Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43118.259ON1376137669930.0
AGR089C8.259ON1370137642660.0
SAKL0H17094g8.259ON1422137038320.0
KAFR0B027108.259ON1416137635380.0
Kwal_56.238258.259ON1396136635160.0
KLTH0G13750g8.259ON1399137735080.0
TDEL0F038608.259ON1399136534810.0
NCAS0B050008.259ON1409136934590.0
Smik_12.1458.259ON1418139334570.0
ZYRO0C01716g8.259ON1413137634540.0
Suva_10.1708.259ON1416136734310.0
Skud_12.1548.259ON1417137234070.0
Kpol_392.88.259ON1427138333920.0
YLR086W (SMC4)8.259ON1418137533760.0
NDAI0B019708.259ON1415136833740.0
KLLA0F19085g8.259ON1372138033550.0
KNAG0G020208.259ON1444139532520.0
TBLA0E044108.259ON1422138031500.0
TPHA0J007208.259ON1393138930870.0
CAGL0L12188g8.259ON1398137528910.0
Suva_6.528.68ON126413316804e-72
NDAI0G033208.68ON123113406743e-71
Skud_6.648.68ON123013756611e-69
Smik_6.718.68ON122813246441e-67
KAFR0C032008.68ON122313686378e-67
Ecym_73038.68ON122213416305e-66
KLLA0D07502g8.68ON124313566083e-63
CAGL0F02079g8.68ON122313196021e-62
ZYRO0F03828g8.68ON121713285895e-61
KNAG0L011607.186ON117012994709e-47
YFL008W (SMC1)8.68ON12257644611e-45
TPHA0P003408.68ON12197604371e-42
TDEL0C009608.68ON12227753682e-34
KLTH0A02706g8.68ON12281703493e-32
TDEL0H026107.186ON11707993351e-30
Skud_6.1197.186ON11707853332e-30
AGR236W7.186ON11707633143e-28
AGL023W8.68ON12221823126e-28
ZYRO0D15642g7.186ON11709693118e-28
Kwal_23.50438.68ON12252192796e-24
Kpol_1011.58.68ON12211592591e-21
TBLA0G035308.68ON12321822553e-21
NDAI0G020707.186ON11711862527e-21
CAGL0D05258g7.186ON11701862527e-21
KAFR0G029307.186ON11707482501e-20
Suva_6.1047.186ON11701862492e-20
YFR031C (SMC2)7.186ON11701862492e-20
Smik_7.3467.186ON11701862492e-20
NCAS0E019207.186ON11701892492e-20
KNAG0G009108.68ON12261812492e-20
NCAS0C040008.68ON12232072473e-20
Kwal_55.204217.186ON11701842402e-19
TPHA0C044407.186ON11701972366e-19
Smik_10.1671.295ON12297462331e-18
Ecym_43907.186ON11701862322e-18
KLLA0D16005g7.186ON11701842312e-18
TBLA0D046107.186ON11741862294e-18
SAKL0B02288g8.68ON12281992276e-18
KLLA0A00286g1.295ON12247362071e-15
ZYRO0G21296g1.295ON12271182001e-14
KLTH0H09966g1.295ON12241862001e-14
KAFR0A016101.295ON1227991982e-14
Kwal_14.24351.295ON12471711982e-14
Kpol_1063.207.186ON1171731972e-14
SAKL0D06116g1.295ON1229731963e-14
TDEL0D016201.295ON12232171911e-13
KNAG0B052301.295ON1225981892e-13
NCAS0A093301.295ON12271061892e-13
TPHA0I010901.295ON12167321882e-13
NDAI0G056301.295ON12291011847e-13
Kpol_1018.21.295ON12111951848e-13
YJL074C (SMC3)1.295ON1230791802e-12
Ecym_63221.295ON12322151784e-12
Suva_6.1491.295ON1230791775e-12
TBLA0C027401.295ON11191521766e-12
CAGL0H02805g1.295ON1219961767e-12
Skud_10.1701.295ON1230791722e-11
AAL182W1.295ON1231791722e-11
KLTH0E04774g7.186ON1170801642e-10
SAKL0F07282g7.186ON1170801633e-10
KLTH0D02816g7.101ON10941701203e-05
KNAG0L006307.101ON11082131193e-05
SAKL0B09526g7.101ON10991841194e-05
TDEL0E013404.237ON1106851141e-04
Kwal_26.72047.101ON11171661122e-04
KLLA0F07997g7.101ON11191891122e-04
TBLA0E021907.101ON10891621086e-04
ZYRO0B12122g4.237ON1109791050.001
Kpol_1044.137.101ON11032871000.005
Ecym_26257.101ON1097242990.008
CAGL0H05071g4.237ON111076990.008
NCAS0J013904.237ON109679990.008
ZYRO0G01584g7.101ON1088161990.008
TPHA0B008404.237ON111968960.016
YLR383W (SMC6)4.237ON111468960.018
Skud_12.4684.237ON112068960.019
NDAI0J021804.237ON110868960.019
Suva_10.5004.237ON111568960.019
Smik_12.4704.237ON111468950.020
NCAS0I005707.101ON109562950.021
Skud_15.1217.101ON109383950.021
NDAI0A084507.101ON111962950.022
KNAG0B060104.237ON111768950.023
Suva_15.1337.101ON109262950.023
Smik_15.1317.101ON109362950.024
Ecym_53444.237ON110270940.027
CAGL0F01155g7.101ON1105144940.027
YOL034W (SMC5)7.101ON109362940.028
TPHA0L006007.101ON111762940.031
TDEL0H034907.101ON110385930.034
KAFR0D013307.101ON108062930.035
KLLA0E05303g4.237ON109892930.044
AEL337C7.101ON1097165920.054
Kwal_26.93804.237ON110285910.060
TBLA0I028904.237ON1098178910.075
NCAS0A024504.238ON1928140900.089
AER044W4.237ON110364890.11
Kpol_483.104.237ON111875880.13
TBLA0A053001.67ON70763870.16
KAFR0A060404.237ON110267870.18
SAKL0H03322g4.237ON111147870.22
SAKL0H03300g4.238ON1707100860.27
Smik_12.3934.46ON910255840.43
TDEL0G028102.351ON109471840.48
KLTH0D14080g4.237ON110258820.82
Smik_2.2733.399ON82879811.1
Smik_14.851.110ON1312177791.6
SAKL0G11110g5.267ON1871138791.8
NCAS0B087001.67ON71572763.6
NDAI0D029304.46ON960101763.7
Suva_15.3172.147ON95783764.0
Kwal_YGOB_55.211643.479ON657112754.2
Kwal_55.21164singletonOFF588112754.6
Ecym_5271na 1ON30664745.2
KAFR0B005907.488ON1261163745.9
AFR683C1.67ON677112746.7
TPHA0J003006.16ON982135747.0
SAKL0H08426g8.604ON81678738.6
ZYRO0F17050g1.67ON71456738.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4311
         (1376 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  2698   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1647   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1480   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1367   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1358   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1355   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1345   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1337   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1336   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1335   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1326   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1316   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1311   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1305   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1304   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1296   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1257   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1217   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1193   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1118   0.0  
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   266   4e-72
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             264   3e-71
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   259   1e-69
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   252   1e-67
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   249   8e-67
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   247   5e-66
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   238   3e-63
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   236   1e-62
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   231   5e-61
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...   185   9e-47
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   182   1e-45
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   172   1e-42
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   146   2e-34
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   139   3e-32
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....   133   1e-30
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...   132   2e-30
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   125   3e-28
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   124   6e-28
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   124   8e-28
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   112   6e-24
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   104   1e-21
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   102   3e-21
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....   101   7e-21
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...   101   7e-21
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   100   1e-20
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...   100   2e-20
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...   100   2e-20
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...   100   2e-20
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....   100   2e-20
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   100   2e-20
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   100   3e-20
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    97   2e-19
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    96   6e-19
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    94   1e-18
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    94   2e-18
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    94   2e-18
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    93   4e-18
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...    92   6e-18
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    84   1e-15
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    82   1e-14
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    82   1e-14
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    81   2e-14
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    81   2e-14
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    80   2e-14
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    80   3e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    78   1e-13
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    77   2e-13
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    77   2e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    77   2e-13
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    75   7e-13
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    75   8e-13
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    74   2e-12
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    73   4e-12
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    73   5e-12
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    72   6e-12
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    72   7e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    71   2e-11
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    71   2e-11
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    68   2e-10
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    67   3e-10
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    51   3e-05
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    50   3e-05
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    50   4e-05
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    49   1e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    48   2e-04
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    48   2e-04
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    46   6e-04
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    45   0.001
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    43   0.005
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    43   0.008
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    43   0.008
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    43   0.008
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    43   0.008
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.016
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.018
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.019
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    42   0.019
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.019
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    41   0.020
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    41   0.021
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    41   0.021
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    41   0.022
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.023
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    41   0.023
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.024
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    41   0.027
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    41   0.027
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    41   0.028
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    41   0.031
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    40   0.034
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    40   0.035
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.044
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    40   0.054
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    40   0.060
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    40   0.075
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    39   0.089
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    39   0.11 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    39   0.13 
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    38   0.16 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    38   0.18 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.22 
SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} simil...    38   0.27 
Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {...    37   0.43 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    37   0.48 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    36   0.82 
Smik_2.273 Chr2 complement(486425..488911) [2487 bp, 828 aa] {ON...    36   1.1  
Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250...    35   1.6  
SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] ...    35   1.8  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    34   3.6  
NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {O...    34   3.7  
Suva_15.317 Chr15 (551916..554789) [2874 bp, 957 aa] {ON} YHR120...    34   4.0  
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    33   4.2  
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    33   4.6  
Ecym_5271 Chr5 complement(556773..557693) [921 bp, 306 aa] {ON} ...    33   5.2  
KAFR0B00590 Chr2 complement(117951..121736) [3786 bp, 1261 aa] {...    33   5.9  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    33   6.7  
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...    33   7.0  
SAKL0H08426g Chr8 complement(726923..729373) [2451 bp, 816 aa] {...    33   8.6  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   8.6  

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 2698 bits (6993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1329/1376 (96%), Positives = 1329/1376 (96%)

Query: 1    MADLRTSKKPKHLDTPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSV 60
            MADLRTSKKPKHLDTPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSV
Sbjct: 1    MADLRTSKKPKHLDTPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSV 60

Query: 61   YXXXXXXXXXXXXXXXIELIQLSPIKNSRLELQKIYDGKQTTTKRLSIKNLILNNFKSYA 120
            Y               IELIQLSPIKNSRLELQKIYDGKQTTTKRLSIKNLILNNFKSYA
Sbjct: 61   YSQSPPRSPNRSPARRIELIQLSPIKNSRLELQKIYDGKQTTTKRLSIKNLILNNFKSYA 120

Query: 121  GVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLS 180
            GVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLS
Sbjct: 121  GVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLS 180

Query: 181  FCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRN 240
            FCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRN
Sbjct: 181  FCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRN 240

Query: 241  EGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMD 300
            EGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMD
Sbjct: 241  EGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMD 300

Query: 301  TLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLA 360
            TLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIA              WDINKETKKLA
Sbjct: 301  TLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLA 360

Query: 361  VTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQR 420
            VTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQR
Sbjct: 361  VTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQR 420

Query: 421  ELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXX 480
            ELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEF             
Sbjct: 421  ELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHS 480

Query: 481  XXXXXDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLK 540
                 DAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLK
Sbjct: 481  ERSELDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLK 540

Query: 541  LEQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQV 600
            LEQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQV
Sbjct: 541  LEQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQV 600

Query: 601  LTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISV 660
            LTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISV
Sbjct: 601  LTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISV 660

Query: 661  ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLT 720
            ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLT
Sbjct: 661  ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLT 720

Query: 721  TPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRV 780
            TPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRV
Sbjct: 721  TPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRV 780

Query: 781  VKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDV 840
            VKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDV
Sbjct: 781  VKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDV 840

Query: 841  EISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDE 900
            EISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDE
Sbjct: 841  EISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDE 900

Query: 901  SKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNR 960
            SKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNR
Sbjct: 901  SKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNR 960

Query: 961  ASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKN 1020
            ASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKN
Sbjct: 961  ASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKN 1020

Query: 1021 LDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDE 1080
            LDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDE
Sbjct: 1021 LDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDE 1080

Query: 1081 HNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDAS 1140
            HNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDAS
Sbjct: 1081 HNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDAS 1140

Query: 1141 YIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDL 1200
            YIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDL
Sbjct: 1141 YIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDL 1200

Query: 1201 NESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPF 1260
            NESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPF
Sbjct: 1201 NESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPF 1260

Query: 1261 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1320
            SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV
Sbjct: 1261 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1320

Query: 1321 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILNIK 1376
            SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILNIK
Sbjct: 1321 SIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILNIK 1376

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1647 bits (4266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 844/1376 (61%), Positives = 1038/1376 (75%), Gaps = 11/1376 (0%)

Query: 3    DLRTSKKPKHLDTPSKLMFGSPGRKHVASQASSNSTT-ALRGPSLQPPTYSQLSRGRSVY 61
            D+ T KKP+ LDTP KL+  SP RK+V S+ SS STT  LRGPSLQPP   Q+SRGRS Y
Sbjct: 2    DIPTPKKPRILDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISRGRSQY 61

Query: 62   XXXXXXXXXXXXXXXIELIQLSPIKNSRLELQKIYDGKQTTTKRLSIKNLILNNFKSYAG 121
                           +ELIQLSPIKNSRLELQ++YD KQ   +RL I+ L+L NFKSYAG
Sbjct: 62   SQSPPRSPNRSPGRAVELIQLSPIKNSRLELQRLYDTKQKKVERLCIRTLVLENFKSYAG 121

Query: 122  VQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSF 181
             QVVGPFHSSFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQGKLS+LIHKSE + +L F
Sbjct: 122  RQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDF 181

Query: 182  CSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNE 241
            CSVEI FQYV+D+ DG T+VL    ELSVMRK FKNNTSKYY+NGKES+YTEVT+ LR+E
Sbjct: 182  CSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDE 241

Query: 242  GIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDT 301
            GIDLDHKRFLILQGEVESIAQMKPKA+HEGDDGLLEYLEDIIGT KYK+QI  ALVE+D+
Sbjct: 242  GIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDS 301

Query: 302  LNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAV 361
            LNDICMEKE RF+LVEKEK SLE GK++AL F+               + +     KLA 
Sbjct: 302  LNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAK 361

Query: 362  TLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRE 421
            TL  +S    KLE E+ K  E QKEI +L + S+ L  ++  +N    + +    QL+RE
Sbjct: 362  TLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQLERE 421

Query: 422  LVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXX 481
            LVS+EEK KSL QKR+KAEKTL   EK+I+ CEN I        E+              
Sbjct: 422  LVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDA 481

Query: 482  XXXXDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKL 541
                + +K++L DKT  I++EVA LEKELEPWT K+E K S+IKL ESEI IIKE+ LKL
Sbjct: 482  QAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKL 541

Query: 542  EQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVL 601
            E EI+ L ++IE  +  I + ++ I  L  ES++I  +I   + EC SA+ KL +MK+VL
Sbjct: 542  ESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVL 601

Query: 602  TNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVA 661
              HRQR+ DAR A+S+ ENKNKVL AL RLQKSGRI G+HGRLGDLGTIDDKYDIAIS A
Sbjct: 602  VTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTA 661

Query: 662  CPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTT 721
            CPRLDDIVV+TVEC QQCIEHLRKNKLGYARFILLDKL+KFN+    TPENVPRLFDL  
Sbjct: 662  CPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVK 721

Query: 722  PKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVV 781
            PK   FAPA YSVLRDTLV  DL+QANRVAYG +R+RVVTLDGKLIDISGTM+GGGDR  
Sbjct: 722  PKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAA 781

Query: 782  KGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVE 841
             GLMKS Q+S+ +YT EEVQRME EL +RE NFK+A +TFQEME+ALQ Y DRQP I+VE
Sbjct: 782  SGLMKSTQQSS-LYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVE 840

Query: 842  ISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDES 901
            +SK K+DI+T+S+EL+SK +  +ELE + + +  D+  L   E +L ALN++L +    S
Sbjct: 841  LSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSAS 900

Query: 902  KVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRA 961
            + KN++I ELRA+IM+IGGL+LQ+ NSKVDSL QQ++I+ AKQKK++T  KK ELE+ RA
Sbjct: 901  ESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRA 960

Query: 962  SKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNL 1021
             KQ++ A++DI HC+IE+ K  +S++ +  G++E +  +  ++++   L  EH   K  L
Sbjct: 961  RKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHEL 1020

Query: 1022 DDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEH 1081
            D K   ++ + S EIE+   L+KL+NL +++K E++  D +L+ LKLRD+ Q++  L+E 
Sbjct: 1021 DQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEE- 1079

Query: 1082 NLPLESLTDRAVTPSN--QCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDA 1139
            N  L+S +  + TP    + I    +E H A  +  E K IS   N+     SM+VD+ A
Sbjct: 1080 NKSLQSFS-HSPTPDTKRENIQSSMLETHLASPSPNERK-ISIAENNL----SMEVDEQA 1133

