P   
Sbjct: 377 LANLVNTAIMETDVD--------LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALK 428

Query: 354 WSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
           + +       + + + W      S+  ++ Q  V R EY E G +   K RF
Sbjct: 429 FRILTSGHLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 84/210 (40%), Gaps = 35/210 (16%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQI-REVSNCHVRRPFEL- 62
           ++ID GSY    G S    P   L  +    YG+Y      K I  E S    R+ +EL 
Sbjct: 17  VVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKDYELK 72

Query: 63  -----GQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVV 117
                G ++ W+  +  W + L N       L  +     +++E   +  E  K   +V+
Sbjct: 73  PIVKDGLVIDWDTAQEQWQWALKNE----LYLNSNSGTPALLTEPVWNSTENRKKSLEVL 128

Query: 118 FEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVI 177
            E  +F +    P +  + F          + G P            LVVD G +   V 
Sbjct: 129 LEGMQFEACYLAPTSTCVSF----------AAGRPNC----------LVVDIGHDTCSVS 168

Query: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETV 207
           P++ G+   K+ ++  + G+F+  L+K+ +
Sbjct: 169 PIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 72/179 (40%), Gaps = 26/179 (14%)

Query: 247 RIDYVLPDFQTSLIGYVRQPKQAIPED-----------SQTLNLEDELFTIPETFFHP-E 294
           R DYV P  +T   G  +  K+A P D           S T N  D   T  E+   P E
Sbjct: 316 RNDYV-PLKRTKPSGINKAEKKATPADEKEQATVSKSTSPTANSAD---TPNESGKRPLE 371

Query: 295 IANILKP-----GLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQ 349
              +LK      GL   V  SI      +R  +  N+ + GG   I   + RL TEL + 
Sbjct: 372 EEKLLKSDNELIGLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKI 431

Query: 350 CPTDWSVRVHLPKGDT---ELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
            P+    R+ L  G T   + Q W      ++  ++ Q  V + EY E GV+     RF
Sbjct: 432 LPS-LKFRI-LTTGHTMERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 99/498 (19%), Positives = 169/498 (33%), Gaps = 129/498 (25%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRAL-NCLARDKYGRYHLSNQMKQIREV----------SN 53
           ++ID GS+    G S    P   L +C    K       +  K   +V           +
Sbjct: 17  VVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLTFPRPD 76

Query: 54  CHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHM 113
             ++   E G +V W+  +  WD+ L N       L+ +K V  +++E+  +  E     
Sbjct: 77  YEIKPIVENGLVVDWDAAQEQWDWALRN----VLHLESNKGVPALMTESIWNTMENKTKS 132

Query: 114 DQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
            +V+ E  +F +         + F          + G P            LVVD G + 
Sbjct: 133 LEVLLETLDFEACYISSTPTCVSF----------ATGRPNC----------LVVDVGHDT 172

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH---------------------- 211
               PV+ G+   ++ ++  I G+F+  L+ + +  R                       
Sbjct: 173 ASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPREIIPLFEIAQRRPEFKKKNFEFN 232

Query: 212 -----YNLMDETILANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLI------ 260
                YN  +E       KE  C + P +  D F+ + E+     +    T  I      
Sbjct: 233 IDPSLYNFANERGFFQECKETLCQIAPTT-LDKFKPELESTAKRSIEAPWTEEIVFDNPS 291

Query: 261 --GYVRQ-----------------------------------PKQAIPED---SQTLNLE 280
             G+  Q                                   P  + PE     +T + E
Sbjct: 292 RYGFAEQLFYPQSEDIPEGWPVSKDGIVETWHNDYVPLKRNKPSGSKPEKPNGEETPSGE 351

Query: 281 DELFTIPETFFH----------PEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIG 330
           D+  T   T  H           E+A     G+ + V  SI+     +R  +  NI + G
Sbjct: 352 DQASTSETTNEHGKRPMEDSESSELA-----GISDLVHSSITSADVDLRATLAHNIVLTG 406

Query: 331 GNFNISNFASRLATELQRQCPTDWSVRVHLPKG---DTELQGWKAMMRFSNTDSYKQGRV 387
           G+ ++  F+ RL  EL ++ P     RV L  G   + + Q W      ++  S+ Q  V
Sbjct: 407 GSSSVPGFSDRLMNELTKKLPA-LKFRV-LTTGHLRERQYQSWLGGSILTSLGSFHQLWV 464

Query: 388 TRAEYLEHGVDWCTKYRF 405
            + EY E G +     RF
Sbjct: 465 GKREYEEVGAERLLNDRF 482

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 5/108 (4%)

Query: 301 PGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHL 360
           PG+++ +  SI      +R  +  NI + GG   I  F+ RL  EL ++ P     RV L
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPA-LKFRV-L 452

Query: 361 PKGDT---ELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
             G T   + Q W      S+  ++ Q  V + EY E G D   K RF
Sbjct: 453 TTGQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 88/231 (38%), Gaps = 52/231 (22%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHL-----------------SNQMKQ 47
           ++ID GS+    G S    P   L       YG   L                 +N+ K+
Sbjct: 17  VVIDPGSFTTNIGYSGTDCPQAILPSY----YGEISLKEVASEGNEEIEENSASNNKSKK 72

Query: 48  I-REVSNCHVRRPFEL------GQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVS 100
           I  E S  + R  +E+      G+++ W+  +  WD+ L N+      L+ +  +   ++
Sbjct: 73  IFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNA----LYLESNSGIPAFLT 128

Query: 101 ETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDY 160
           E   +  E  K   +V+ E  +F +    P    I F          + G P        
Sbjct: 129 EPIWNTVENRKKSLEVLLEGLQFEACYLSPTPTCISF----------ASGRPNC------ 172

Query: 161 NDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
               LVVD G +   V PVI G+   K+  +  I GRF+   +KE +  R 
Sbjct: 173 ----LVVDIGHDVASVSPVIDGMTLSKSSMRNFISGRFINEKIKEFLKPRE 219

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 84/212 (39%), Gaps = 30/212 (14%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRAL-NC----LARDKYGRYHLSNQMKQIREVSNCHVRRP 59
           ++ID GSY    G S   SP   + +C     A  K G+   ++Q   I    +  ++R 
Sbjct: 17  VVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQF-MIMPRPDFEIKRI 75

Query: 60  FELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFE 119
            E G +V WE  +  W + + +  +F    +  K     ++E   +  E  K   +V+ E
Sbjct: 76  LENGCVVDWEAAQEQWAWAIRDELKF----ESFKGTPAFLTEAIWNPEENRKKSLEVLLE 131

Query: 120 EYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIPV 179
             EF +    P A    F          + G P            LV+D G +   V PV
Sbjct: 132 GMEFEACYIAPTATCTSF----------AMGRPTC----------LVLDIGHDVASVCPV 171

Query: 180 IKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           + G+   K+  +  + G+ L  L++  +  R 
Sbjct: 172 VDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 1/105 (0%)

Query: 302 GLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPT-DWSVRVHL 360
           GL + V  +I+     +R  +  N+ V GG+ +I     RL TEL ++ P   + +    
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSG 435

Query: 361 PKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
              + + + W      S+  ++ Q  V R EY E G +   K RF
Sbjct: 436 HLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 84/210 (40%), Gaps = 35/210 (16%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQI-REVSNCHVRRPFEL- 62
           ++ID GSY    G S    P   L  +    YG+       K I  E S    R+ +EL 
Sbjct: 17  VVIDPGSYTTNIGYSGSDFPQSILPSV----YGKSTSDKDSKTIFSEQSIGIPRKDYELK 72

Query: 63  -----GQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVV 117
                G ++ W+  +  W + L N       L  +  +  +++E   +  E  K   +V+
Sbjct: 73  PIIENGLVIDWDTAQEQWQWALKNE----LYLDSNSGIPALLTEPVWNSTENRKKSLEVL 128

Query: 118 FEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVI 177
            E  +F +    P +  + F          + G P            LVVD G +   V 
Sbjct: 129 LEGMQFEACYLAPTSTCVSF----------AAGRPNC----------LVVDIGHDTCSVS 168

Query: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETV 207
           P++ G+   K+ ++  I G+F+  L+K+ +
Sbjct: 169 PIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 5/107 (4%)

Query: 302 GLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLP 361
           GL + V  SI      +R  +  N+ + GG  +I   + RL TEL +  P+    R+ L 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS-LKFRI-LT 441

Query: 362 KGDT---ELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
            G T   + Q W      ++  ++ Q  V + EY E GVD     RF
Sbjct: 442 TGHTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 74/168 (44%), Gaps = 19/168 (11%)

Query: 254 DFQTSLIG-YVRQPKQAIPEDSQT------LNLEDELFTIPETFFHPEIANILKPG---L 303
           D++ S++  ++R P+   P DS+       L+L  E   +PE  F P I    + G   L
Sbjct: 582 DWRNSVLHLFLRGPR---PHDSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISEL 638

Query: 304 IETVLES-ISMLPELIRPL---MVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVH 359
            ET+L +     P  +      M  NI + GG+  +     R+  E     P    + V 
Sbjct: 639 CETILSNKFGSKPRELSETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVK 698

Query: 360 LPKGDTELQGWKAMMRFS-NTDSYKQGRVTRAEYLEHGVDWCTKYRFG 406
           + K  + L  W  M + + N   YK   +++ +Y E+G ++  +++ G
Sbjct: 699 MSKNPS-LDAWYGMRKLAQNEADYKDSIISKKDYEEYGAEYIKEHKLG 745

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 89/215 (41%), Gaps = 28/215 (13%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRAL-NCLARDKYGRYH-----LSNQMKQIREVSNCHV 56
            PI ID GSYE++ G +S   P     N L R +  +       + N +  + +      
Sbjct: 37  TPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSKTFTFIGNDV-LLDQTVRSQS 95