Query: 1140 SYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLD 1199
            S +  GLPKL ++EL  +D+E+L  +I QL++Y+D +  DI+IL+EYA RLAEY+RR++D
Sbjct: 1134 SVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRID 1193

Query: 1200 LNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDP 1259
            LNE++ KR+E R   E+LKK RL+EFM+GFGIIS+T+KE+YQMITMGGNAELELVDSLDP
Sbjct: 1194 LNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDP 1253

Query: 1260 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1319
            FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN
Sbjct: 1254 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1313

Query: 1320 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILNI 1375
            VSIVANYIKERTKNAQFIVISLRNNMFELAQ+L+GIYK+SNMT+STTLQN DI+N+
Sbjct: 1314 VSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINV 1369

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1480 bits (3832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 782/1370 (57%), Positives = 991/1370 (72%), Gaps = 13/1370 (0%)

Query: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYXXXX----XXXXX 70
            TP KL+ GSP +K+  SQ S++S+ ++  P+LQPP     SRGR  Y             
Sbjct: 54   TPRKLVLGSPEKKYAYSQPSTSSSLSV--PNLQPPNVDG-SRGRRFYSQSPPRSPHRSPN 110

Query: 71   XXXXXXIELIQLSPIKNSRLELQKIYDGKQ----TTTKRLSIKNLILNNFKSYAGVQVVG 126
                  +ELIQLSP+KN+R ELQKIYD K         RL I  L L+NFKSYAG Q++G
Sbjct: 111  RSPTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIG 170

Query: 127  PFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEI 186
            PFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS+LIHKSE + NL  CSV+I
Sbjct: 171  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDI 230

Query: 187  TFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLD 246
             F+YV+D++DG T+   +   + + RK F+NN+SKYYI+GKES+YTEVTQ LR++GIDLD
Sbjct: 231  HFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLD 290

Query: 247  HKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDIC 306
            HKRFLILQGEVESI+QMKPKA+ E DDGLLEYLEDIIGTAKYK+ I   LVE+DTLND+C
Sbjct: 291  HKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVC 350

Query: 307  MEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKI 366
            +EKE RFELVEKEK SLE+GK++ALEF+               + I ++ +KL+ TL KI
Sbjct: 351  VEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKI 410

Query: 367  SAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSE 426
            S   E L  E+ KY + Q+E+  LRE  ++ ++Q+ K++ E   L   +  + RE  S E
Sbjct: 411  SELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSME 470

Query: 427  EKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXD 486
            EK ++L++KR KAEK L+  E ++   ++ +  LN +Q ++                  D
Sbjct: 471  EKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLD 530

Query: 487  AIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEIS 546
             IK+SLRDKTS IS E+A+ E++LEPW  +L+ K SQ+KL ES+I I+KESK K  Q I 
Sbjct: 531  EIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNII 590

Query: 547  QLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQ 606
            QL+ +IE++ ++    +  I+KL+ E A I   I   + EC SA  KL +MK VL +HRQ
Sbjct: 591  QLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQ 650

Query: 607  RMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLD 666
            R  +AR  LSNVENKNKVL AL RLQ+SGRI GFHGRLGDLGTIDD YD+AIS ACPRLD
Sbjct: 651  RAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLD 710

Query: 667  DIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEI 726
            DIVV+ VEC QQCIEHLRKNKLGYARFI+LDKL+KFN++ + TPE VPRLFDL   KN  
Sbjct: 711  DIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGK 770

Query: 727  FAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMK 786
            F PA YSVLRDTLV  DL QANRVAYG RRFRVVTLDGKLID SGT+SGGG  V+KGLMK
Sbjct: 771  FLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMK 830

Query: 787  SKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHK 846
            SKQ+    YT EEVQ +E EL +RE NF IA +TF +ME AL+K+KDR+P I+VEI+K +
Sbjct: 831  SKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRR 890

Query: 847  IDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNE 906
            +DI++ S+EL+ K++ L ELE+  +    ++  L D E++L  L+ E   +++E+K K +
Sbjct: 891  LDIESSSTELKLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQ 950

Query: 907  QISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKL 966
             I+ L+ +IMKIGG KLQ QNSKV+S+ +Q+ II +KQKK+RT  KK E ++ R   Q  
Sbjct: 951  LINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLENQCR 1010

Query: 967  GAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAA 1026
             A NDI  C +E+SK +  +  L+  + + +  +   E  KE++ +E E  K NL++K  
Sbjct: 1011 EASNDIESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKTNLEEKTN 1070

Query: 1027 YVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLE 1086
                FKS EIE+   LEKL  L  HIK EI    +ELN+LK+RD+ Q LQ L+E  LP E
Sbjct: 1071 NTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPEE 1130

Query: 1087 SLTDRAVTPS--NQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGP 1144
            +  D  V      +   EM+ + +  D+++ +A    +   +  + +SMD+D+  +    
Sbjct: 1131 NEDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDIDEYENETSN 1190

Query: 1145 GLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESV 1204
            GLPK +EA+L +I IE++ L+I +L  Y+D A+ DID+LEEYA RLAEYK+RKLDLN++V
Sbjct: 1191 GLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAV 1250

Query: 1205 EKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGV 1264
             KR+E+R   E LKK RL++FM+GF IISMT+KE+YQMITMGGNAELELVDSLDPFSEGV
Sbjct: 1251 LKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1310

Query: 1265 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1324
            LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1311 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVA 1370

Query: 1325 NYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374
            NYIKERTKNAQFIVISLRNNMFELAQQL+GIYK++NMT+STTLQNIDILN
Sbjct: 1371 NYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1367 bits (3538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 737/1376 (53%), Positives = 966/1376 (70%), Gaps = 21/1376 (1%)

Query: 15   TPSKLMFGSPGRKHVASQA----SSNSTTALRGPSLQPPTYSQLSRGRS--VYXXXXXXX 68
            TP KL+ GS   K+V SQ     SS+ +++L+ P+LQPP  SQ SRGR    Y       
Sbjct: 45   TPRKLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQPP-LSQPSRGRDKKAYSQSPPRS 103

Query: 69   XXXXXXXXIELIQLSPIKNSRLELQKIYDGKQTTTKRLSIKNLILNNFKSYAGVQVVGPF 128
                    +ELIQLSPIKN+R+ELQK+Y+ K     RL I  L+L +FKSYAG Q+VGPF
Sbjct: 104  PGRSPVRKLELIQLSPIKNNRIELQKLYNSKNQNKVRLYIDKLVLQDFKSYAGTQIVGPF 163

Query: 129  HSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITF 188
            ++SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L +LIHKSE   N+  CSVE+ F
Sbjct: 164  NTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHF 223

Query: 189  QYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHK 248
            QYV+D+ DG +K++ D + L VMRK FKNN+SKYYINGKES+YTEVT+ L+ EGIDLDHK
Sbjct: 224  QYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHK 283

Query: 249  RFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICME 308
            RFLILQGEVE+IAQMK KA+ EGDDGLLEYLEDIIGT+KYK+ I D +VE++ LN+IC+E
Sbjct: 284  RFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVE 343

Query: 309  KEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISA 368
            KE RFE+VE EK SLE+ K+ ALEFIA              + + +   KLA TLDKIS 
Sbjct: 344  KEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISN 403

Query: 369  FTEKLENERNKYGELQKEI-TDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEE 427
            F   L+ ER+KY ++Q EI    REL +   E+I    A++ +LV+ K +   + VS EE
Sbjct: 404  FKNALQEERSKYEKIQSEIDQSTRELRE-ANEKINASVAQERELVQKKREYDGQCVSMEE 462

Query: 428  KLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDA 487
            ++K+L QK+TKAEKTL      I+  E+ ++ L + Q  +                  D 
Sbjct: 463  RIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDD 522

Query: 488  IKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQ 547
            IK+SL+DKT  IS +++  EK++EPW +K++ K  QI+LAESEI ++KES+ KL++ +  
Sbjct: 523  IKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGS 582

Query: 548  LRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQR 607
            L+ +I+  +  I+N    I  L+KE  ++   +S  + EC  AK+K  +M+ +L +HRQR
Sbjct: 583  LKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQR 642

Query: 608  MTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDD 667
              DAR AL   ENK+ VL AL RLQKSGRI+GFHGRLGDLG I DKYDIAIS AC RLDD
Sbjct: 643  AIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDD 702

Query: 668  IVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIF 727
            IVV++VEC QQCIE+LRKNKLGYARFILLDKL+ F + ++ TPENV RLFDL  P +  F
Sbjct: 703  IVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKF 762

Query: 728  APALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKS 787
            + A YSVLRDTLVA D+ QANRVAYG RR+RVVTLDGKLIDISGTM+GGG  V KGLMK 
Sbjct: 763  SNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKL 822

Query: 788  KQRSN----DMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEIS 843
            K  SN    ++Y + +V+++E +L +RE NFKIA DT QEM   L++ +D++P I++EI+
Sbjct: 823  KN-SNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIA 881

Query: 844  KHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKV 903
            K  +D+D+L+ +L  K+  L ELE    +      PL+  E  L  L +E  AL+D+S+ 
Sbjct: 882  KLLMDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQS 941

Query: 904  KNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASK 963
            K E+I+ L+ +IMKIGG +LQ QNSKV SLT+++ I+ AK KK++  +K+ E E+ +  +
Sbjct: 942  KKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQR 1001

Query: 964  QKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDD 1023
                AE D   C  +L     +  A++  L+ETE   ++I ++K+ L  + E+ K+ + D
Sbjct: 1002 LFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKD 1061

Query: 1024 KAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNL 1083
                + ++KS EIE+   LEKL +L  + K +I   ++EL +  +RDV Q L+K+   N 
Sbjct: 1062 MEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENA 1121

Query: 1084 -----PLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQD 1138
                   +S  +  V+ S+   P +   D +  M D +    +E      D + MD+D  
Sbjct: 1122 NNSVGVKQSSNNLDVSSSH--TPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNV 1179

Query: 1139 ASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKL 1198
               +  G+PKLT+ +L +ID++ L  EI QL++Y++ + ADI++LEEY  RL E+K+RKL
Sbjct: 1180 TEEVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKL 1239

Query: 1199 DLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLD 1258
            DLN +V +R+E+R+  E LKK+R +EFM+GF IIS+T+KE+YQMITMGGNAELELVDSLD
Sbjct: 1240 DLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLD 1299

Query: 1259 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1318
            PFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1300 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1359

Query: 1319 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374
            NVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK SNMT+S TL+N DILN
Sbjct: 1360 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1358 bits (3516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/1366 (53%), Positives = 941/1366 (68%), Gaps = 13/1366 (0%)

Query: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQP-PTYSQLSRGRSVYXXXXXXXXXXXX 73
            TP KL+ GSP ++   SQ  S+S++ +  P LQP       SRGR VY            
Sbjct: 36   TPRKLVLGSPDKRFAFSQPVSSSSSNV--PHLQPLKNELSSSRGR-VYSQSPPRSPNRSP 92

Query: 74   XXXIELIQLSPIKNSRLELQKIYDGKQT--TTKRLSIKNLILNNFKSYAGVQVVGPFHSS 131
               +ELIQLSP+K SRLE QK  + +    + +RL I  L+L+NFKSYAG QVVGPFH+S
Sbjct: 93   TRKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNS 152

Query: 132  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYV 191
            FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKLS LIHKSE H +L  C V+I FQYV
Sbjct: 153  FSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYV 212

Query: 192  MDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFL 251
             D+ DG T ++     + + RK F+NNTSKYY+NGKESSYT +TQ LR+EGIDLDHKRFL
Sbjct: 213  QDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFL 272

Query: 252  ILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEI 311
            ILQGEVESIAQMKPKA+ E DDGLLEYLEDIIGTA+YK  I + L E+  LNDIC EKE 
Sbjct: 273  ILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKEN 332

Query: 312  RFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAFTE 371
            RFE+VE+EK SLE GK +ALE++               + + K  +KL  T +KI+   E
Sbjct: 333  RFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQE 392

Query: 372  KLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKS 431
            KL  E+ K  +  +E+  ++    +L+  +  +   + +L  +K    R+ VS EEKLK+
Sbjct: 393  KLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKN 452

Query: 432  LNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMS 491
            L QK  K+ ++LQ    +I   +  +  L   Q +                   D IK S
Sbjct: 453  LTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKLDEIKSS 512

Query: 492  LRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKD 551
            L+DK S ISE++  +EKELEPW  KL+ K +Q+KL E+ I + KES  K+EQ+I  + K 
Sbjct: 513  LKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKG 572

Query: 552  IESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDA 611
            I+  ++++   +  +  LEKE   I   ++  Q ECD+A KK+ +MK +LT HRQR  DA
Sbjct: 573  IDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDA 632

Query: 612  RVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVVE 671
            R +LS  ENKNKVL AL RLQ+SGRI GFHGRLGDLGTIDDKYD+AIS ACPRLDDIVVE
Sbjct: 633  RSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVE 692

Query: 672  TVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPAL 731
            TVEC QQCIE+LRKNKLGYARFILLDKL+ FN++ + TPENVPRL+DL  P N  F  A 
Sbjct: 693  TVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAF 752

Query: 732  YSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQRS 791
            YSVLRDTLVAKDL +AN+VAYG +R+RVVTLDGKLID+SGTMSGGG+   +G+MKS+Q+S
Sbjct: 753  YSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQS 812

Query: 792  NDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDT 851
            N  +T+EEVQ+++ EL++RE NF+IA DT  EME ALQK KDR+P I+++ISK K+DID+
Sbjct: 813  NSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDS 872

Query: 852  LSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISEL 911
            LSSE+++ +  L  L       +  N  L   E +L +L SE   L++E + K +++  L
Sbjct: 873  LSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKVL 932

Query: 912  RAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAEND 971
            + QIMK+GG KLQ Q+S VDS+ Q++ I++AK KK +T+LKK + ++ R  KQ      +
Sbjct: 933  QEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRYQKQAEQLAEE 992

Query: 972  INHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVEKF 1031
            +  C  E S   N+ ++  + + E    I  ++D+ E   +    A++++D+K      F
Sbjct: 993  LKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAEESIDEKTVEGRDF 1052

Query: 1032 KSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLESLTDR 1091
            ++ EI+    L+KLK L   +  E +     LN+LK+RDV   LQ LDE +L  ES  + 
Sbjct: 1053 EALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDE-SLENESKNEV 1111

Query: 1092 AVTPSNQCIPEMTVEDH---DADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPGLPK 1148
            A     +   E +   H   D D N GE+   +E      + E  + ++    +  GLPK
Sbjct: 1112 AAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEAQLQAGEAERRNTEES---LPNGLPK 1168

Query: 1149 LTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKRE 1208
            L E EL+N ++E + LEI QL++Y++ AYADI+ILEEYA RL EYK RK+DLN +V++R+
Sbjct: 1169 LLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQERD 1228

Query: 1209 EIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSV 1268
            ++R   E LKK RL+EFM+GF  I M +KE+YQMITMGGNAELELVDSLDPFSEGVLFSV
Sbjct: 1229 KVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFSV 1288

Query: 1269 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1328
            MPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1289 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1348

Query: 1329 ERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374
            ERTKNAQFIVISLRNNMFELA+QL+G+YK+ NMTKS  LQN D+++
Sbjct: 1349 ERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLID 1394

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1355 bits (3508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 743/1377 (53%), Positives = 943/1377 (68%), Gaps = 32/1377 (2%)

Query: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLS--RGRSVYXXXXXXXXXXX 72
            TP KL+ GSP ++   SQ  ++S++ +  P LQP   S+LS  RGR VY           
Sbjct: 36   TPRKLVLGSPDKRFAFSQPVTSSSSNV--PYLQP-LKSELSSSRGR-VYSQSPPRSPTRS 91

Query: 73   XXXXIELIQLSPIKNSRLELQKI--YDGKQTTTKRLSIKNLILNNFKSYAGVQVVGPFHS 130
                +ELIQLSP K +RLE QK     G     +RL I  L L+NFKSYAG QVVGPFHS
Sbjct: 92   PTRKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHS 151

Query: 131  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQY 190
            SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKLS+LIHKSE H NL  C VE+ FQY
Sbjct: 152  SFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQY 211

Query: 191  VMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRF 250
            V D+ DG T V  D   L V RK FKNNTSKYY+NGKESSYT+VT+ LR EGIDLDHKRF
Sbjct: 212  VQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRF 271

Query: 251  LILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKE 310
            LILQGEVESIAQMKPKA+ EGDDGLLEYLEDIIGTAKYK  I   LV++D LND+C EKE
Sbjct: 272  LILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKE 331

Query: 311  IRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAFT 370
             R+E+VE+EK SLE+GK++ALEF+                 + K + K   T +KI    
Sbjct: 332  NRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNTQEKIKTLE 391

Query: 371  EKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLK 430
            EKL  ER KY E ++EI  L   S +L   I  I   +S L  +K    R+ VS EEKLK
Sbjct: 392  EKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLK 451