Query: 57  RRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQV 116
           + PF+   + +W+  E I  Y  FN      D  +S    LI++E   S+    K+  ++
Sbjct: 96  KSPFDGSFIANWDYVEDIMQYT-FNHLGVVGD--NSVRNPLIINEPLGSLQSQRKNWYEL 152

Query: 117 VFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWV 176
           +FE +   ++                   +G DG+      ++ N   +V++     T V
Sbjct: 153 LFECFHLPNV------------------SFGIDGMFGFYANNEGNQDGIVINCSNEETDV 194

Query: 177 IPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           IPV+ G       K+++ GGR     L + +S ++
Sbjct: 195 IPVVDGRGVLTDAKRINWGGRQAVDYLSDLMSLKY 229

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 84/210 (40%), Gaps = 35/210 (16%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHL-SNQMKQIREVSNCHVRRPFEL- 62
           ++ID GSY    G S    P   L  +    YG+     N  K   E S    R+ +EL 
Sbjct: 17  VVIDPGSYTTNIGYSGSDFPQSILPSV----YGKLTADENSKKMFSEQSIGIPRKDYELK 72

Query: 63  -----GQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVV 117
                G ++ W+  +  W + L N       L  +  +  +++E   +  E  K   +V+
Sbjct: 73  PIIENGLVIDWDTAQEQWQWALRNE----LYLDSNSGIPALLTEPVWNSMENRKKSLEVL 128

Query: 118 FEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVI 177
            E  +F +    P +  + F          + G P            LVVD G +   V 
Sbjct: 129 LEGMQFEACYLAPTSTCVSF----------AAGRPNC----------LVVDIGHDTCSVS 168

Query: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETV 207
           P++ G+   K+ ++  I G+F+  L+++ +
Sbjct: 169 PIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 5/107 (4%)

Query: 302 GLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLP 361
           GL   V  SI      +R  +  N+ + GG  +I   + RL TEL +  P+    R+ L 
Sbjct: 383 GLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPS-LKFRI-LT 440

Query: 362 KG---DTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
            G   + + Q W      ++  ++ Q  V + EY E G++     RF
Sbjct: 441 TGHIRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 76/334 (22%), Positives = 133/334 (39%), Gaps = 69/334 (20%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRAL-NCLARDKYGRYHLSNQMKQI-REVSNCHVRRPFEL 62
           IIID GS+    G S    P   L +C     YG+Y    +   +  E S    R+ +E+
Sbjct: 17  IIIDPGSFNTNIGYSGTDCPQAILPSC-----YGQYINDEEKPSLFNEQSIGLPRKDYEI 71

Query: 63  ------GQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQV 116
                 G++V W+  +  W++ + +   F    + +K +  +++E   +  +  K   +V
Sbjct: 72  KEIVRSGEVVDWDKAQEQWEWAIKSVLLF----ESNKGLPALLTEPIWNSEDNRKKSLEV 127

Query: 117 VFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWV 176
           + E  +F +    P A  + F          + G P            LVVD G + T V
Sbjct: 128 LLEGMDFEACYLTPTATAVSF----------AMGRPTC----------LVVDIGHDITSV 167

Query: 177 IPVIKGVPYYKAVKKLDIGGRFLTGLLKETVS------------------FRHYNLMDET 218
            PVI G+   K+  +  I G  L  L++ ++                    R ++     
Sbjct: 168 SPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPEFVKRSFDYEIHP 227

Query: 219 ILANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQA-----IPED 273
            L N + E+        +F  F++         L  F++ L    ++  +A     +  D
Sbjct: 228 SLLNFVNER-------QFFQEFKETMLQVAPTSLTKFKSELEQLSKRSIEAPWGEDLVFD 280

Query: 274 SQT-LNLEDELFTIPETFFHPEIANILKPGLIET 306
           S+T  N+ ++LF  PET   PE   I K G++ET
Sbjct: 281 SETRFNIAEQLFR-PETAKFPEDWPISKDGVVET 313

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 48/114 (42%), Gaps = 2/114 (1%)

Query: 293 PEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPT 352
           PE  N +  GL + +  SI      +R  +  N+ + GG+ +I     R+  EL +  P 
Sbjct: 367 PEAKNEIS-GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPA 425

Query: 353 -DWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
             + +       + + Q W      ++  ++ Q  V + EY E G D   K RF
Sbjct: 426 LKFRMLTSGQAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 83/222 (37%), Gaps = 39/222 (17%)

Query: 5   IIIDNGSYEIKFG-----------PSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVS- 52
           +IID GSY    G           PSS    + A    + D   +   + ++   + +  
Sbjct: 17  VIIDPGSYTTNIGYAGTDCPQSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSEQSIPI 76

Query: 53  ---NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEI 109
              +  V+R  E GQ+  W+     W + L N       ++ ++ +  +++E   +  E 
Sbjct: 77  PRPDYEVKRVVENGQVCDWDSAVEQWSWALRNE----LHIESNRGIPAMLTEPLWNSKEN 132

Query: 110 SKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDS 169
                +++ E  EF +      +  + F          + G P            L+VD 
Sbjct: 133 RSKSLEILLEGMEFEACYLTATSTAVSF----------ATGRP----------NSLIVDI 172

Query: 170 GFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           G +   V PVI G+   K+ +     GRFL  LL + +  R 
Sbjct: 173 GHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 5/101 (4%)

Query: 301 PGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHL 360
           PG+++ +  SIS     IR  +  N+ + GG+  I   + R+  EL  + P     RV L
Sbjct: 387 PGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPA-LKFRV-L 444

Query: 361 PKGDT---ELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVD 398
             G +   + Q W      S+  ++ Q  + + EY E G +
Sbjct: 445 ATGQSIERQYQSWLGGSILSSLGTFHQLWIGKKEYEEVGSE 485

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 8/88 (9%)

Query: 312 SMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCP----TDWSVRVHLPKGDTEL 367
           S  PE I   +++N+ +IGG   +     RL  +L  Q P    + ++   H+   D +L
Sbjct: 313 SATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHV---DRQL 369

Query: 368 QGWKAMMRFSNTDSYKQGR-VTRAEYLE 394
           Q W+  +   +   +K G  VT+ EYLE
Sbjct: 370 QSWQGGVNMCHLPDWKLGSWVTKQEYLE 397

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 63/141 (44%), Gaps = 2/141 (1%)

Query: 266 PKQAIPEDSQTLNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSN 325
           P + I E+ +    + E   +P+     +I NI+ PG+ + V  +++     +R  +  N
Sbjct: 456 PSENINENGKRSIEDGENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHN 514

Query: 326 IAVIGGNFNISNFASRLATELQRQCPT-DWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQ 384
           + + GG   I   A RL  EL ++ P   + +     + + + Q W      ++  ++ Q
Sbjct: 515 VILTGGTSLIPGLADRLMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQ 574

Query: 385 GRVTRAEYLEHGVDWCTKYRF 405
             V + EY E G D   K RF
Sbjct: 575 LWVGKREYEEVGPDRLLKDRF 595

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 66/163 (40%), Gaps = 30/163 (18%)

Query: 52  SNCHVRRPFELGQLVSWELEEHIWDYCLFNS---DEFSWDLKDSKDVDLIVSETCMSIPE 108
           S+  V+R  E G +  W++ E  W + L      D F       K +  +++E   +  +
Sbjct: 157 SDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSF-------KGIPALLTEPVWNTVQ 209

Query: 109 ISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVD 168
             K   +V+ E+ EF +     +   + F          + G P            LVVD
Sbjct: 210 NRKKSLEVLLEKMEFEACYLTTIPTNVSF----------AAGKPNC----------LVVD 249

Query: 169 SGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
            G +   V PVI G+   K+V++    GR+L  LL+  +  R 
Sbjct: 250 VGHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 67/163 (41%), Gaps = 38/163 (23%)

Query: 274 SQTLNLED-ELFTIPETFFHPEIAN---ILKPGLIETVLESI------------------ 311
           ++TL LE  E + + E  F P++A+     K GL E V++++                  
Sbjct: 256 NKTLTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVTTSNSGPAGGG 315

Query: 312 --------------SMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPT-DWSV 356
                         +  PE I   +++NI + G    +     R+  EL  Q P    S 
Sbjct: 316 GPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSYQFPQYKLSS 375

Query: 357 RVHLPKGDTELQGWKAMMRFSNTDSYKQGR-VTRAEYLEHGVD 398
             +    D +LQ W+  +  SN  S++ G  +TR EY  +G++
Sbjct: 376 FANPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANGIN 418

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 85/221 (38%), Gaps = 42/221 (19%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRY-------HLSNQMKQIREVSNCHVR 57
           +IID GS+    G S    P   L       YG Y         + + K+I   S+  + 
Sbjct: 17  VIIDPGSFSTNIGYSGTDYPQSILPS----SYGTYKETTEGQESTTKRKRIFSESSIQIP 72

Query: 58  RP-------FELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEIS 110
           RP        E G ++ W+  +  W + L    +    L+ +  +  +++E   +  E  
Sbjct: 73  RPDYEIKRIVENGSIMDWDAAQEQWSWAL----KSQLHLQSTSGIPALLTEPIWNSVENR 128

Query: 111 KHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSG 170
           K   +++ E   F +     V   + F          + G P            LVVD G
Sbjct: 129 KKSLEILLEGMNFEACYLSSVPTCVSF----------AAGRPNC----------LVVDIG 168

Query: 171 FNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
            + T V PV+ G+   K+  +  I G+++  L+++ +  R 
Sbjct: 169 HDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPRE 209

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 1/106 (0%)

Query: 301 PGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPT-DWSVRVH 359
           PG+++ +  SI+     +R  +  N+ + GG   I   + R+  EL ++ P   + V  +
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 360 LPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
               + + Q W      S+  ++ Q  V + EY E G D     RF
Sbjct: 457 GQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 64/160 (40%), Gaps = 24/160 (15%)