Query: 431  SLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKM 490
            +++QK+ KAEKT      +I   +  +  L + Q ++                  D IK+
Sbjct: 452  NISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKI 511

Query: 491  SLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRK 550
            SL+ KT +IS ++  +E+ELEPW  KL+ K SQIKL E++I ++KES  K+ +EIS+   
Sbjct: 512  SLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSEN 571

Query: 551  DIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTD 610
            DI + + ++    + I  LEKE   I   I   Q ECD+A  K+ +MK VLT HRQR  D
Sbjct: 572  DISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLD 631

Query: 611  ARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVV 670
            A+ +LS  ENKNKVL AL RLQ+SGRI GFHGRLGDLGTIDDKYD+AIS ACPRLDD+VV
Sbjct: 632  AKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVV 691

Query: 671  ETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPA 730
            ETVEC QQCIEHLRKNKLGYARFILLDKL+ FNM  + TP NV RLFDL  P +  F  A
Sbjct: 692  ETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNA 751

Query: 731  LYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQ- 789
             YSVLRDTLVAKDL +ANRVAYG +RFRVVTLDGKLID+SGTMSGGG+    G+MKS++ 
Sbjct: 752  FYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERL 811

Query: 790  RSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDI 849
             +   +T+EEV++++ ELT+RE NFKIATDT  EME ALQ  KDR+P I+ +ISK +++I
Sbjct: 812  NTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEI 871

Query: 850  DTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQIS 909
            D+L SE++  +D    L+   + N+  +  L +  ++L +L +E   L+ E K K  +I 
Sbjct: 872  DSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIK 931

Query: 910  ELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAE 969
            EL+ QIMKIGG KLQ Q S VDS+ Q++ I + KQK+++T +KK E ++ R  KQ     
Sbjct: 932  ELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLS 991

Query: 970  NDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVE 1029
             DI+ C  EL        +    + E E  I+ ++ + E++ ++    ++ +++K++  +
Sbjct: 992  VDIDQCTNELESIKELISSSDNKILELEASIDKLQKEGEEIEEKVREIERLIEEKSSEGQ 1051

Query: 1030 KFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDE--------- 1080
             F   E+++   LEKL +L +HI  +     ++L +LK+RDV   LQ L++         
Sbjct: 1052 DFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSESRSG 1111

Query: 1081 HNLPLESLTDRAVTPSNQCIPEM-TVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDA 1139
              L  +S   R+  PSN  + E+ TVE             +  +P +   ++ MDVD+  
Sbjct: 1112 DELHGQSSEARSQEPSNGDLMEVDTVEG-----------CMGNEPTASQPEDQMDVDEPE 1160

Query: 1140 SY-IGPG-LPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRK 1197
                 P  LPKLTEA+L  +++EE+ LEI QL ++++ AYADI++LEEY  RL +++ RK
Sbjct: 1161 EMETSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAYADIEVLEEYTKRLVDFQARK 1220

Query: 1198 LDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSL 1257
            L+LN++VE+R+ +R   + L+K RL+EFM+GF  ISMT+KE+YQMITMGGNAELELVDSL
Sbjct: 1221 LELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSL 1280

Query: 1258 DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1317
            DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1281 DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1340

Query: 1318 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374
            RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK+ NMTKS  L+N D++N
Sbjct: 1341 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1345 bits (3481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 714/1365 (52%), Positives = 951/1365 (69%), Gaps = 14/1365 (1%)

Query: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYXXXXXXXXXXXXX 74
            TP KL+ G+       SQ    S+++L+ PSLQ P  S   R +  Y             
Sbjct: 42   TPKKLVIGTNDDTTSQSQPIV-SSSSLQAPSLQHPNSSSRGREQRTYSQSPPRSPGRSPT 100

Query: 75   XXIELIQLSPIKNSRLELQKIYDGKQT--TTKRLSIKNLILNNFKSYAGVQVVGPFHSSF 132
              +ELI++SP+K +RLELQ++YD +Q+     RL I  L+L +FKSYAG QVVGPFHSSF
Sbjct: 101  RKLELIKISPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSF 160

Query: 133  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYVM 192
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIH SE H NL  CSVE+ FQYV+
Sbjct: 161  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVV 220

Query: 193  DDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLI 252
            D+ DG T++  +   L V RK FKNN+SKYY+N KES+YTEVTQ L+ EGIDLDHKRFLI
Sbjct: 221  DEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLI 280

Query: 253  LQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEIR 312
            LQGEVE+IAQM+PKA+ EG+DGLLEYLEDI GTAKYK QI   L E++ LN+ C+EKE R
Sbjct: 281  LQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENR 340

Query: 313  FELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAFTEK 372
            F +V++EK SLE GK++ALEF+               + I +   KL  TLDK S    +
Sbjct: 341  FHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQ 400

Query: 373  LENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSL 432
            L+ E  KY E  KE+  L++ S  + ++I  +  E+  L+  K  L ++ V+ EEK+KS+
Sbjct: 401  LDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSV 460

Query: 433  NQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSL 492
            NQK  KAEK L+  + ++   E N+R L ++Q ++                  + +K+SL
Sbjct: 461  NQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISL 520

Query: 493  RDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDI 552
            ++KT +IS  +A  EK+LEPW  +L+ K ++I+LAESE+ ++K++  ++ ++I QL+ +I
Sbjct: 521  KEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEI 580

Query: 553  ESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDAR 612
                +     +K I +L++E + +T+ + TA  EC SA  +L  M ++L   RQR  DAR
Sbjct: 581  ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDAR 640

Query: 613  VALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVVET 672
             A S+ +NK+ VL AL +LQKSGRI GFHGRLGDLG ID+KYD+AIS ACPRL+DIVVE+
Sbjct: 641  AAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVES 700

Query: 673  VECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPALY 732
            VEC QQCIE+LRKNKLGYARFILLDKL+KF+  K+ TPENVPRLFDL  PK++ F PA Y
Sbjct: 701  VECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFY 760

Query: 733  SVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQR-- 790
            SVLRDTL A+ LAQANRVAYG +RFRVV+LDGKLIDISGTMSGGG  VV+GLM+  Q   
Sbjct: 761  SVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNS 820

Query: 791  -SNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDI 849
             S D+++ EEV ++E ELT++E +F+IA+DTF+EME  L+K KDR P I +++SK  ++ 
Sbjct: 821  YSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMET 880

Query: 850  DTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQIS 909
            ++  SEL+ K+  L+E     +     N   +  E ++  L  E  AL D++    ++I+
Sbjct: 881  ESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIA 940

Query: 910  ELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAE 969
             L+ +IM+IGG +LQ QNSKV S  Q+++I+ +KQKK +  +KK E E+ +++K     +
Sbjct: 941  VLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQ 1000

Query: 970  NDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVE 1029
             D++    E++    + + +Q+ L   E  ++  +D   ++N++ +  K+ L    A   
Sbjct: 1001 KDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFT 1060

Query: 1030 KFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLESLT 1089
            +FKS +IE+   LEKL  L  HI  E+ + + +LN LK+RDV + LQ LDE     ES T
Sbjct: 1061 EFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEG----ES-T 1115

Query: 1090 DRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPGLPKL 1149
            + +  P+   + E   E  DA   +GE   +S +    ND E M+VD+    +  GLP++
Sbjct: 1116 NNSKMPNE--LQEKRTEGADATRQEGEESDVSMEEEKSND-EVMEVDEKPHELENGLPRV 1172

Query: 1150 TEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKREE 1209
            +EAEL ++D+E+L  +I  L+ Y+D+   D++ILEEYA RLAE+KRRK+DLNE+V +R+ 
Sbjct: 1173 SEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDA 1232

Query: 1210 IRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSVM 1269
            +R +   LKK R +EFM GFGIISMT+KE+YQMITMGGNAELELVDSLDPFSEGV FSVM
Sbjct: 1233 MREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM 1292

Query: 1270 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1329
            PPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE
Sbjct: 1293 PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1352

Query: 1330 RTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374
            RTKNAQFIVISLRNNMFELAQQL+GIYK+ NMTKS +L+N DILN
Sbjct: 1353 RTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILN 1397

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1337 bits (3459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 721/1369 (52%), Positives = 951/1369 (69%), Gaps = 29/1369 (2%)

Query: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRS---VYXXXXXXXXXX 71
            TP KL+ G    ++ A    S S+++ + P+LQPP  S  SRGR     Y          
Sbjct: 55   TPRKLILGQNDNRY-AFSQPSVSSSSFQVPTLQPPDSSS-SRGRKDIKSYSQSPPRSPGR 112

Query: 72   XXXXXIELIQLSPIKNSRLELQKIYDGKQTTTK--RLSIKNLILNNFKSYAGVQVVGPFH 129
                 +ELIQLSP+KN+R++L+++YD   + +K  RL I  L LNNFKSYAG QVVGPFH
Sbjct: 113  SPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFH 172

Query: 130  SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQ 189
            +SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   +L+ CSV++ F 
Sbjct: 173  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFL 232

Query: 190  YVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKR 249
            Y +D+ DG+TK+     +L + RK FKNN+SKYYINGKES+YT+VT+ L+ EGIDLDHKR
Sbjct: 233  YAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKR 292

Query: 250  FLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEK 309
            FLILQGEVE+IAQMKPKA+ E DDGLLEYLEDIIGT+KYK  I   L+E+++LN+IC+EK
Sbjct: 293  FLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEK 352

Query: 310  EIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAF 369
            E RFE+V++EK SLE+GK  ALEF+               +++ +   KL  TL KISA 
Sbjct: 353  ENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISAL 412

Query: 370  TEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKL 429
             E+   E++K   LQ EI   ++L +  + +I  +  E+ Q +K K  L+ E VS +EKL
Sbjct: 413  NEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKL 472

Query: 430  KSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIK 489
            K+L QK+ K EK +   EK I    + I+ L ++Q E+                  +A+K
Sbjct: 473  KNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMK 532

Query: 490  MSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLR 549
            + L++KTS ISEE+   E +LEPW  K++ K ++I+L ES+I +++E ++KL+ +I  L 
Sbjct: 533  LKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLS 592

Query: 550  KDIESYKD-RIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRM 608
            +++ +    +I+  +  +N L+K+ ++IT  IS  + EC+  + KL +MK VL   RQR 
Sbjct: 593  QEVSNQTALKIKREEDLVN-LKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRA 651

Query: 609  TDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDI 668
            ++AR+AL+NV+N+ KVL AL +LQKSGRI GFHGRLGDLGTID+ YD+A+S ACPRLDDI
Sbjct: 652  SEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDI 711

Query: 669  VVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFA 728
            VVETVEC QQCIE+LRKNKLGYARFILLDKL+ FN   + TP+NVPRLFDL  PK+  F 
Sbjct: 712  VVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFV 771

Query: 729  PALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLM--- 785
            PA YSVLRDTLVAKDL QANRVAYG RR+RVVTLDGKLID+SGTMSGGG+ V KGLM   
Sbjct: 772  PAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQ 831

Query: 786  KSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKH 845
            +  Q   D Y  E+V+++E +L+D+E NF++A + F EME  LQK  +R+P I++EISK 
Sbjct: 832  RKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKI 891

Query: 846  KIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKN 905
             ++IDT S+E++SK+  L E  +   +  +DN  L+     L  L  E +AL+D++K K 
Sbjct: 892  IMEIDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKK 951

Query: 906  EQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQK 965
            ++I+ L+ +IMKIGG++LQ QNSKV S+ Q++ I+ AKQKK+RT  KK++ E+ +A K  
Sbjct: 952  KKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTL 1011

Query: 966  LGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKA 1025
            L ++NDI     ++ + +   + +   L   +  IE  +  KE L  E +  K  + D  
Sbjct: 1012 LTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLE 1071

Query: 1026 AYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPL 1085
              + +FKS EIE+   LEKL  L +HIK +I   ++ L+ L LR + Q+L  LDE +   
Sbjct: 1072 ENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEES--- 1128

Query: 1086 ESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPG 1145
                  A  P+N  + +  + D         A           D +SMD+D  A  I  G
Sbjct: 1129 -----EAKAPNNGTLSDEQIHDQTGHELTNTA---------VQDDDSMDIDNGAEVISNG 1174

Query: 1146 LPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVE 1205
            LP L++ EL  +DI  +  E++ L++Y+++  A+I++LEEY  RL E+K RKLDLN++V+
Sbjct: 1175 LPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVD 1234

Query: 1206 KREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVL 1265
            KRE +R + E LKK+R EEFM GFGIISMT+KE+YQMITMGGNAELELVDSLDPFSEGV 
Sbjct: 1235 KRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVT 1294

Query: 1266 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1325
            FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1295 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1354

Query: 1326 YIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374
            YIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N T S T++N +ILN
Sbjct: 1355 YIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1336 bits (3457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 728/1393 (52%), Positives = 970/1393 (69%), Gaps = 49/1393 (3%)

Query: 4    LRTSKKPKHLDTPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYXX 63
            L TS    H  TP KL+  S   ++  SQ ++++TT+L  P+LQPP  S   R    Y  
Sbjct: 51   LETSYAKSH--TPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYSQ 108

Query: 64   XXXXXXXXXXXXXIELIQLSPIKNSRLELQKIYDGKQTTTK---RLSIKNLILNNFKSYA 120
                         +EL+QLSP+KNSR+ELQK+Y+  Q++TK   RL I  L+L NFKSYA
Sbjct: 109  SPPRSPGRSPTRRLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYA 168

Query: 121  GVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLS 180
            G QVVGPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   NL 
Sbjct: 169  GRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQ 228

Query: 181  FCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRN 240
             CSV + F+YV+D++ G +++  +   L + RK FKNN+SKYYINGKESSYTEVT+ L+N
Sbjct: 229  SCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKN 288

Query: 241  EGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMD 300
            EGIDLDHKRFLILQGEVE+IAQMKPKA+ E DDGLLEYLEDIIGTA YK  I + + +++
Sbjct: 289  EGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIE 348

Query: 301  TLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLA 360
             LN++C+EKE RFE+V++EK SLE+GKE ALEF+A              + + +   KLA
Sbjct: 349  ALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLA 408

Query: 361  VTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQR 420
             TL+KIS+  +  E E+ K+ E  K++ +++     ++++I+  ++ +  LV ++ +L+ 
Sbjct: 409  STLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEG 468

Query: 421  ELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXX 480
              VS EE+ K+L  K  K+E+T +  +++I   E+ ++ L+  QTE              
Sbjct: 469  TRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEE 528

Query: 481  XXXXXDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLK 540
                 D IK+SL+DKT  IS E+   EKELEPW  +L+ K SQI+LAESE+ +++E++ K
Sbjct: 529  ERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSK 588

Query: 541  LEQEISQLRKDI-------ESYKDRIENHKKKINKLEKESAAITSFISTAQGE--CDSAK 591
            L++ +  + + I       +  +D I N KKK++ L  E          +QGE    SA 
Sbjct: 589  LKKNVETMEEKILARKAHKQELQDLILNLKKKLSSLRDER---------SQGEENFSSAH 639

Query: 592  KKLVDMKQVLTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTID 651
             KL +M++VL  HRQR  +AR +LS  +NK+KVL AL +LQKSGRI+GFHGRLGDLG ID
Sbjct: 640  LKLEEMQKVLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIID 699

Query: 652  DKYDIAISVACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPE 711
            + +D+AIS ACPRLDD+VV+TVECAQQCI++LRKNKLGYARFILLD+L++FN+  ++TPE
Sbjct: 700  NSFDVAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPE 759

Query: 712  NVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISG 771
            NVPRLFDL  PK+  F+ A YSVLRDTLVA+ L QAN VAYG +RFRVVT+DGKLIDISG
Sbjct: 760  NVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISG 819

Query: 772  TMSGGGDRVVKGLMK-SKQRSN--DMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAAL 828
            T+SGGG+ V KGLM+    +SN  D YT EEV ++E EL++RE NF++A DT  EMEA L
Sbjct: 820  TISGGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAEL 879

Query: 829  QKYKDRQPNIDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLV 888
            +  +D++P I+ +ISK +++ D+++SEL   +  + E      N   D   +  I   L 
Sbjct: 880  KNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLE 939

Query: 889  ALNSELVALKDESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNR 948
             L  E   L+ E+K K E+I  L+ +IMKIGG KLQ QNSKV SL Q+L I+VAK KK +
Sbjct: 940  RLKGEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVK 999

Query: 949  TELKKNELEMNRASKQKLGAENDINHCEIELSKTNNSHEALQEGLRET-----EHLIEVI 1003
            + +KK+E ++ +  KQ   +E D     +ELS  +N  +A++E L+ T     E+ I++ 
Sbjct: 1000 SGIKKSEGDVLKFQKQLKNSERD-----VELS--SNELKAIEEKLKHTKLDLSENDIKMT 1052

Query: 1004 E--DKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDE 1061
            E  + + +L +E E  K+ + +    +++FKS EIEM   LEKL +L  HIK EI++ ++
Sbjct: 1053 ETFNLRSELKEESEQLKEMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEK 1112