Query: 52  SNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISK 111
           +N  ++   + G++V W+  +  W + L N       LK ++ V  +++E   +  E  K
Sbjct: 90  ANYEIKPIVQNGEVVDWDAAQEQWSWALEN----ELFLKSNEGVPALLTEPIWNTVENRK 145

Query: 112 HMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGF 171
              +V+ E   F +         + F         G                 LVVD G 
Sbjct: 146 KSLEVLLEGMGFEACYLSATPTCVSF-------AAGRSNC-------------LVVDIGH 185

Query: 172 NCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           +   V PV+ G+ + K+ ++  I G++L  L+ + +  R 
Sbjct: 186 DIISVSPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPRE 225

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 82/216 (37%), Gaps = 41/216 (18%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRAL-NCLARDKYGRYHLSN-----QMKQIREVSNCHVRR 58
           ++ID GSY    G S    P   L +C     YG Y  ++     + K   E S C  R+
Sbjct: 17  VVIDPGSYSTNIGYSGTDCPQAILPSC-----YGDYTNTDDPEGKKKKVFSEQSICIPRK 71

Query: 59  PFEL------GQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112
            +E+      G ++ W+  +  W + L N       L+ +  +  +++E   +  E  K 
Sbjct: 72  DYEIKPIVENGVVIDWDAAQEQWSWALEN----QLYLRSNSGIPALLTEPIWNTVENRKK 127

Query: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFN 172
             +++ E  +F +         + F                           LVVD G +
Sbjct: 128 SLELLLEGMDFEACYLASTPTCVSFGTG--------------------RSSCLVVDLGHD 167

Query: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVS 208
              V PV+ G+   K+ K+    G +L  L+K  +S
Sbjct: 168 TCSVSPVVDGMTLSKSTKRNFFAGGYLNELIKNYIS 203

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 81/214 (37%), Gaps = 35/214 (16%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIRE-------VSNCHVR 57
           I+ID GS+    G S    P      +    YG        K+I          +   ++
Sbjct: 17  IVIDPGSFVTNIGYSGTDCP----QSIMPSSYGNVETDGDTKRIFNEQPLLFPRAGMEIK 72

Query: 58  RPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVV 117
              E   +V W+  +  W+Y L N+D      + +K   ++++E   +     K   +++
Sbjct: 73  PIVENSTIVDWDRAQEQWEYAL-NTD---LKFESNKGTPVLLTEPIWNSEASRKKSLEIL 128

Query: 118 FEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVI 177
            E  EF +      +  + F          + G P            LVVD G + + V 
Sbjct: 129 LESMEFEACYLAANSSAVSF----------AMGRPTC----------LVVDIGHDVSTVS 168

Query: 178 PVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           PVI G+   K+  +  + G++L  L+ + +  R 
Sbjct: 169 PVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPRE 202

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 5/107 (4%)

Query: 302 GLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLP 361
           G+++ + +S+      +R  +  N+ + GG   I   + R+  EL +  P     R+ L 
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPA-LKFRM-LS 472

Query: 362 KG---DTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
            G   + + QGW      ++  ++ Q  V R EY E G +   K RF
Sbjct: 473 SGHLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 43/105 (40%), Gaps = 1/105 (0%)

Query: 302 GLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPT-DWSVRVHL 360
           GL + V  SI      +R  +  N+ + GG   I   + RL  EL  + P   + +    
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 361 PKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
            K + E Q W      ++  ++ Q  V R EY E G D     RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 41/222 (18%), Positives = 83/222 (37%), Gaps = 50/222 (22%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSN-------CHV- 56
           ++ID GSY    G S    P+  L      +YG +  +N+     +  +        H+ 
Sbjct: 17  VVIDPGSYSTNIGYSGTDCPHSILPS----RYGSFKKTNKDSGDEDTKSDESATKRAHIF 72

Query: 57  --------RRPFEL------GQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSET 102
                   R+ +E+      G +  W+  +  W++ L N       L+ +K +  +++E 
Sbjct: 73  SEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKN----ELFLESTKGIPALLTEP 128

Query: 103 CMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYND 162
             +  +  K   + + E   F +    P +  + F         G               
Sbjct: 129 VWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSF-------ATGRANC----------- 170

Query: 163 FQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLK 204
             LVVD G +   V PV+ G+   K+ ++    G+++  L++
Sbjct: 171 --LVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIE 210

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 47/117 (40%), Gaps = 6/117 (5%)

Query: 292 HPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCP 351
           +PE  N +  GL + +  SI      +R  +  N+ V GG  +I     R+  EL +  P
Sbjct: 383 NPESKNEIA-GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLP 441

Query: 352 T---DWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRF 405
                     HL   + + Q W      S+  ++ Q  V + EY E G     K RF
Sbjct: 442 ALKFRMLTSGHL--KERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 80/224 (35%), Gaps = 49/224 (21%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRY-------------HLSNQMKQ--IR 49
           ++ID GSY    G S    P   L      +YG+Y                 ++KQ    
Sbjct: 17  VVIDPGSYTTNIGYSGTDCPQVTLPS----RYGQYISEEEEKDEQEQQEDDRKLKQKVFS 72

Query: 50  EVS------NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETC 103
           E S      N  ++     G ++ W+  +  W + + +   F    + +K +   ++E  
Sbjct: 73  EQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHELHF----ESTKGMPAFLTEPI 128

Query: 104 MSIPEISKHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDF 163
            +  E  K   +V+ E  EF +    P    + F          + G P           
Sbjct: 129 WNTEENRKKSLEVLLENMEFEACFLSPTPTCVSF----------AMGRPTC--------- 169

Query: 164 QLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETV 207
            LVVD G +   V PV+ G+   K+     I G  L  LL + +
Sbjct: 170 -LVVDIGHDVCSVSPVVDGMTLSKSSTSNFIAGSLLNALLSKQL 212

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 61/146 (41%), Gaps = 16/146 (10%)

Query: 257 TSLIGYVRQPKQAIPED---SQTLNLEDELFTIPETFFHPEIANILKPGLI---ETVL-- 308
           ++L  ++R P+    ED      ++L  E   +PE  F P +    + G+I   ET+L  
Sbjct: 586 STLHLFLRGPRPHDSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCETILTK 645

Query: 309 ----ESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPKGD 364
               E   + P  +   M +N+ + GGN  +     R+  E     P   +  V      
Sbjct: 646 KFGSEQRKLSPTAL--AMANNLWITGGNSKLPGMKERIVKEFTGFLPVGTAFNVKQSYNP 703

Query: 365 TELQGWKAMMRFS-NTDSYKQGRVTR 389
           + L  W  M + + N++ YK   +++
Sbjct: 704 S-LDAWNGMAKLTLNSEDYKNTIISK 728

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 44/215 (20%), Positives = 93/215 (43%), Gaps = 28/215 (13%)

Query: 3   VPIIIDNGSYEIKFGPSSLKSPYRAL-NCLARDKYGRYH-----LSNQMKQIREVSNCHV 56
           +PI ID GS +I+ G ++  +P     N L R +  + +     + N +  + +      
Sbjct: 37  IPIAIDFGSSQIRAGYTNQSTPSHIFPNRLTRYRDRKINKTFTFIGNDV-SLDQAIRTQS 95

Query: 57  RRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQV 116
           + PF+   + +W+  E I  Y +FN         +     ++++E   ++     +  Q+
Sbjct: 96  KSPFDGSIITNWDYVEDIMQY-IFN--HLGVVGHNGVSNPILLTEKLATLQSQRSNWYQL 152

Query: 117 VFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWV 176
           +FE ++   +        +  D+M  +  YG +         + +   LV+D G   T V
Sbjct: 153 LFECFDIPEVT-------LGIDSM--FAFYGLN---------ERSSTGLVIDCGNEETDV 194

Query: 177 IPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRH 211
           IPV++G       K+++ GGR     L + ++ ++
Sbjct: 195 IPVVEGAGMLTDAKRINWGGRQAVDYLNDLLTLKY 229

>AFL222W Chr6 (20289..22487) [2199 bp, 732 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YOR112W
          Length = 732

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 44/102 (43%), Gaps = 11/102 (10%)

Query: 253 PDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPET----FFHPEIANILKPGLIETVL 308
           P  QT LI      K+   +DSQ     D+L  + E        P + +   PG ++  +
Sbjct: 248 PQLQTPLITIYSHLKELHIKDSQ-----DKLVALAEVQNIILQEPGVLDNSTPGFVDGFI 302

Query: 309 ESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQC 350
             I  L E IR  +V+N   I G    SN  S LAT LQ  C
Sbjct: 303 --IPQLSETIRNEIVTNQQQIAGMQVFSNIVSLLATALQLTC 342

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 80/203 (39%), Gaps = 35/203 (17%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDK-----YGRYHLSNQMKQIREVSNCHVRRP 59
           ++I NGS     G S+++ P   ++     K     +G + + ++ +   E   C V   
Sbjct: 7   VVIHNGSSSTVAGFSNMELPQSIISSSYVQKGNERVFGTFAMLDECESKEE---CEVYTI 63

Query: 60  FEL-GQLVSWELEEHIWDYCLFNSDEFSWDLK-DSKDVDLIVSETCMSIPEISKHMDQVV 117
            +  G   +WE  E  W Y       + ++LK D +++ L++S     +P     +D  V
Sbjct: 64  MDKNGMPYNWEALEAQWRYL------YEYELKVDPQELPLVIS-----VPATHSEIDPQV 112

Query: 118 FEEYEFGSLMKCPV-AQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWV 176
            E Y   +L K  V A  I  + +A     G                 LV+D G   T V
Sbjct: 113 VENYFDLALNKLQVPALQIVVEPLAVALAMGKSS-------------ALVIDVGARGTTV 159

Query: 177 IPVIKGVPYYKAVKKLDIGGRFL 199
            P++ G      V K   GG FL
Sbjct: 160 TPIVDGTVVRSGVMKSRFGGDFL 182

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 124/315 (39%), Gaps = 62/315 (19%)