Query: 1062 ELNTLKLRDVEQLLQKLDEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLIS 1121
             L+ L +RDV   L+ LD + + +       V   N+    +  E   ++  D   K I 
Sbjct: 1113 GLSELSIRDVTHTLEILDNNTMDI-------VKTDNKIEQAVVKEKRSSETQD--EKNIQ 1163

Query: 1122 EDPNSFNDQESMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADID 1181
            E+  + +D  SMD+D+ ++ +  G+P+ +E EL  +DIE L  EI++L  Y+D    DI 
Sbjct: 1164 EEERTCDDHHSMDIDETSNEVIRGIPRFSEEELKELDIELLEKEISELSYYIDETNVDIG 1223

Query: 1182 ILEEYALRLAEYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQ 1241
            +LEEYA RLAE+KRRKLDLN++V+KR+E++ + E+LKK R +EFM GF IISMT+KE+YQ
Sbjct: 1224 VLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQ 1283

Query: 1242 MITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYK 1301
            MITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYK
Sbjct: 1284 MITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYK 1343

Query: 1302 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNM 1361
            PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N 
Sbjct: 1344 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNR 1403

Query: 1362 TKSTTLQNIDILN 1374
            T+STT++NIDILN
Sbjct: 1404 TRSTTVKNIDILN 1416

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1335 bits (3454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 725/1376 (52%), Positives = 958/1376 (69%), Gaps = 23/1376 (1%)

Query: 12   HLDTPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYXXXXXXXXXX 71
            H  TP KL+ G+ G    A  + S S+++L+ P LQPP  S   RG   Y          
Sbjct: 48   HAKTPRKLVVGN-GDNRYAHSSQSISSSSLQVPPLQPPATSSRGRGSKTYSQSPPRSPGR 106

Query: 72   XXXXXIELIQLSPIKNSRLELQKIYDGKQTTTK--RLSIKNLILNNFKSYAGVQVVGPFH 129
                 +ELIQ+SP+KNSRLELQKIYD +Q   +  RL I  LIL +FKSYAG QVVGPF+
Sbjct: 107  SPTRKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFN 166

Query: 130  SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQ 189
            +SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE + +L  CSVE+ F+
Sbjct: 167  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFK 226

Query: 190  YVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKR 249
            YV+D+  G T++  +   L V RK F+NNTSKYY+N +E++Y EVT+ L+ EG+DLDHKR
Sbjct: 227  YVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKR 286

Query: 250  FLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEK 309
            FLILQGEVE+IAQMK KA+ EG+DGLLEYLEDIIGTAKYK  I   L +M++LNDIC+EK
Sbjct: 287  FLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEK 346

Query: 310  EIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAF 369
            E RF++V++EK SLE GKE+AL F+               + I     KL  TLDKI+  
Sbjct: 347  ENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNL 406

Query: 370  TEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKL 429
             +KLE E +K   ++KE+  LR   D LE ++   N E+ QL+  K +L  + V +EEK+
Sbjct: 407  NQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKI 466

Query: 430  KSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIK 489
            K+  +KR KAEKTL   +++I   E  +  L + Q ++                  + IK
Sbjct: 467  KNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIK 526

Query: 490  MSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLR 549
             SL+DKT+ IS E+A LEKELEPW  +L+ K +QI+LAES+I +IKE++ KL QEI Q +
Sbjct: 527  FSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFK 586

Query: 550  KDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMT 609
            ++IE+ K +I    K+++ L  +  ++   IST + EC +A+ +L +M+ +L   RQ+  
Sbjct: 587  QEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKAL 646

Query: 610  DARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIV 669
            DAR ALSN ENK+KVL AL RLQKSGRI GFHGRLGDLG ID+KYD+AIS ACPRL+DIV
Sbjct: 647  DARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIV 706

Query: 670  VETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAP 729
            VETVEC QQCIE+LRKNKLGYARFILLDKL+KFN+  + TPE+VPRLFDL  PK+  F+ 
Sbjct: 707  VETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSS 766

Query: 730  ALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLM---K 786
            A +SVL +TLVA DL QANRVAYG +RFRVVTLDG LIDISGTMSGGG RV +GLM   +
Sbjct: 767  AFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINR 826

Query: 787  SKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHK 846
            +K    ++Y+SEEV ++E  L +RE NF++A+DT  +ME  L+  K+++P I+  IS+  
Sbjct: 827  NKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLT 886

Query: 847  IDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNE 906
            ++I++ +SE++ K+  ++E E      Q +N  L +    + +L  E  ++++++K K  
Sbjct: 887  MEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKH 946

Query: 907  QISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKL 966
            +I  L+ +IM+IGG +L+ Q+SKVDS+ Q++ I+V+KQKK R+ +KK E E+N++ K KL
Sbjct: 947  RIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKL 1006

Query: 967  GAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAA 1026
                D+ +   E+     + E LQ+ L +    +  ++  KE L +E  T +  L+D   
Sbjct: 1007 ETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINE 1066

Query: 1027 YVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLE 1086
             +  FKS E+EM   LEKL +L  H+K EI   +E+L  LK+RDV Q+L     H+L  E
Sbjct: 1067 DIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQIL-----HDLKDE 1121

Query: 1087 SLTDRAVTPSNQCIPEMTVEDHDADMNDG-------EAKLISEDPNSFNDQESMDVDQDA 1139
            S  + A  PS    P   VE+ ++ + +G       +A+   +D     D + MDV+   
Sbjct: 1122 S--NNASDPSEN--PVSDVEESESSVGEGKDENKDLDAQDQVQDAEKQGDNQ-MDVEDGG 1176

Query: 1140 SYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLD 1199
             Y   GL + +E EL  I+IEEL  EI  L+ ++D + ADID+LEEYA RL E+K R+LD
Sbjct: 1177 EYSDRGLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLD 1236

Query: 1200 LNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDP 1259
            LN++VE+R +++ + + LKK R +EFM GFGIISMT+KE+YQMITMGGNAELELVD+LDP
Sbjct: 1237 LNQAVEERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDP 1296

Query: 1260 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1319
            FSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN
Sbjct: 1297 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1356

Query: 1320 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILNI 1375
            VSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N TKS T++NID +++
Sbjct: 1357 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSV 1412

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1326 bits (3431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/1367 (51%), Positives = 944/1367 (69%), Gaps = 19/1367 (1%)

Query: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYXXXXXXXXXXXXX 74
            TP KL+  S   ++  SQ ++++T++L  P+LQPP      R    Y             
Sbjct: 60   TPRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYSQSPPRSPGRSPT 119

Query: 75   XXIELIQLSPIKNSRLELQKIYDGKQTTTK---RLSIKNLILNNFKSYAGVQVVGPFHSS 131
              +EL+QLSP+KNSR+ELQK+YD  Q + +   RL I  L+L NFKSYAG QVVGPFH+S
Sbjct: 120  RRLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTS 179

Query: 132  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYV 191
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   NL  CSV + F+YV
Sbjct: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYV 239

Query: 192  MDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFL 251
            +D+  G +++  +   L + RK F+NN+SKYYINGKES+YT+VT+ L+NEGIDLDHKRFL
Sbjct: 240  VDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFL 299

Query: 252  ILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEI 311
            ILQGEVE+IAQMK KA+ E DDGLLEYLEDIIGTA YK  I D L +++TLN+IC+EKE 
Sbjct: 300  ILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKEN 359

Query: 312  RFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAFTE 371
            RFE+V +EK SLE+GKE ALEF+               + + +   KLA TL+K S+  +
Sbjct: 360  RFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSLNK 419

Query: 372  KLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKS 431
              E+E+ K+ E  KE+ ++      ++++++   +++  L  +K +L+   VS EE+ K+
Sbjct: 420  DFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKN 479

Query: 432  LNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMS 491
            L  K  KAEK L+    +I   E+ +  L+  QTE                   D IK+S
Sbjct: 480  LVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIKLS 539

Query: 492  LRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKD 551
            L+DKT  IS E+   EK+LEPW  +L+ K SQI+LAESE+ +++E+++KL++    L ++
Sbjct: 540  LKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALEEN 599

Query: 552  IESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDA 611
            I + K R +  +  I  L+K   ++    S  + +  +A  KL +M+ +L  HRQR  +A
Sbjct: 600  IAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEA 659

Query: 612  RVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVVE 671
            R +LS  ENK+KVL AL RLQKSGRI+GFHGRLGDLG IDD +D+AIS ACPRLDD+VV+
Sbjct: 660  RSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVD 719

Query: 672  TVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPAL 731
            TVECAQ CI++LRKNKLGYARFILLD+L++FN+  V TPENVPRLFDL  PK+  F+ A 
Sbjct: 720  TVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAF 779

Query: 732  YSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMK-SKQR 790
            YSVLRDTLVA+DL QAN VAYG RRFRVVT+DGKLIDISGTMSGGG+ VVKGLM+  K +
Sbjct: 780  YSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQ 839

Query: 791  SNDM--YTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKID 848
            S+ M  YT EEV ++E EL++RE NF++A DT  EME  L+K +D++P+++ +I + +++
Sbjct: 840  SDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRAEME 899

Query: 849  IDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQI 908
             D+L+SEL   ++ + E +   + +  D   L  I   L  L  E   L+ E+K K E+I
Sbjct: 900  ADSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERI 959

Query: 909  SELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGA 968
              L+ QIMKIGG  LQ QNSKV+SL+Q++ I+VAK KK ++ +KK+  ++ +  KQ    
Sbjct: 960  KALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQLKNV 1019

Query: 969  ENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYV 1028
            E DI     EL       E ++  L + +  +  I + K  L ++ E  K+ + +    +
Sbjct: 1020 ERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKI 1079

Query: 1029 EKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLESL 1088
            ++FKS E+EM   LEKL +L  +IK++I + ++ELN L +RDV   L  LD + + +   
Sbjct: 1080 DEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDK 1139

Query: 1089 TDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFND-QESMDVDQDASYIGPGLP 1147
                   +NQ            D++ GEAK  ++     ND +  M++D+ +  +  G+P
Sbjct: 1140 EGEDRQETNQ-----------EDIS-GEAKGETQGEEGDNDDRHCMNIDETSDEVSRGIP 1187

Query: 1148 KLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKR 1207
            +L+E EL  ++IE L  +I +L  Y+D    DI +LEEYA RLAE+KRRKLDLN++V+KR
Sbjct: 1188 RLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKR 1247

Query: 1208 EEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFS 1267
            +E++ + E+LKK R +EFM GF IISMT+KE+YQMITMGGNAELELVDSLDPFSEGV FS
Sbjct: 1248 DEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1307

Query: 1268 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1327
            VMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI
Sbjct: 1308 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1367

Query: 1328 KERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374
            KERTKNAQFIVISLRNNMFELAQQL+G+YK  N TKSTT++NIDILN
Sbjct: 1368 KERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1316 bits (3407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/1372 (51%), Positives = 943/1372 (68%), Gaps = 30/1372 (2%)

Query: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYXXXXXXXXXXXXX 74
            TP KL+  S   ++  SQ ++++TT+L  P+LQPP  S   R    Y             
Sbjct: 60   TPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYSQSPPRSPGRSPA 119

Query: 75   XXIELIQLSPIKNSRLELQKIYDGKQTTTK---RLSIKNLILNNFKSYAGVQVVGPFHSS 131
              +EL+QLSP+KNSR+ELQK+YD  +++ K   RL I  L+L+NFKSYAG QVVGPFH+S
Sbjct: 120  RRLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTS 179

Query: 132  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYV 191
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   +L  CSV + F+Y+
Sbjct: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYI 239

Query: 192  MDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFL 251
            +D+  G +++  +   L + R+ FKNN+SKYYIN KESSYTEVT+ L+ EGIDLDHKRFL
Sbjct: 240  IDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFL 299

Query: 252  ILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEI 311
            ILQGEVE+IAQMKPKA+ E DDGLLEYLEDIIGTA YK  I + L ++++LN+IC+EK  
Sbjct: 300  ILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKAN 359

Query: 312  RFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAFTE 371
            RFE+V++EK SLE+GKE ALEF+               + + +   KLA TL+KIS+   
Sbjct: 360  RFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISSLNR 419

Query: 372  KLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKS 431
            + E+E+ K+ E  +E+ +++    +++++I+   + +  L  +K +L+   VS EE+ K+
Sbjct: 420  EFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKN 479

Query: 432  LNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMS 491
            L  K  KAEK L+  + +I   E+  + L   QTE                   D IK+S
Sbjct: 480  LVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLS 539

Query: 492  LRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKD 551
            L+DKT  IS ++   EKE EPW  +L+ K SQI+LAESE+ +++E++ KL++    L + 
Sbjct: 540  LKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEALEEK 599

Query: 552  IESYKDRIENHKKKINKLEKESAAITSFI-STAQGECD--SAKKKLVDMKQVLTNHRQRM 608
            I S K R +  +  +  L   S  + S I   +QGE D  SA  KL +M+++L  HRQR 
Sbjct: 600  IISKKQRKQELQGLVLDL---SQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRA 656

Query: 609  TDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDI 668
             +AR +LS  +NKN VL AL +LQKSGRI+GFHGRLGDLG ID+ +D+AIS ACPRLDD+
Sbjct: 657  MEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDV 716

Query: 669  VVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFA 728
            VV+TVECAQ CI++LRKNKLGYARFILLD+L+KFN+  ++TPENVPRLFD+  PK+  F+
Sbjct: 717  VVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFS 776

Query: 729  PALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSK 788
             A YSVL+DTLVA+DL QAN+VAYG RRFRVVT+DGKLIDISGTMSGGG+ V+KGLM+  
Sbjct: 777  NAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLG 836

Query: 789  QRSNDM---YTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKH 845
               +D    YT EEV ++E EL +RE NF++A DT  EME  L+K +D++P+++ +IS+ 
Sbjct: 837  TNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRA 896

Query: 846  KIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKN 905
            +++ D+L+SEL   +    E +   +    +   + ++   L  L  E   L+ E++ K 
Sbjct: 897  EMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKK 956

Query: 906  EQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQK 965
            EQI  L+ QIMKIGG KL +QNSKV SL Q++ I+V K KK ++ +KK+E ++ +  KQ 
Sbjct: 957  EQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQKQL 1016

Query: 966  LGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKA 1025
               E D      EL       +  +  L E +  +  I + K +L  + E  K+ L +  
Sbjct: 1017 KNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEME 1076

Query: 1026 AYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPL 1085
              +++FKS EIEM   LEKL +L  HIK EI + D+ELN L +RDV   LQ LD + + +
Sbjct: 1077 ENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDV 1136

Query: 1086 --ESLTDRAVTPSNQCIPEMTVEDHDADMNDG--EAKLISEDPNSFNDQESMDVDQDASY 1141
              + + D               +D D D   G  + + I E  ++ N+  SM++D+ +S 
Sbjct: 1137 VEDGIKDE--------------QDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSE 1182

Query: 1142 IGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLN 1201
            I  G+PKL E EL ++DIE L  +I+ L  Y++    DI +LEEY  RL E+KRRKLDLN
Sbjct: 1183 ISRGIPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLN 1242

Query: 1202 ESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFS 1261
            ++V+KR+E++ + E+LKK+R +EFM+GF IISMT+KE+YQMITMGGNAELELVDSLDPFS
Sbjct: 1243 QAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFS 1302

Query: 1262 EGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1321
            EGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVS
Sbjct: 1303 EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVS 1362

Query: 1322 IVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDIL 1373
            IVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYK  N TKSTT++NIDIL
Sbjct: 1363 IVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDIL 1414

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1311 bits (3392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/1383 (51%), Positives = 951/1383 (68%), Gaps = 37/1383 (2%)

Query: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYXXXXX------XX 68
            TP KL+        +   A+   +++L+ PSL PPT S  SRGR+               
Sbjct: 57   TPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESS-SRGRTARTYSQSPPRSPARS 115

Query: 69   XXXXXXXXIELIQLSPIKNSRLELQKIYDGK-QTTTKRLSIKNLILNNFKSYAGVQVVGP 127
                    +ELIQLSP+KNSR+ LQKIY+ K +   +RL I  L+L++FKSYAG QVVGP
Sbjct: 116  PARSPTRKLELIQLSPVKNSRIALQKIYESKNEKQIERLCIDKLVLHDFKSYAGTQVVGP 175

Query: 128  FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEIT 187
            FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQ +LS+LIHKSEN  +L  CSVE+ 
Sbjct: 176  FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVH 235

Query: 188  FQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDH 247
            F+YV+D  DG T +    ++L + RK FKNNTSKYYINGKES+YT VT+ L++EGIDLDH
Sbjct: 236  FEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDH 295

Query: 248  KRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICM 307
             RFLILQGEVE+IAQMKPKA+++GDDGLLEYLEDIIGTAKYK  I     E++ LN+IC+
Sbjct: 296  NRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICI 355

Query: 308  EKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKIS 367
            EKE RFE+V++EK SLE+GK++ALEF+               + + ++ KKL+ TL+K+S
Sbjct: 356  EKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLS 415