Query: 61  ELGQLVSWELEEHIWDYCLFNSDEFSWDLK-DSKDVDLIVSETCMSIPE-ISKHMD--QV 116
           +LG   +WE  E  W+Y       F   LK D  ++ ++++     IP  ISK+ D    
Sbjct: 71  QLGVPYNWEALEKQWEYI------FEKQLKCDPTELPVLIT-----IPSSISKNEDIENK 119

Query: 117 VFEEYEFGSLMKCPVAQ---YIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNC 173
           V E+Y       C +A     IP+  + +  +  S GL    KK       LV+D   + 
Sbjct: 120 VIEQY-------CKIAFEKFKIPYLQIVNESLSISLGLG---KKTS-----LVIDISGSG 164

Query: 174 TWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPP 233
           + V P++ GV     + K   GG FL   + +  S    +L +E   ++NI     ++  
Sbjct: 165 SSVTPIVDGVIIKNGIVKSKYGGDFLDYQIIKKFSTIDEDLEEEMTNSSNI-----WVSS 219

Query: 234 VSYFDSFQKKAETRIDYVLPDF----------------QTSLIGYVRQP----KQAIPED 273
            S+  +F+K      D  L D                 Q S+      P    K+ +   
Sbjct: 220 NSWIKNFKKTMLQVTDKKLQDVEKYYEEQLRLQAELQNQGSITSVGTNPLSVKKEYLYRS 279

Query: 274 SQTLNLED-ELFTIPETFFHPEIAN---ILKPGLIETVLESISMLPELIRPLMVSNIAVI 329
            +T+  E  EL+   E  F P++A+       GL E +  SI+       P  V+    I
Sbjct: 280 RKTVTFESRELYQFGEYLFQPQLASEQYNRDDGLGELIYRSITSAAMGNMPAAVAASNNI 339

Query: 330 GGNFNISNFASRLAT 344
           GG+   +   S + T
Sbjct: 340 GGSSGATGGDSNVHT 354

>KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 aa]
           {ON} Anc_8.50 YLR054C
          Length = 730

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 14/95 (14%)

Query: 41  LSNQMKQIREVSNCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVS 100
           L N++  I+E+ N    +  +  QL    LE   W      SD     LK  + +     
Sbjct: 176 LQNELVAIQELQNISKSKLLKFNQL----LEVAEWIKIKLESDSSKMSLKIWESI----- 226

Query: 101 ETCMSIPEISKHMDQVVFEEYEFGSLMKCPVAQYI 135
                IP+IS ++  +++EE+++ +L+K P  + I
Sbjct: 227 -----IPKISLNILSIIYEEFDYETLLKTPSTEAI 256

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 46/215 (21%), Positives = 79/215 (36%), Gaps = 46/215 (21%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRAL-NCLARDKYGRYHLSNQMKQIREVSNCHVRRP-FEL 62
           ++ID GS+    G S    P   L +C    K       N  K+I    +  + RP +E+
Sbjct: 17  VVIDPGSFSTNIGFSGTDCPQAILPSCYGEQKAETE--DNAPKKIFAEQSIGIPRPDYEI 74

Query: 63  ------GQLVSWELEEHIWDYCLFNSDEFSWDLKD------SKDVDLIVSETCMSIPEIS 110
                   +V W+  E  W          SW LKD      +  +  +++E   +  E  
Sbjct: 75  KPIVQNSMVVDWDAAEEQW----------SWALKDILYLNSNSGIPALLTEPIWNTLENK 124

Query: 111 KHMDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSG 170
               +++ E  +F +         + F          + G P            LVVD G
Sbjct: 125 TKSLEILLESLQFEACYLSSTPTCVSF----------ASGRPNC----------LVVDLG 164

Query: 171 FNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKE 205
            + T V PV+ G+   K+  +  + G  +  L+K+
Sbjct: 165 HDTTSVSPVVDGMTLSKSTMRNFLAGNCINELIKK 199

>NCAS0H01080 Chr8 (203424..205208) [1785 bp, 594 aa] {ON} Anc_6.174
           YGL095C
          Length = 594

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 11/70 (15%)

Query: 27  ALNCLARD----KYGRYHLS-NQMKQIREVSNCHVRRPFELGQL-VSWELEEHIWDYCLF 80
           ++ CL ++    KYG YH+  N M     VS   + R  E   L V  ++EE   DY + 
Sbjct: 90  SIRCLVQELQNPKYGEYHIFFNNM-----VSKSQLERLAEADNLEVVVKIEEIFQDYQIL 144

Query: 81  NSDEFSWDLK 90
           + D FS+DL+
Sbjct: 145 DQDLFSFDLE 154

>ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 465

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 76/336 (22%), Positives = 130/336 (38%), Gaps = 58/336 (17%)

Query: 5   IIIDNGSYEIKFGPSSLKSPYRAL--NCLARDK------YGRYHLSNQMKQIREVSNCHV 56
           ++I NGS++   G S+ ++P   +  + + RD       +G + + ++ ++    SN + 
Sbjct: 9   VVIHNGSWQTVAGFSNRETPQCVIPSSYIQRDGQREAQIFGTFEMLDETQENDPNSNVYT 68

Query: 57  RRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMD-Q 115
                 G   +WE  E  W Y      +      D  ++ LI+S     +P  S  +D +
Sbjct: 69  IIDSR-GLPYNWEALESQWRYIYEKQLQI-----DPSELPLIIS-----VPASSSEVDMK 117

Query: 116 VVFEEYEFG-SLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCT 174
           +V + +E     ++ P  Q +                P+           LV+D G    
Sbjct: 118 IVHKYFELAFEKLRVPTLQIVVE--------------PLAIALSMSKSSALVIDIGAREC 163

Query: 175 WVIPVIKGVPYYKAVKKLDIGGRFL----TGLLK------ETVSFRHYNLMDETILANNI 224
            + PVI G      V K    G FL    T LLK      E+     YN         N 
Sbjct: 164 KITPVIDGTVVKSGVMKSKFAGDFLDFQVTELLKDRLPPAESSCQMWYNSQTWIQQFKNT 223

Query: 225 KEQCCFMPPVSYFDSFQKKAETRIDYVLP-DFQTSLIGYVRQPKQAIPEDS----QTLNL 279
             Q C    V      Q+  E + + + P  FQ      + QPK  + + +    QT+++
Sbjct: 224 MLQVCDRNLV----EVQRLHEEQSNQLQPVGFQQFTSNSLTQPKNFLLKTANGSKQTISV 279

Query: 280 E-DELFTIPETFFHPEIANILKP---GLIETVLESI 311
           E  +   +PE  F P+++N   P   GL E + +SI
Sbjct: 280 ELKDCLKLPEYLFQPQLSNKDFPSSDGLCELMSKSI 315

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 14/103 (13%)

Query: 303 LIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHLPK 362
           +I  VLESI  LP  ++  ++ N+ +IGG   I     RL   L R   T+        +
Sbjct: 205 IISLVLESIKQLPIDVKSKVLQNVIIIGGLSKIQGLKERLIENL-RYAHTN-------AR 256

Query: 363 GDTELQGWKAMMRFS----NTDSYKQGRVTRAEYLEHGV--DW 399
           G   L+ W+    ++      +   Q  V R E+   G+  DW
Sbjct: 257 GINILKVWQGGSIYTYHSLMHNDLDQMEVNREEFKSSGIVPDW 299

>SAKL0G12364g Chr7 (1052416..1053090) [675 bp, 224 aa] {ON} similar
           to uniprot|P39975 Saccharomyces cerevisiae YEL072W RMD6
           Protein required for sporulation
          Length = 224

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 49/125 (39%), Gaps = 29/125 (23%)

Query: 167 VDSGFNCTWVIPVIKGVPYYKAVKKLDIGG--RFLTG----LLKETVSFRHYNLMDETIL 220
           +D  FN   ++  I   PY   +K  +I G   F  G    LL  + ++    L+ E I+
Sbjct: 110 IDQNFNTASILGTIAFKPYLSTLKSFEITGFTSFERGVGKVLLSASTNYYQKELLAEQIV 169

Query: 221 ANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLE 280
           A  I                       +++ L ++ TS+ G++   +  I +  Q   LE
Sbjct: 170 AKVI-----------------------VEHELIEYYTSIHGFIEVERTLIKKGEQKSGLE 206

Query: 281 DELFT 285
           D + T
Sbjct: 207 DGIIT 211

>TBLA0B08460 Chr2 (2026227..2027915) [1689 bp, 562 aa] {ON} Anc_3.68
           YNL291C
          Length = 562

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 59/134 (44%), Gaps = 22/134 (16%)

Query: 174 TWVIPVIK-GVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMP 232
           T+ I V + G  Y+  V+ L     F++G + E++  R+YNL D T   N+   Q  +  
Sbjct: 49  TYNINVTQLGQDYFNTVEVL----LFISGTI-ESMPLRYYNLTDNTQFQNDTALQVTY-- 101

Query: 233 PVSYFDSFQKKAETRIDYVLPDFQ--------TSLIGYVRQPKQAIPEDSQTLNLEDELF 284
              YF        T+I Y    F+        TS I Y   P  A+ E+ +T N+  +  
Sbjct: 102 ---YFSPSDPSNSTKIGYNNITFENGYIMALGTSPITY--NPLFAL-EEQETTNITGQSL 155

Query: 285 TIPETFFHPEIANI 298
            +  T  H E++ I
Sbjct: 156 VLEYTTLHLEVSLI 169

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,016,401
Number of extensions: 2116580
Number of successful extensions: 5281
Number of sequences better than 10.0: 163
Number of HSP's gapped: 5112
Number of HSP's successfully gapped: 202
Length of query: 411
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 299
Effective length of database: 40,638,807
Effective search space: 12151003293
Effective search space used: 12151003293
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)