Query: 368  AFTEKLENERNKYG--ELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQR----- 420
               E+ E  + K+   E+Q     + E+S +  E +  I A + Q  + KL +Q+     
Sbjct: 416  NIKEEFEETKKKHSTTEIQ-----MNEISKSYHEMLKNIKASQEQ--EKKLNIQKRNYDT 468

Query: 421  ELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXX 480
            E VS EE+ K++ +K+ K EK L+   K I + +  I  L + ++E+             
Sbjct: 469  ERVSLEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQI 528

Query: 481  XXXXXDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLK 540
                 + IK+SL+DKT   S+E++  EKELEPW  +L+ K SQI++ ESEI +IKE ++K
Sbjct: 529  ERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVK 588

Query: 541  LEQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQV 600
            LE +I  L   I    +   + +K+I  L  E   IT  +S    E  +AK+KL +MK V
Sbjct: 589  LENDIENLNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAV 648

Query: 601  LTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISV 660
            L  HRQ+  DAR +LS  ENKN+VL +L RLQKSGRI GF+GRLGDLG IDD+YDIAIS 
Sbjct: 649  LNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAIST 708

Query: 661  ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLT 720
            ACPRL+D+VVETVEC QQCIE+LRKNKLGYARFILL+KL+ F+M K++TP NVPRLFDL 
Sbjct: 709  ACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLV 768

Query: 721  TPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRV 780
               +  F PA YSVLRDTLV  +L  ANRVAYG +RFRVVTL G+LID+SGTMSGGG + 
Sbjct: 769  ISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQT 828

Query: 781  VKGLMKSKQRSND---MYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPN 837
             +GLMK  +  N     YT E+V+++E EL  RE NF+IA +TF EME  L++ KDR+P+
Sbjct: 829  SRGLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPD 888

Query: 838  IDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVAL 897
            +++EISK +++I +  +E +  +  L E + + +    +N  L  +E++L  L ++  +L
Sbjct: 889  VELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSL 948

Query: 898  KDESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELE 957
            + E+K K ++I  L+ +IMK+GG+KLQ Q+SKVDS+ Q+  I+  K KK++ +LKK E E
Sbjct: 949  QLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETE 1008

Query: 958  MNRASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETA 1017
            + R SK++     D+     +L  T+     + + L ETE L+  +E  +E+  Q  E  
Sbjct: 1009 LKRLSKKQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSREESLQNSENL 1068

Query: 1018 KKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQK 1077
            K  L +    +  FK  ++E     EKL NL + IK +I  TD EL +LK+RD+   LQ+
Sbjct: 1069 KDQLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQE 1128

Query: 1078 LDEHNLPLE----SLTDRAVTPS--NQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQE 1131
            LD  N+  +    S+ D AV+ S  N       +E  + + N+ +       P++ ND E
Sbjct: 1129 LDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDV-----SPDANNDLE 1183

Query: 1132 SMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLA 1191
             M++D+D + I  G+P+++E E  N+D+EEL  +  QL++Y+DT   +ID+LEEYA R+A
Sbjct: 1184 -MEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVA 1242

Query: 1192 EYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAEL 1251
            EYKRRKLDLN +V++RE++R   + LKK+R EEFM GFG+IS+T+KE+YQMITMGGNAEL
Sbjct: 1243 EYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAEL 1302

Query: 1252 ELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1311
            ELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEI
Sbjct: 1303 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1362

Query: 1312 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNID 1371
            DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+GIYKS+N TKS TLQN D
Sbjct: 1363 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNND 1422

Query: 1372 ILN 1374
            I+N
Sbjct: 1423 IIN 1425

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1305 bits (3376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 715/1375 (52%), Positives = 951/1375 (69%), Gaps = 33/1375 (2%)

Query: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYXXXXXXXXXXXXX 74
            TP KL+  S   ++  SQ ++++TT+L  P+LQPP  S   R    Y             
Sbjct: 60   TPRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYSQSPPRSPGRSPT 119

Query: 75   XXIELIQLSPIKNSRLELQKIYDGKQTTTK---RLSIKNLILNNFKSYAGVQVVGPFHSS 131
              +EL+QLSP+KNSR+ELQKIYD  Q+++K   RL I  L+L NFKSYAG QVVGPFH+S
Sbjct: 120  RRLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTS 179

Query: 132  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQYV 191
            FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   +L  CSV + FQYV
Sbjct: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYV 239

Query: 192  MDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFL 251
            +D++ G +++  +   L + RK FKNN+SKYYIN KESSYTEVT+ L+NEGIDLDHKRFL
Sbjct: 240  IDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFL 299

Query: 252  ILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEI 311
            ILQGEVE+IAQMKPKA+ E DDGLLEYLEDIIGTA YK  I + + +++ LN++C+EKE 
Sbjct: 300  ILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKEN 359

Query: 312  RFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAFTE 371
            RFE+V++EK SLE+GKE ALEF+               + + +   KLA TL+KIS+  +
Sbjct: 360  RFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNK 419

Query: 372  KLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKS 431
             LE+E+ K+ E  K++ +++     ++++I+  ++++  LV ++ +L+   VS EE+ K+
Sbjct: 420  DLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKN 479

Query: 432  LNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMS 491
            L  K  KAEKTL+  + +I   EN +  L   QTE                   D IK+S
Sbjct: 480  LVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLS 539

Query: 492  LRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKD 551
            L+DKT +IS E+   EKELEPW  +L+ K SQI+LAESE+ +++E++ KL++ +  L + 
Sbjct: 540  LKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEK 599

Query: 552  I-------ESYKDRIENHKKKINKLEKESAAITSFISTAQGECD--SAKKKLVDMKQVLT 602
            I       +  +D I + KKK+N L+ E +         QGE +  SA  KL +M++VL 
Sbjct: 600  ILAKKTHKQELQDLILDLKKKLNSLKDERS---------QGEKNFTSAHLKLKEMQKVLN 650

Query: 603  NHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVAC 662
             HRQR  +AR +LS  +NK+KVL AL RLQKSGRI+GFHGRLGDLG IDD +D+AIS AC
Sbjct: 651  AHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTAC 710

Query: 663  PRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTP 722
            PRLDD+VV+TVECAQ CI++LRKNKLGYARFILLD+L++FN+  ++TPENVPRLFDL  P
Sbjct: 711  PRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKP 770

Query: 723  KNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVK 782
            KN  F+ A YSVLRDTLVA++L QAN VAYG +RFRVVT+DGKLIDISGTMSGGG+ V K
Sbjct: 771  KNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAK 830

Query: 783  GLMKSKQRSNDM---YTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNID 839
            GLMK     +D    YT EEV ++E EL++RE NF++A+DT  EME  L+K +D +P+++
Sbjct: 831  GLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLE 890

Query: 840  VEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKD 899
             +ISK +++ D+L+SEL   +  + E E        D   L  +   L  L  E   L+ 
Sbjct: 891  SQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQS 950

Query: 900  ESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMN 959
            E+K K E+I  L+ +IMKIGG+KLQ QNSKV+S+ Q+L I+VAK KK ++  KK+  ++ 
Sbjct: 951  ETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVV 1010

Query: 960  RASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKK 1019
            +  K    +E D+     EL       +  +  L E +  +    + K +L ++ E  K+
Sbjct: 1011 KFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKE 1070

Query: 1020 NLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLD 1079
             ++D    + +FKS EIEM   LEKL +L  +IK+EI++ ++ LN L +RDV   L  LD
Sbjct: 1071 QMEDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLD 1130

Query: 1080 EHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDA 1139
            ++ +     + +    +NQ   E+  E    +  D     I +   S ++   M++D+ +
Sbjct: 1131 DNKMD----SVKEDVKNNQ---ELDQEYRSCETQDESE--IKDAETSCDNYHPMNIDETS 1181

Query: 1140 SYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLD 1199
              +  G+P+L+E EL  +D+E +  +I +L  Y++    DI +LEEYA RLAE+KRRKLD
Sbjct: 1182 DEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLD 1241

Query: 1200 LNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDP 1259
            LN +V+KR+E++ +  +LKK R +EFM GF IISMT+KE+YQMITMGGNAELELVDSLDP
Sbjct: 1242 LNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDP 1301

Query: 1260 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1319
            FSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN
Sbjct: 1302 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1361

Query: 1320 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374
            VSIVANYIKERTKNAQFIVISLRNNMFELAQQL+G+YK  N TKSTT++NIDILN
Sbjct: 1362 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1304 bits (3374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/1368 (51%), Positives = 944/1368 (69%), Gaps = 24/1368 (1%)

Query: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPP-TYSQLSRGR---SVYXXXXXXXXX 70
            TP KL+      ++  SQ +  S ++L+ PSLQPP T S  SRGR    VY         
Sbjct: 57   TPRKLILHQSDNRYAFSQPTV-SASSLQVPSLQPPETSSSSSRGRRDIKVYSQSPPRSPG 115

Query: 71   XXXXXXIELIQLSPIKNSRL-ELQKIYDGKQTTTKRLSIKNLILNNFKSYAGVQVVGPFH 129
                  +ELIQLSP+KN+R+ +LQ++Y+  Q   +RL I  L+LNNFKSYAG QV+GPF+
Sbjct: 116  RSPTRKLELIQLSPVKNNRIRKLQELYNS-QIKKERLFINKLVLNNFKSYAGEQVIGPFN 174

Query: 130  SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQ 189
            ++FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE+  NL  CSV++ FQ
Sbjct: 175  TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQ 234

Query: 190  YVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKR 249
            YV+D ++G++K+  +  +L + RK FKNN+SKY+INGKESSYTEVT+ L+ EGIDLDHKR
Sbjct: 235  YVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKR 294

Query: 250  FLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEK 309
            FLILQGEVE+IAQMKPKA+ EGDDGLLEYLEDIIGTA YKS I    +E+DTLN+IC+EK
Sbjct: 295  FLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEK 354

Query: 310  EIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAF 369
            E RFE+VE+EK SLE+ K  ALEF+               ++I KE +KLA TL K+S  
Sbjct: 355  ENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVL 414

Query: 370  TEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKL 429
             E+ +NE  K+   Q+E   L +    + ++I  I  +       K +LQ +  S EEK+
Sbjct: 415  QEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKI 474

Query: 430  KSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIK 489
            KS  +K+ KA K++  ++K +++  N I  LN  Q E                   + IK
Sbjct: 475  KSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIK 534

Query: 490  MSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLR 549
            +SL+DKT+ IS E+A  E+ELEPW  +L+ K  +I++AES+I +++E++ KL+ EI +L+
Sbjct: 535  LSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLK 594

Query: 550  KDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMT 609
             D++   +  +N ++K+  L+ + +AI++     + EC +AK K+ DM+ VL   RQ++ 
Sbjct: 595  NDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVM 654

Query: 610  DARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIV 669
            DAR  L+ VENK+KVL AL +LQKSGRI GF+GRLGDLG ID++YDIAIS A  RLDDIV
Sbjct: 655  DARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIV 714

Query: 670  VETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAP 729
            V++VEC Q CIE+LRKNKLGYARFILL+KL+   + ++ TPENV RLFDL  P  +IF P
Sbjct: 715  VDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIP 774

Query: 730  ALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQ 789
            A YSVLR+TLVAKDL QANRVAYG  RFRVVT+DGKLIDISGT++GGG +  +GLMK ++
Sbjct: 775  AFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRK 834

Query: 790  RSN---DMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHK 846
            +     D+Y++++++++E EL +RE NFK A DT+ EME ALQ+ KDR+P +++EISK  
Sbjct: 835  KGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCL 894

Query: 847  IDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNE 906
            +D D  S EL+S +D L +  +  E + ++   + +IE+QL  L  E   L D +K  +E
Sbjct: 895  MDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISE 954

Query: 907  QISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKL 966
            +I +L+ +IM+IGG+ LQ QNSKV+S+ Q + II +KQK+  + +KK E E+ R+ K   
Sbjct: 955  KIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALS 1014

Query: 967  GAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAA 1026
            GAE D   C  E+   +   E+++  L   +     +E++  +L  E    K+ +++   
Sbjct: 1015 GAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEI 1074

Query: 1027 YVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLE 1086
               KFKS EI++   LEKL NL  HIK  I   DE+L  L+LR+   +     ++N    
Sbjct: 1075 EGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNN---- 1130

Query: 1087 SLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQES-MDVDQDASYIGPG 1145
            S+     T     +P   ++D +  + +   +      N  N  E+ M++D  A    PG
Sbjct: 1131 SINGVDRTSHGGGVP---LQDQNKVVRENNMR------NEKNSTEAEMEIDDVADEFSPG 1181

Query: 1146 LPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVE 1205
            +P++++A+L  ID++ L  EI QL+EY+     +ID+LEEYA RLA+Y  RKLDLN++VE
Sbjct: 1182 IPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVE 1241

Query: 1206 KREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVL 1265
            +RE ++   + LKK R +EFM GFGIISMT+KE+YQMITMGGNAELEL+DSLDPFSEGV 
Sbjct: 1242 RREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVT 1301

Query: 1266 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1325
            FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1302 FSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1361

Query: 1326 YIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDIL 1373
            YIKERTKNAQFIVISLRNNMFELAQQLIGIYK  N TKS  ++N D L
Sbjct: 1362 YIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1296 bits (3355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 723/1380 (52%), Positives = 946/1380 (68%), Gaps = 39/1380 (2%)

Query: 5    RTSKKPKHLDTPSKLMFGSPGRKHVAS--QASSNSTTALRGPSLQPPTYSQLSRGRSVYX 62
            R S+ P    TP KL+ GSP +K+  S  QA++ ++  +  PSLQPPT +   RGR    
Sbjct: 20   RVSQSPTR--TPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPT-AHAVRGREYSQ 76

Query: 63   X---XXXXXXXXXXXXXIELIQLSPIKNSRLELQKIYDGKQTTTKRLSIKNLILNNFKSY 119
                             +ELI+LSP K++RLELQK+++    T++RL I  L+LNNFKSY
Sbjct: 77   SPPRSPTRSPTRSPTRKLELIRLSPKKSTRLELQKMHEANTQTSQRLCIDKLVLNNFKSY 136

Query: 120  AGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENL 179
            AG+Q +GPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS LIHKSE   +L
Sbjct: 137  AGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSL 196

Query: 180  SFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLR 239
            + CSV+I F YV D  +G TK+LP    + V R+ FKNN+SKYY+NGKES+YTEVT+ L+
Sbjct: 197  ASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLK 256

Query: 240  NEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEM 299
             EGIDLDHKRFLILQGEVESIAQMK KA+ + DDGLLEYLEDIIGTAK+K QI   L E+
Sbjct: 257  EEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEI 316

Query: 300  DTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKL 359
            +TLN++CMEKE RFELV+KEK++LE+GKE+ALEF+                 I    +KL
Sbjct: 317  ETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKL 376

Query: 360  AVTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQ 419
            A + DKISA   + + E+++Y  LQKE   L    +N +++ T +  E   +   K  L+
Sbjct: 377  ATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLE 436

Query: 420  RELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXX 479
            ++ ++++EKLKS+ +K   AEK    +E N +   N I  L +   +             
Sbjct: 437  KDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSIS 496

Query: 480  XXXXXXDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKL 539
                  + IK+ L +KT  +S+E+ SLE++LEP+  +++ K S+IKL+E++I ++K S  
Sbjct: 497  IEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHS 556

Query: 540  KLEQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQ 599
             L +E + +   IE  +      K+    L  E + + + ISTAQ EC+ A+K+  +M+ 
Sbjct: 557  NLLKEKATIESKIEDLQLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQTNEMRD 616

Query: 600  VLTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAIS 659
            VL   RQ + +A+  L+  +NKN+VL AL +LQ SGRI GFHGRLGDLGTIDD+YDIAIS
Sbjct: 617  VLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAIS 676

Query: 660  VACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDL 719
             ACPRLDDIVVETVEC QQCI+HLRKNKLGY RFILLDKL+K N+ ++ TPENVPRLFDL
Sbjct: 677  TACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDL 736

Query: 720  TTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDR 779
             TP  ++F PA YSVLRDTLVA+DL QANRVAYG RRFRVVTLDGKLIDISGTMSGGG  
Sbjct: 737  ITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSS 796

Query: 780  VVKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNID 839
               GLM+SK  +   Y+ +EV++ME +L+ +ETN++ A     EME+ALQK  DR P ID
Sbjct: 797  PQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEID 856

Query: 840  VEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKD 899
            ++ISK +++  +  +E++S    L +L      N+++  PL D E +L  L   L    D
Sbjct: 857  IQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTID 916

Query: 900  ESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMN 959
             SK   ++I +L+ +IM+ GG++L+ Q +KV SL Q ++I+  KQKK +T  KK ++++ 
Sbjct: 917  ASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEKTRSKKLDIDLA 976

Query: 960  RASKQKLGAENDINHCEIELSKTNNSHEALQ-EGLRETEHLIEVIEDKKEQLNQEHETAK 1018
            RA+++K     ++  C  ++S  +   E+++ E  R  E +IE  E +K +LN   E  K
Sbjct: 977  RATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNE-RKAELNSSVEKLK 1035

Query: 1019 KNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKL 1078
            + L        +FK++E+E    LEKL  L+ ++K ++   +  L +LK+RDV +LL +L
Sbjct: 1036 QELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQL 1095

Query: 1079 DEHNLPLESLTDRAVTPSNQCIPEMT----VEDHDADMNDGEAKLISEDPNSFNDQESMD 1134
            ++    +ES TD      N  I +      V ++DA  + GEA   S             
Sbjct: 1096 NDG--IIESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDSGEAATHS------------- 1140

Query: 1135 VDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYK 1194
                      GLP LTE EL+N+D+E L LE+ QL++Y+D    DI++LEEYA RLAEY+
Sbjct: 1141 ----------GLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQ 1190

Query: 1195 RRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELV 1254
            RRKLDLN++V KREE+RN+ E  K  RLE+FM+GFGIISMT+KE+YQMITMGGNAELELV
Sbjct: 1191 RRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELV 1250

Query: 1255 DSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1314
            DSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA
Sbjct: 1251 DSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1310

Query: 1315 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374
            LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ L+GIYK++NMTKSTTLQNIDIL+
Sbjct: 1311 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILH 1370

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1257 bits (3252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1395 (49%), Positives = 928/1395 (66%), Gaps = 32/1395 (2%)

Query: 1    MADLRTSKKP---KHLDTPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPP--TYSQLS 55
            +  L++S  P   K   TP KL+ G    K+  SQ +++++++L+ P+LQ      SQ S
Sbjct: 50   LPKLQSSVSPLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDS 109

Query: 56   RGRSVYXXXXX------XXXXXXXXXXIELIQLSPIKNSRLELQKIYDG---KQTTTKRL 106
            RGR +                      +ELIQLSPIKNSRLELQK+YD    K     RL
Sbjct: 110  RGRRIKMYSQSPPRSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRL 169

Query: 107  SIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL 166
             I  L+L+NFKSYAG Q +GPF +SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L
Sbjct: 170  YIHKLVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRL 229

Query: 167  SNLIHKSENHENLSFCSVEITFQYVMDD----ADGNTKVLPDVQELSVMRKVFKNNTSKY 222
            S+LIHKSE   NL+FCSVE+ F+YV D+     DG+T  +     L + RK FKNN+SKY
Sbjct: 230  SDLIHKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKY 287

Query: 223  YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            +INGKES++TEVT+ L+ +GIDLDHKRFLILQGEVE+IAQMK KA+ + +DGLLEYLEDI
Sbjct: 288  FINGKESNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDI 347

Query: 283  IGTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXX 342
            IGT  YK  I    VE++ +N++C+EKE RF +V+ EK SLE  K+ ALEF+        
Sbjct: 348  IGTKHYKPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTL 407

Query: 343  XXXXXXXWDINKETKKLAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQIT 402
                   + +     K+  TL +I +     E E+ ++ +  KE+  L+   D  +  +T
Sbjct: 408  LKSKLTQYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLT 467

Query: 403  KINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNE 462
             +  E+  L++ K ++  + VS EE  K+L+QK  KA+ T++ ++  I   E+ ++  ++
Sbjct: 468  SLTTEEKSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQ 527

Query: 463  AQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNS 522
             Q E+                    IK+ L+DKT + S+E+AS+EKELEP  T+++ K S
Sbjct: 528  LQEEYEAEVNDLSKQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKS 587

Query: 523  QIKLAESEILIIKESKLKLEQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFIST 582
            QIKL E EI +I++SK K+  EI  L++++   +  +E+++K +  L K    +      
Sbjct: 588  QIKLVEMEIDLIRDSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQE 647

Query: 583  AQGECDSAKKKLVDMKQVLTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHG 642
               EC  A  KL +MK +L +HRQ+  +AR  +S  +NKNKVL +L R+Q+SGRI+GFHG
Sbjct: 648  GDKECKDAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHG 707

Query: 643  RLGDLGTIDDKYDIAISVACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKF 702
            RLGDLG I D+YD+AIS ACPRLDD+VVE+VEC Q CIE LRKNKLGYARF++LDKLK+F
Sbjct: 708  RLGDLGIIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRF 767

Query: 703  NMAKVTTPENVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTL 762
            +M+ + TPENVPRLFDL  PK + FAPA+YSVLRDTLVAKDL QANRVAYG RRFRVVTL
Sbjct: 768  DMSPIQTPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTL 827

Query: 763  DGKLIDISGTMSGGGDRVVKGLMKSKQR---SNDMYTSEEVQRMEAELTDRETNFKIATD 819
            DG+LIDISGTMSGGG RV KGLM    +   ++++++ E+++++E EL  RE  F +A++
Sbjct: 828  DGQLIDISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASE 887

Query: 820  TFQEMEAALQKYKDRQPNIDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGP 879
            TF  ME  L+K  DR+P +++EISK  IDID L+ ++Q  +  L E  +  E + +D   
Sbjct: 888  TFHSMEQELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDD 947

Query: 880  LEDIENQLVALNSELVALKDESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQI 939
            L+ +   L ALN EL  L+D+SK  +E++S L+ +IM+IGG +LQ QNSKV SL Q++ I
Sbjct: 948  LDLLLGNLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDI 1007

Query: 940  IVAKQKKNRTELKKNELEMNRASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHL 999
            + AK KK++T +KK   E+ +A K  + +  +  +   E++      E  +  L +    
Sbjct: 1008 LQAKLKKSKTVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKS 1067

Query: 1000 IEVIEDKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRT 1059
            +E I+D+K  L QE E     L +    V +FK+ ++E+   +E+  ++  ++K E  + 
Sbjct: 1068 LESIQDEKINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQL 1127

Query: 1060 DEELNTLKLRDVEQLLQKLDEH-----NLPLESLTDRAVTPSNQCIPEMTVEDHDADMND 1114
             EELN  +LRDV   L  L E      N    + TD   T SN  +    +   DA + +
Sbjct: 1128 LEELNNFRLRDVTHTLDLLREEEGTEANQQPTTGTDE--TTSN--VDNEMLGAADAGVEN 1183

Query: 1115 GEAKLISEDPNSFNDQESMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMD 1174
                 +S      +D+ SMDVD     +  G+P+L++ EL  ID + L  EI QL+ +++
Sbjct: 1184 MNTSSLSNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFIN 1243

Query: 1175 TAYADIDILEEYALRLAEYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISM 1234
                +I+ILEEYA RL E+K+RK+DLN SV +R ++ +  E LKK R  EFM+GF IISM
Sbjct: 1244 NVSINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISM 1303

Query: 1235 TVKEIYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALV 1294
            T+KE+YQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALV
Sbjct: 1304 TLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALV 1363

Query: 1295 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIG 1354
            FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+G
Sbjct: 1364 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG 1423

Query: 1355 IYKSSNMTKSTTLQN 1369
            IYK  NMTK+ T++N
Sbjct: 1424 IYKHENMTKNATIRN 1438

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1217 bits (3150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 683/1380 (49%), Positives = 917/1380 (66%), Gaps = 50/1380 (3%)

Query: 15   TPSKLMFGSPGRKHVASQA---SSNSTTALRGPSLQPPTYSQLSRGRSVYXXXX----XX 67
            TP KL+  S   +   SQ    S++S T    PSLQ P+ S   R    Y          
Sbjct: 70   TPRKLIVSSADHRFTMSQPNLLSADSQT----PSLQHPSVST-GREHKFYSQSPPRSPHR 124

Query: 68   XXXXXXXXXIELIQLSPIKNSRLELQKIYDGKQTT--TKRLSIKNLILNNFKSYAGVQVV 125
                     +ELIQLSPIKN+R ELQK+Y+ +QT   T RL I+ L+L NFKSYAG QVV
Sbjct: 125  SPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAGRQVV 184

Query: 126  GPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVE 185
            GPFH++FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL +LIHKSE +  LS CSVE
Sbjct: 185  GPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSSCSVE 244

Query: 186  ITFQYVMDDADGN-TKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGID 244
            I FQYV+DD +G  +K+    ++L VMRK FKNN+SKYYIN KESS+T+VT  L+NEGID
Sbjct: 245  IHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGID 304

Query: 245  LDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLND 304
            LDHKRFLILQGEVE+IAQMKPK++ EGDDGLLEYLEDIIGT+ YK QI   L +++ LN+
Sbjct: 305  LDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEALNE 364

Query: 305  ICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLD 364
            IC+EKE RF +VEKEK SL  GK +AL+++A                +  + KKL  TL 
Sbjct: 365  ICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLTSTLA 424

Query: 365  KISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVS 424
            KI+   E  + E  KY  + KE+ +L++    L +++ +    + +L+ ++ +   EL+S
Sbjct: 425  KITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNSELIS 484

Query: 425  SEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXX 484
            ++E +K++ +K+  AEK +   EK+I    N +  LN  Q ++                 
Sbjct: 485  TQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEKLKIEKSK 544

Query: 485  XDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQE 544
             + IK+SL+ KT   S E+   EKELEP+  +L+ K SQI+L +SEI ++ E+K  L  E
Sbjct: 545  LEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNENKDNLSNE 604

Query: 545  ISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNH 604
            I  ++K IE  K  +    +KI   +++       + +   E +   KK+ +M+  L +H
Sbjct: 605  IISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLDSH 664

Query: 605  RQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPR 664
            RQ+  D+R +LSNV+NKN VL AL +LQKSGRI GF+GRLGDLG ID+KYD+AIS ACPR
Sbjct: 665  RQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAISTACPR 724

Query: 665  LDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKN 724
            L+D+VV++V+C QQCI++LRKN+LGYARFILLDKL+KFN+ ++ TP+N PRLFDL   + 
Sbjct: 725  LEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLIQVRE 784

Query: 725  EIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGL 784
            + F PA YSVLRDTLVA +L  AN+VAYG RRFRVVTLDGKLIDISGTMSGGG+ V++GL
Sbjct: 785  DKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYVLRGL 844

Query: 785  MKSKQ--RSNDM--YTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDV 840
            MK  Q    ND    + EEVQ++E EL   E NFK+A ++ +EM   +   K++ P  ++
Sbjct: 845  MKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIPATEL 904

Query: 841  EISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDE 900
             ISK  I+I+   +E++     L E +   +    +N  ++  +++L AL  E  +L D+
Sbjct: 905  NISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQ 964

Query: 901  SKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNR 960
            +KV  ++I +LR QIM  GG++L+ QNSKV SL  QL+I+ +KQK +++ +KKN   + +
Sbjct: 965  TKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKKNN-NILK 1023

Query: 961  ASKQKLGAENDINHCEIELSKTNNSHEA--LQEGLRETEHLIEVIEDKKEQLNQEHETAK 1018
              + +L    D N  E + +  N+  +   L E L + E  I   ++ KE++    +  K
Sbjct: 1024 KLQNELNTTKD-NSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNIDGNK 1082

Query: 1019 KNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKL 1078
            +   +       FKS E+E+   L+KLK+L HH++ +I + D ELN L +R++ Q L+  
Sbjct: 1083 EKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTIREISQNLESF 1142

Query: 1079 DEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDG--EAKLISEDPNSFND--QESMD 1134
            DE                        +E +D   N    + +  S   NS ++   ++MD
Sbjct: 1143 DER-----------------------LEKYDISKNGATEDTQHTSSALNSVSNINTDTMD 1179

Query: 1135 VDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYK 1194
            +D   + I PG+ +L+E E++ +DIE L  EI  L+E ++ + A+I+ILEEY  RL+EYK
Sbjct: 1180 IDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYK 1239

Query: 1195 RRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELV 1254
            +RK DL+ES+ ++E  +   E+LKK RLEEF  GF IIS+T+KE+YQMITMGGNAELELV
Sbjct: 1240 KRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELV 1299

Query: 1255 DSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1314
            DSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA
Sbjct: 1300 DSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1359

Query: 1315 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374
            LDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QL+GIYKS NMT+S TL N D+LN
Sbjct: 1360 LDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1193 bits (3087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/1389 (48%), Positives = 908/1389 (65%), Gaps = 54/1389 (3%)

Query: 4    LRTSKKPKHLDTPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYXX 63
            L+ +  P    TP K++  +     ++   S   +++ + PSLQ P+ S  SRGR+V   
Sbjct: 37   LQVANDPLKSYTPMKVIISNNHSNSISPLPSQLMSSSTQPPSLQHPSSS--SRGRAVKAY 94

Query: 64   XXX------XXXXXXXXXXIELIQLSPIKNSRLELQKIYDGKQT-TTKRLSIKNLILNNF 116
                               +ELIQLSPIKNSR ELQKIY  KQ    +R+ +  L+L+NF
Sbjct: 95   SQSPPRSPDRSPVRSPTRKLELIQLSPIKNSRSELQKIYSSKQEEKIERICLNKLVLHNF 154

Query: 117  KSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENH 176
            KSYAG Q +GPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL++LIHKSE +
Sbjct: 155  KSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEY 214

Query: 177  ENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQ 236
             +L+ C+V++ F+Y++D  D  TK+ P  Q L + R+ FKN+TSKYY+NGKES+Y  +T 
Sbjct: 215  PDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITA 274

Query: 237  FLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDAL 296
             L+ EGIDLDH RFLILQGEVE+IAQMKPKA+ EGDDGLLEYLEDIIGT KYK  I    
Sbjct: 275  LLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKF 334

Query: 297  VEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKET 356
            +E++ LNDIC+E+E RF+++++EK SLE+ KE ALE+++              + I +  
Sbjct: 335  IEIEALNDICIERENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNN 394

Query: 357  KKLAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKL 416
             KL+ TL+KI+   ++   E+NK  EL+ +I +LR+L    ++++  +  ++ +LV  K 
Sbjct: 395  IKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKR 454

Query: 417  QLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXX 476
             L  + VS+ E+LK++ +K  K  K ++   K I      ++  ++ +  F         
Sbjct: 455  SLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDN 514

Query: 477  XXXXXXXXXDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKE 536
                     + IK+ L+DKT  +SEE+   EK+LEPW  KL+   S+I++ ESE  + +E
Sbjct: 515  NLVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEE 574

Query: 537  SKLKLEQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVD 596
            SK KL+  I  L KD+       E+ +K++  L  +   ++  +     E   A +KL +
Sbjct: 575  SKNKLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCE 634

Query: 597  MKQVLTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDI 656
            M+++L   RQ+  DAR +LSNVEN++KVL AL +LQKSGRI+GFHGRLG+LG ID+KYD+
Sbjct: 635  MQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDV 694

Query: 657  AISVACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRL 716
            AIS ACPRL+DIVV++VEC QQCIE+LRKN LG+ARFILLDKL KF+M K++TP NVPRL
Sbjct: 695  AISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRL 754

Query: 717  FDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGG 776
            FDL    +E F PA YSVLR+TLVA DL +AN VAYG  R+RVVTL G LIDISGTMSGG
Sbjct: 755  FDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGG 814

Query: 777  GDRVVKGLMK---SKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKD 833
            G++  KG M+   S  +    Y+SEEV  +E EL+ RE N++ A +T QEME  L+  K+
Sbjct: 815  GNQASKGAMQLSNSTSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKE 874

Query: 834  RQPNIDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSE 893
             +P I++EISK   +ID+L +E   K+  L E  ++       +  + +++N L  LN +
Sbjct: 875  SEPKIELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEK 934

Query: 894  LVALKDESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKK 953
               ++ + K K ++I EL+ +IMKIGG+KLQ QNSKVDSL +Q +I++ KQK  +  + K
Sbjct: 935  QKLIESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMK 994

Query: 954  NELEMNRASKQKLGAEND---INHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQL 1010
             E ++ + SK+   +E+D   +N  +I L    N  + ++E L + E+ +  I+DKK  L
Sbjct: 995  IESDVRKLSKKLKESESDNTKLNEKKIALE---NELKNIEELLAQNENNMNCIQDKKFTL 1051

Query: 1011 NQEHETAKKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRD 1070
             ++ E     L +    + +FK+ E+E     EKL +L + IK  +   +E+ ++L +R+
Sbjct: 1052 REKSEITMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIRE 1111

Query: 1071 VEQLLQKLD-----EHNLPLESLTDRAVTPSNQCI-PEMTVEDHDADMNDGEAKLISEDP 1124
            V   L  L+        +  E   D     SN  I  EM +ED++ +             
Sbjct: 1112 VAYDLDLLNIKEQEAQKIKTELYADFEQNQSNDVINDEMIIEDNNNE------------- 1158

Query: 1125 NSFNDQESMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILE 1184
                             I  G+P   E++    DI  L  E+ QL++Y + A  D+DILE
Sbjct: 1159 -----------------IAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILE 1201

Query: 1185 EYALRLAEYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMIT 1244
            EY  R+ EY++RK DLN+SVE+R+++R   E LKK R  EFM+ F IISMT+KE+YQ+IT
Sbjct: 1202 EYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIIT 1261

Query: 1245 MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTP 1304
            MGGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTP
Sbjct: 1262 MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTP 1321

Query: 1305 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKS 1364
            LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+GIYK+ N TKS
Sbjct: 1322 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKS 1381

Query: 1365 TTLQNIDIL 1373
             TL+N DIL
Sbjct: 1382 ATLKNNDIL 1390

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1118 bits (2891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/1375 (46%), Positives = 888/1375 (64%), Gaps = 33/1375 (2%)

Query: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSV--YXXXXXXXXXXX 72
            TP  L+ GS  R  + +  S N    L+ PSL PP     +RGR    Y           
Sbjct: 38   TPRNLL-GSENRNVLPTGGSQN----LQIPSLLPPESLGSARGRDFKSYSQSPPRSPGRS 92

Query: 73   XXXXIELIQLSPIKNSRLELQKIYDGKQTTTK--RLSIKNLILNNFKSYAGVQVVGPFHS 130
                ++LI+LSPIKNSR ELQK+Y+ K+   K  RL I  L+LN+FKSYAG QV+GPFH+
Sbjct: 93   PTRRLKLIELSPIKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHT 152

Query: 131  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQY 190
            SFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   +L  CSVE+ F+Y
Sbjct: 153  SFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKY 212

Query: 191  VMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRF 250
            V+D  DG+T +      L V RK FKNN SKY++NGKES+YTEVT  L+ EGIDLDHKRF
Sbjct: 213  VIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRF 272

Query: 251  LILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKE 310
            LILQGEVE+IAQMK KA+ E DDGLLEYLEDIIGT+KYK  I    +E+++LN+IC+EKE
Sbjct: 273  LILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKE 332

Query: 311  IRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAFT 370
             RF +VE+EK SLE+GKE+AL+F+               +++ ++ KKL   L+K +   
Sbjct: 333  NRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQ 392

Query: 371  EKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLK 430
            ++   + +++ +    I+D+    + L+  + K++ E+  L K K  L+ + V +E+ + 
Sbjct: 393  QEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVN 452

Query: 431  SLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKM 490
            +L+ KR + E+  ++ +  I   +  I+ + E Q+                    + IK+
Sbjct: 453  NLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKL 512

Query: 491  SLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRK 550
             LR+KT  ++ ++A  EKEL PW  + +    +IK+ ESE+ II+E++  LE +I+ L  
Sbjct: 513  KLREKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLEN 572

Query: 551  DIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTD 610
             I S K  +E  +++I  L ++   +       + EC +A+  L ++++ +   RQ+  +
Sbjct: 573  AILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIE 632

Query: 611  ARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVV 670
             R   S  EN NKVL AL RLQKSGR++GFHGRLGDL  ID KYD+AIS ACPRL+D+VV
Sbjct: 633  IRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVV 692

Query: 671  ETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPA 730
            +TVE  QQCIE+LRKNKLGYARFILLDKL  FN  ++ TP+   RLFDL T K + F  A
Sbjct: 693  DTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNA 752

Query: 731  LYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQR 790
             YSVLRDTLV +++ QANRVAYG +R+RVVTLDG LID+SGTM+GGG  V KGLMK  + 
Sbjct: 753  FYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKS 812

Query: 791  SND---MYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKI 847
            S+     ++ EEVQ +E EL  +E  +K A D + EME  L++ +DR P ID  +SK ++
Sbjct: 813  SSKGSAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEM 872

Query: 848  DIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQ 907
            DI+T  +++ S  + L E     E+ +  N P   +  +L  L S+L  +  ++K   ++
Sbjct: 873  DIETAHNDINSNINVLEEKRKKLESMKNQNDPSITLLAKLKELKSKLDDIDVQTKSTKDK 932

Query: 908  ISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLG 967
            I  ++ +I+++GG +L++Q+  V  +T ++     + KK ++   K E  + + +K+   
Sbjct: 933  IKTIKDKIIELGGDELKNQSLLVTDITNKISENSRRLKKIKSNKLKKESLLKKFNKELTE 992

Query: 968  AENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAY 1027
            A  ++ +        +   + ++  L + +  IE +++ + +L  E E     L+     
Sbjct: 993  ANEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKV 1052

Query: 1028 VEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQK-LDEHNLPLE 1086
            V  +KS  +E    LEKL+  E  +K  I R ++ L+ L +RDV Q+L   + E N  ++
Sbjct: 1053 VSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVD 1112

Query: 1087 SLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFN--------DQESMDVDQD 1138
              +D  +  ++  I        +AD +DG    +SE+  SFN        D   M++D  
Sbjct: 1113 K-SDPKLENTSAVI--------NAD-DDG-ISAVSEN-QSFNHNDENDDIDSNKMEIDSQ 1160

Query: 1139 ASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKL 1198
              +I PG+P L+ +EL  +D +E+ L I  L +++ ++ A++D+LEEYALR  E+ +RK 
Sbjct: 1161 GGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYALRFVEFNKRKN 1220

Query: 1199 DLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLD 1258
            DLN +V+ R+ +++R E +K+ R +EFM+GF IISMT+KE+YQMIT+GGNAELELVDSLD
Sbjct: 1221 DLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGNAELELVDSLD 1280

Query: 1259 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1318
            PFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1281 PFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1340

Query: 1319 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDIL 1373
            NVSIVANYIKERTKNAQFIVISLRNNMFEL +QL+GIYK  NMTKS  L N D++
Sbjct: 1341 NVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALVNEDLV 1395

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  266 bits (680), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 342/1331 (25%), Positives = 612/1331 (45%), Gaps = 170/1331 (12%)

Query: 100  QTTTKRLSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRAN 159
            Q+T  RL    L L+NFKSY G+  VG   S+F++++GPNGSGKSN++D++ FV G R+N
Sbjct: 34   QSTMGRLV--GLELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSN 91

Query: 160  KMRQGKLSNLIHKS----ENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVF 215
             +R   L +LI++      N EN+   + +       + A          + + + R + 
Sbjct: 92   HLRSNILKDLIYRGVLDDGNDENIDSGADDNAITSNPNSAYVKAFYQKGNKLVELTRLIS 151

Query: 216  KNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGL 275
            +N  + Y I+GK  +Y + + FL NE I +  K FL+ QG+VE IA   P         L
Sbjct: 152  RNGDTTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPT-------DL 204

Query: 276  LEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIA 335
                E++ G+ +YK +  +   +++ L+    E       +  E ++ + G  +  E+  
Sbjct: 205  SRMFEEVSGSIQYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRK 264

Query: 336  XXXXXXXXXXXXXXWDI-NKETKKLAVTLDKISAFTEKLENERNKYGELQKEITDLRELS 394
                          W + + E KK  +T DK+SA   ++ + + +   +  E   L+   
Sbjct: 265  QVDKKNELQKFQALWKLYHLEQKKEELT-DKLSASNSEIMSLKER---INNETKSLQRSK 320

Query: 395  DNLEEQITKINAEKSQL---VKDKLQLQREL-------VSSEEKLKSLNQKRTKAEKTLQ 444
             +  ++ T I+ +KS+L   VKDK +L  +L        ++  ++  + ++    ++ L+
Sbjct: 321  SSFVKESTVISKQKSKLDYIVKDKEKLMSDLRLIKVPQQAAGRRISHIEKRIGSLQRDLE 380

Query: 445  VAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKM--SLRDK----TSS 498
              E  +   E  ++ + +++  F                    +K   SL +K      S
Sbjct: 381  RQESYVERFETQLKVITKSKKTFEEEIKESARNYDKFKLNESDLKTYDSLHEKYLTQGGS 440

Query: 499  ISEEVASLEK--------ELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRK 550
            I EE  SL          EL+ +  + +    +I     E+ I  E   KL+ +++ LR 
Sbjct: 441  ILEEKISLSNNDKQEIVDELDRFNKRADISKRRIT---EELFITGE---KLDTQLNDLRA 494

Query: 551  DIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTD 610
               S  ++   H +++N+L+K  + I S  +         ++ LV +  +  N R+ M +
Sbjct: 495  ---SLNEKNALHTERLNELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQRETMKE 551

Query: 611  ARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLG-TIDDKYDIAISVACPR-LDDI 668
             ++     EN    +  L R        G  G + DL     +KY +A+S    R  D +
Sbjct: 552  RKLR----EN----IAMLKRF-----FPGVKGLVHDLCHPKKEKYGLAVSTILGRNFDSV 598

Query: 669  VVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEI-F 727
            +VE +  AQ+CI  L+K + G A FI LD ++   +  ++ P++   +  +     E  +
Sbjct: 599  IVENLTVAQECIAFLKKQRAGTASFIPLDTIET-ELPTLSLPDSQDYILSINAIDYEPEY 657

Query: 728  APALYSVLRDTLVAKDLAQANRVAYGTR-RFRVVTLDGKLIDISGTMSGG--GDRVVKGL 784
              A+  V  D+++   L  A  + +    R ++VT++G LI  +G M+GG  GD      
Sbjct: 658  EKAMQYVCGDSIICNTLNIAKDLKWKKGVRAKLVTIEGALIHKAGLMTGGISGD------ 711

Query: 785  MKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISK 844
                  +N+ +  EE Q + + L D+     I  D   E+  + +    R   ++  +S 
Sbjct: 712  ------TNNRWDKEEYQSLMS-LKDK---LLIQID---ELSNSQRSSSIRAREVENSVSL 758

Query: 845  HKIDIDTLSSELQSKKDTLIE--LESTAENNQRDNGPLEDIENQLVALNSELVALKDESK 902
               DI +L +++  +K +L E  LE    N+  DN    +I+ ++  L  +L  L+   K
Sbjct: 759  LNSDIASLRTQVTQQKRSLDENKLEIKYHNDLIDN----EIQPKITELEKKLEHLE---K 811

Query: 903  VKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTEL-KKNELEMNRA 961
             KNE   E  A         LQS+  K    T+++   + + + +  EL ++   E+ + 
Sbjct: 812  TKNELEKEKEA---------LQSEVFK--EFTEKIGFSIKEYESHSGELMRQQSKELQQL 860

Query: 962  SKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNL 1021
             KQ L  EN +      L+ T   +E  Q  L   +  ++ +E+++E    + +  +  L
Sbjct: 861  QKQILTVENKLQFETDRLNTTQRRYEKAQRDLANVQIEMKSLEEQEETTETKIKAIESKL 920

Query: 1022 DDKAAYVE----KFKSEEIEMCTH---LEKLKNLEHHIKAEISRTDEELNTLKLRDVEQL 1074
            ++   +++    KF + + ++ +    LE L N    +K E     E++    L  V  L
Sbjct: 921  EENKMHLDELQKKFIANQSDLNSTEDILEDLNNNLQALKRERDGIKEDIEKFDLERVTAL 980

Query: 1075 LQ-KLDEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESM 1133
               K+   NLP+              + E T++D      D EA  IS +         +
Sbjct: 981  KNCKISNINLPI--------------LSETTIDDLPISSGDSEAISISNN---------I 1017

Query: 1134 DVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEY 1193
            DVD        GLPK  +   ++   +EL  +I +  E ++    +   +E Y     + 
Sbjct: 1018 DVDYQ------GLPKKYKENSNDSARKELEQKITEADEILNELQPNARAVERY-----DE 1066

Query: 1194 KRRKLDL--NESVEKREE---IRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMIT---- 1244
               + D+  NE+ E + E   I N++  +KK R E F   F  +S  +  IY+ +T    
Sbjct: 1067 AEERFDVINNETEELKSEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPN 1126

Query: 1245 -----MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK 1299
                  GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ 
Sbjct: 1127 STVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINS 1186

Query: 1300 YKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLIGIYKS 1358
            Y+P+P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  L+G+Y+ 
Sbjct: 1187 YQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQ 1246

Query: 1359 S--NMTKSTTL 1367
               N +K+ TL
Sbjct: 1247 QQENSSKTVTL 1257

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  264 bits (674), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 339/1340 (25%), Positives = 618/1340 (46%), Gaps = 195/1340 (14%)

Query: 105  RLSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 164
            RLS   L LNNFKSY G+  VG   S+F++++GPNGSGKSN++D++ FV G R++ +R  
Sbjct: 3    RLS--GLELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSN 60

Query: 165  KLSNLIHKSENHENLSFCS-VEITFQYVMDDADGNTKVLPDV------QELSVMRKVFKN 217
             + +LI++   ++N       ++T  YV    + NT    D       + + +MR +  N
Sbjct: 61   IVKDLIYRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERPVELMRAISTN 120

Query: 218  NTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLE 277
              + Y INGK  +Y E ++FL  E I +  K FL+ QG+VE IA   P         L +
Sbjct: 121  GDTTYKINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DLSK 173

Query: 278  YLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXX 337
              E++ G+ +YK +  +   +++ LN    E       +  E ++ + G  +  E+    
Sbjct: 174  LFEEVSGSIQYKKEYDELKEQIEKLNQSAAESIRNRRRIHGELKTYKEGITKDEEYKNNI 233

Query: 338  XXXXXXXXXXXXWDINKETKKLAVTLDKISAFTEKLENERNKYGELQKEITD-----LRE 392
                        W +     +   +LD        L+N +++  +L+ +IT+      R 
Sbjct: 234  EKRKKYYMYLVLWQLYHLENEKKKSLDN-------LKNAKSEISQLKNKITNEEKNLQRS 286

Query: 393  LSDNLEEQITKINAEKSQL---VKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKN 449
             S  L+E + K+N ++ QL   +K+K +L  +L S +   ++ +++    EK ++  +K+
Sbjct: 287  KSSFLKENL-KVNKKREQLNYQLKEKDKLLEDLNSIKIPQRAASKRINNIEKRIESIQKD 345

Query: 450  IRH-------CENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKM--SLRDK----- 495
            I          EN ++ + +A+  F                  D +K+  SL +K     
Sbjct: 346  IERQQGYINTFENQLKVVTKAKESFEREIKESAQNSNKYSLSDDDLKLYESLNEKYLMEN 405

Query: 496  TSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIESY 555
             S+I ++++ L  + +    +++  N +I  ++  I      +L + QE           
Sbjct: 406  GSAIEQQISLLNNDKQEVLEEMDRLNRKIDASKKRIT----EELLISQE----------- 450

Query: 556  KDRIENHKKKINKLEKESAAI----TSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDA 611
              RI+N   ++     E  +I    T  + T Q E +S+  +  D     TN++ R T  
Sbjct: 451  --RIQNENIELVSSLNEKNSIFSEKTHELKTLQAEIESSNNQEYD-----TNYKLRETLL 503

Query: 612  RVALSNVENKNKV--------LGALCRLQKSGRIHGFHGRLGDLGTID-DKYDIAISVAC 662
            ++   N   +  +        +  L R        G  G + DL     DKY +A+S   
Sbjct: 504  KLDDLNANQRESIKEKKLRENVTMLKRF-----FPGVRGLVHDLCRPKKDKYGLAVSTIL 558

Query: 663  PR-LDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTT 721
             +  D I+V+ +  AQ+CI   +K + G A FI LD      ++      N+P   D   
Sbjct: 559  GKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPLD-----TISSEQPTLNLPSSQDYIL 613

Query: 722  PKNEI-----FAPALYSVLRDTLVAKDLAQANRVAYGTR-RFRVVTLDGKLIDISGTMSG 775
              N I     +  A+  V  D+++   L  A  + +    R ++VT++G LI  +G M+G
Sbjct: 614  TINAIEYDPEYERAMQYVCSDSIICNSLDIARDLKWNKGVRSKLVTIEGALIHKAGLMTG 673

Query: 776  GGDRVVKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQ 835
            G  +           SN+ +  EE Q +   L D+           +E+    +    R 
Sbjct: 674  GISK----------DSNNRWDKEEYQSL-MTLKDK------LLLQVEEISTKSRLSSTRA 716

Query: 836  PNIDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELV 895
             ++++E+S       TL++E+ S +  L +++ + + N+ +      + +Q    N +L 
Sbjct: 717  RDVEIELS-------TLNAEISSLRMQLSQVQRSLDENKTEINHQNTLLDQ--QYNPKLK 767

Query: 896  ALKDESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTEL-KKN 954
            +LK++    ++  +EL++   K+       QN     LT ++   + + +++  EL +K 
Sbjct: 768  SLKEKVDEFDKSWNELKSNKEKL-------QNEIFKELTDKVGFTIEEYERHSGELLRKQ 820

Query: 955  ELEMNRASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEH 1014
              E+ +  K+ L  EN +   + E+ +  N+ + L                 +  L + H
Sbjct: 821  SKELQQLQKEILNIENKL---QFEIERLENTQKRLTSA--------------ESNLEKAH 863

Query: 1015 ETAKKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAE---ISRTDE---ELN---- 1064
            ET K    D+    E+ K  E E+ +   +L ++     A+   I+R +E   ELN    
Sbjct: 864  ETLKSLQKDENELAEQVKQIESEINSARNELDSVNKVFTAQQLDINRMEESLGELNDNSQ 923

Query: 1065 TLKLRDVEQLLQKLDEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDP 1124
            TLK R+ +++ + + +++L    +   A   +N  IP ++    + +++D     I ED 
Sbjct: 924  TLK-RNRDEIKEDIAKNDLERIGILKNAKV-TNIDIPVIS----ETNLSDLPIDRIDEDT 977

Query: 1125 NSFNDQESMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILE 1184
             S +++  +DVD  A      LP   + E+ +    EL  +I  +++ +D    +     
Sbjct: 978  ISVSNE--IDVDYTA------LPAKYKEEMGSATKNELDTKIKNVEDLLDVLQPNA---- 1025

Query: 1185 EYALRLAEYKRRKLDLNESVEK-----REEIRNRYEMLKKSRLEEFMDGFGIISMTVKEI 1239
              A R  E + R   ++   EK     R+ ++ ++  +KK R E F + F  +S  +  I
Sbjct: 1026 RAADRFTEAQERFEIIDGETEKIKTTERKALQ-QFLKIKKKRKELFENAFDFVSEHLDNI 1084

Query: 1240 YQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSS 1290
            Y+ +T          GGNA L L D  +PF+ GV +   PP K ++++  LSGGEKT+++
Sbjct: 1085 YRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYHATPPLKRFKDMEYLSGGEKTVAA 1144

Query: 1291 LALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELA 1349
            LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     N QFIVISL+N MFE +
Sbjct: 1145 LALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPNLQFIVISLKNTMFEKS 1204

Query: 1350 QQLIGIYKSS--NMTKSTTL 1367
              L+G+++    N +K  TL
Sbjct: 1205 DALVGVFRQQQENSSKIVTL 1224

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  259 bits (661), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 343/1375 (24%), Positives = 597/1375 (43%), Gaps = 276/1375 (20%)

Query: 111  LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
            L L+NFKSY GV  VG   S+F++++GPNGSGKSN++D++ FV G R+N +R   L +LI
Sbjct: 7    LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 171  HKS-------------------ENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVM 211
            ++                        N     V+  +Q       GN  V        +M
Sbjct: 67   YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQ------KGNKLV-------ELM 113

Query: 212  RKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEG 271
            R + +N  + Y I+GK  SY + + FL NE I +  K FL+ QG+VE IA   P      
Sbjct: 114  RIISRNGDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSPIE---- 169

Query: 272  DDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQAL 331
               L +  E++ G+ +YK +  +   +++ L     E       +  E ++ + G  +  
Sbjct: 170  ---LSKMFEEVSGSIQYKKEYDELKEKIEKLGKSATESIKNRRRIHGELKTYKEGINKNE 226

Query: 332  EFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAFTEKLENERNKYGELQKEITDLR 391
            E+I               W +    ++    +DK+SA   ++ + + K   +  E+  L+
Sbjct: 227  EYIKQVDKKNELQRFQALWQLYHLEQQKEELMDKLSASNSEVSSLKEK---INNEMKSLQ 283

Query: 392  ELSDNLEEQITKINAEKSQL---VKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQVAEK 448
                +  ++ T I+ +KS+L   VKDK +L  +L   +   ++  ++ +  EK ++  ++
Sbjct: 284  RSKSSFVKEGTIISKQKSKLEYIVKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQR 343

Query: 449  NIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRD-------------K 495
            ++   E  + R                          +  K++  D             +
Sbjct: 344  DLGRQEAYVERFETQLKVVTKSKKTFEEEIKESARNYEKFKLNENDLKTYDLLHEKYLTQ 403

Query: 496  TSSISEEVASLEK--------ELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQ 547
              S+ EE  SL          EL+ +  + +    +I     E+LI  E   KL+ +++ 
Sbjct: 404  GGSVLEEKISLSNNHKQEILDELDRFNKRADISKRRIT---EELLITGE---KLDTQLND 457

Query: 548  LRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQR 607
            LR    S  ++   H +++N+L+K  + I S  +         ++ LV +  +  N R+ 
Sbjct: 458  LRA---SLNEKNALHTERLNQLKKLQSDIESANNKEYDLNFKLRETLVKIDDLSANQRET 514

Query: 608  MTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLG-TIDDKYDIAISVACPR-L 665
            M + ++     EN    +  L R        G  G + DL     +KY +A+S    R  
Sbjct: 515  MKERKLR----EN----IAMLKRF-----FPGVKGLVHDLCHPKKEKYGLAVSTILGRNF 561

Query: 666  DDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTT-PKN 724
            D ++VE +  AQ+CI  L+K + G A FI LD ++  ++  ++ P++   +  +     +
Sbjct: 562  DSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-DLPTLSLPDSQDYILSINAIDYD 620

Query: 725  EIFAPALYSVLRDTLVAKDLAQANRVAYG-TRRFRVVTLDGKLIDISGTMSGG--GDRVV 781
              +  A+  V  D+++   L  A  + +  + R ++VT++G LI  +G M+GG  GD   
Sbjct: 621  SEYEKAMQYVCGDSIICNTLNIAKDLKWKKSVRAKLVTIEGALIHKAGLMTGGISGD--- 677

Query: 782  KGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVE 841
                     +N+ +  EE Q                          L   KD        
Sbjct: 678  ---------ANNRWDKEEYQ-------------------------GLMSLKD-------- 695

Query: 842  ISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNG-PLEDIENQLVALNSELVALKDE 900
              K  I ID LS                  N+QR N     ++EN +  LNS++ +L+ +
Sbjct: 696  --KLLIQIDELS------------------NSQRSNSIRAREVENSVSLLNSDIASLRTQ 735

Query: 901  SKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNR 960
               +   + E          L+++  N  ++   Q  +I   ++K    E  +N+LE   
Sbjct: 736  VTQQKRSLDE--------NNLEIKYHNDLIEKEIQP-KITELEEKLKNLENTRNDLE--- 783

Query: 961  ASKQKLGAENDINHC---EIELS---KTNNSHEALQEGLRETEHL---IEVIEDK----K 1007
              K+K   +NDI      +I  S     N+S E +++  RE + L   I  +E+K    K
Sbjct: 784  --KEKEALQNDIFKKFTDKIGFSIKEYENHSGELMRQQSRELQQLQKQILTVENKLQFEK 841

Query: 1008 EQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLK 1067
            ++LN      +K  +D        KS +IEM       K+LE           EE   +K
Sbjct: 842  DRLNTTQRRYEKAQND-------LKSAQIEM-------KSLEEQ---------EEAAEMK 878

Query: 1068 LRDVEQLLQKLDEHNLPLESLTDR-AVTPSNQCIPEMTVEDHDADMN------DGEAKLI 1120
            ++ +E    KL+E+ + LE L  +     S+    E  +ED ++++       DG    I
Sbjct: 879  IKSLES---KLEENKIHLEGLQRKFTAKQSDLNSNEDVLEDMNSNLQILKRERDG----I 931

Query: 1121 SEDPNSFNDQESMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADI 1180
             ED   F D E +   ++       LP L+E  +D++ I     E   +   +D  Y  +
Sbjct: 932  KEDTEKF-DLERVTALKNCKISNINLPILSETTIDDLPIASGDSEAISISNKIDVDYKGL 990

Query: 1181 DILEEYALRLAEYKRRKLD---------LNE------SVEKREEIRNRYEML-------- 1217
               ++Y     +  ++ LD         LNE      + E+ +E   R+E++        
Sbjct: 991  P--KKYKESNTDSAKKGLDEKIREVEEILNELQPNARAEERYDEAEERFEVINNETEELK 1048

Query: 1218 -------------KKSRLEEFMDGFGIISMTVKEIYQMIT---------MGGNAELELVD 1255
                         K+ R E F   F  +S  +  IY+ +T          GGNA L + D
Sbjct: 1049 AEEKKILSQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIED 1108

Query: 1256 SLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1315
              +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAAL
Sbjct: 1109 EDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAAL 1168

Query: 1316 DFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLIGIYKSS--NMTKSTTL 1367
            D  NV  +A YI + R  + QFIVISL+N MFE +  L+G+Y+    N +K+ TL
Sbjct: 1169 DITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTITL 1223

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  252 bits (644), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 342/1324 (25%), Positives = 615/1324 (46%), Gaps = 176/1324 (13%)

Query: 111  LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
            L L+NFKSY G+  VG   S+F++++GPNGSGKSN++D++ FV G R+N +R   L +LI
Sbjct: 7    LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 171  HKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQE----LSVMRKVFKNNTSKYYING 226
            ++   +++      + +   V      +  V    Q+    + +MR + +N  + Y I+ 
Sbjct: 67   YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGDTSYKIDE 126

Query: 227  KESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTA 286
            K  SY + + FL NE I +  K FL+ QG+VE IA   P         L    E++ G+ 
Sbjct: 127  KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSRMFEEVSGSI 179

Query: 287  KYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXX 346
            +YK +  +   +++ L+    E       +  E ++ + G  +  E+             
Sbjct: 180  QYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQVEKKSELQKF 239

Query: 347  XXXWDI-----NKE--TKKLAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEE 399
               W +      KE  T KL+ +  +IS+  EK+ +E      LQ+  +   + S  + +
Sbjct: 240  QALWQLYHLEQQKEELTDKLSASNSEISSLKEKINHE---MKSLQRSKSSFVKESAVISK 296

Query: 400  QITKIN---AEKSQLVKD----KLQLQ---RELVSSEEKLKSLNQ--KRTKA-----EKT 442
            Q +K+N    +K +LV D    K+  Q   + ++  E++++SL +  +R KA     E  
Sbjct: 297  QKSKLNYIIKDKEKLVSDLRLIKVPQQAAGKRVLHIEKRIESLQRDLQRQKAYVERFETQ 356

Query: 443  LQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKTSSISEE 502
            L+V  K+ +  E  I+       +F                        L +K +  + +
Sbjct: 357  LKVVTKSKKTFEEEIKESARNYDKFKLNENDLETYNCLHEKYLTENGSILEEKIALYNND 416

Query: 503  VASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIESYKDRIENH 562
               +++EL+ +  + +    +I     E+ +  E   KL+ +++ LR    S  ++   H
Sbjct: 417  KQEIQEELDRFNKRADISKRRIT---EELSVTGE---KLDTQLNDLRA---SLNEKNAVH 467

Query: 563  KKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDARVALSNVENKN 622
             +++++L+K  + I S  +         ++ LV +  +  N R+ M + ++     EN  
Sbjct: 468  TERLHELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQRETMKERKLR----EN-- 521

Query: 623  KVLGALCRLQKSGRIHGFHGRLGDLG-TIDDKYDIAISVACPR-LDDIVVETVECAQQCI 680
              +  L R        G  G + DL     +KY +A+S    +  D ++VE +  AQ+CI
Sbjct: 522  --IAMLKRF-----FPGVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECI 574

Query: 681  EHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEI-FAPALYSVLRDTL 739
              L+K + G A FI LD ++   +  ++ P++   +  +     E  +  A+  V  D++
Sbjct: 575  AFLKKQRAGTASFIPLDTIET-ELPTLSLPDSQEYILSINAIDYEPEYEKAMQYVCGDSI 633

Query: 740  VAKDLAQANRVAYGTR-RFRVVTLDGKLIDISGTMSGG--GDRVVKGLMKSKQRSNDMYT 796
            +   L  A  + +    R ++VT++G LI  +G M+GG  GD            +N+ + 
Sbjct: 634  ICNSLKIAKGLKWNKGVRAKLVTIEGALIHKAGLMTGGISGD------------ANNRWD 681

Query: 797  SEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDTLSSEL 856
             EE Q + + L D+     +  D   E+  + +    R   ++  +S    DI +L +++
Sbjct: 682  KEEYQSLMS-LKDK---LLVQID---ELSNSQRSNSIRAREVENSVSLLNSDIASLRTQV 734

Query: 857  QSKKDTLIE--LESTAENN--QRDNGP-LEDIENQLVALNSELVALKDESKV-KNEQISE 910
              +K +L E  LE    N+  +++  P + ++E +L  L +    L+ E ++ +N+   E
Sbjct: 735  TQQKRSLDENNLEIKYHNDLLEKEIQPKITELEKKLDDLENTKNGLEKEKEILQNDIFKE 794

Query: 911  LRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELE---MNRASKQKLG 967
              +   KIG    + +N   + + QQ + +   QK+  T   K + E   +N   ++   
Sbjct: 795  FTS---KIGFSIKEYENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLNTTQRRYEK 851

Query: 968  AENDINHCEIELSKTNNSHEALQEGLRETEHLIEV-IEDKKEQL--NQEH--ETAKKNLD 1022
            A  D+   ++E+S            L E EH IE+ IE    +L  N+ H  E  KK + 
Sbjct: 852  ARKDLEKAQVEMS-----------SLEEQEHAIEMKIESIGSKLEENKNHLVELEKKLVT 900

Query: 1023 DKAAYVEKFKSEEI--EMCTHLEKLKNLEHHIKAEISRTD-EELNTLKLRDVEQLLQKLD 1079
             ++   +   SE+I  +M ++L+ LK     IK ++ + D E++  LK   +  +     
Sbjct: 901  KQS---DLNSSEDILEDMNSNLQVLKRERDGIKEDVEKNDLEKVTALKNCKISNI----- 952

Query: 1080 EHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDA 1139
              NLP+ S T              T++D      D +A  IS          S+ VD   
Sbjct: 953  --NLPILSQT--------------TLDDFPISSRDSDAITIS---------NSIVVDY-- 985

Query: 1140 SYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLD 1199
                 GLPK  +    +    EL  +I +++E ++    +   +E Y     E + R   
Sbjct: 986  ----KGLPKKYKENNSDSAKRELEQKIREIEEILNELQPNARAVERY----DEAEGRFEV 1037

Query: 1200 LNESVE--KREE--IRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMIT---------MG 1246
            +N   E  K EE  I N++  +K+ R E F   F  +S  +  IY+ +T          G
Sbjct: 1038 INNETEQLKTEEKKILNQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAG 1097

Query: 1247 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1306
            GNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +
Sbjct: 1098 GNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFF 1157

Query: 1307 VMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLIGIYKSS--NMTK 1363
            V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  L+G+Y+    N +K
Sbjct: 1158 VLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSK 1217

Query: 1364 STTL 1367
              TL
Sbjct: 1218 IITL 1221

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  249 bits (637), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 355/1368 (25%), Positives = 598/1368 (43%), Gaps = 269/1368 (19%)

Query: 111  LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
            L L NFKSY G   +G   S+F++++GPNGSGKSN++D++ FV G R++ +R   L +LI
Sbjct: 7    LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 171  HK-------SENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYY 223
            ++       SE+ E+ S  +    +     + +  T        + +MR + +N  + Y 
Sbjct: 67   YRGVITGEDSESDEDGSVNNPSTAYVKAFYEKENKT--------IELMRTISRNGDTNYK 118

Query: 224  INGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDII 283
            I GK  SY + + FL +E I +  K FL+ QG+VE IA   P         L    E++ 
Sbjct: 119  IGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSPM-------DLSRLFEEVS 171

Query: 284  GTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXX 343
            G+ +YK +      +M+ L+    E       +  E ++ + G  +  E+ +        
Sbjct: 172  GSIQYKKEYDQLKEKMEQLSKAATESIKNRRRIHGELKTYKEGINKDEEYKSKVAKKKEL 231

Query: 344  XXXXXXWDI-NKETKK------LAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDN 396
                  W + + E KK      +A T  K+S   +K+ NE                   N
Sbjct: 232  QTILVLWQLYHLEQKKINIMKNMADTKSKMSVLKDKIHNEER-----------------N 274

Query: 397  LEEQITKINAEKSQLVKDKLQL-----QRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIR 451
            L+   T I  E S + K K ++     ++E ++S+ KL  L Q  T   K +   EK I 
Sbjct: 275  LQRAKTSIAKEMSIITKKKDKIDYKLKEKEKIASDLKLIKLPQLSTI--KRIGNIEKRIE 332

Query: 452  HCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKTSSISEEVASLEKELE 511
              E +I R +     F                      M+  DK     EE  + +   E
Sbjct: 333  SFEKDIERQSSFVERFTNQLKVVTKTKEAFERELKETSMNF-DKYRLNDEEKENYQSLNE 391

Query: 512  PWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIESYKDRI--------ENHK 563
             + T   +  S I   E +I+I +  K ++ +E+++  K I+  K RI        EN++
Sbjct: 392  KYLT---SGGSSI---EEKIMINENDKQEVGEELNRFEKLIDISKQRINDVLMVELENNQ 445

Query: 564  KKINKLE--------------KESAAITSFISTAQG-ECD---SAKKKLVDMKQVLTNHR 605
             + ++L               KE   + S I +A   E D     ++ LV +  +  N R
Sbjct: 446  LRASELTTLLNEKNSIHAERLKELKGLQSDIESASNQEYDLNYKLRETLVQIDDLSANQR 505

Query: 606  QRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLG-TIDDKYDIAISVACPR 664
            + M + ++     EN    +  L RL       G  G + DL     DKY +A+S    R
Sbjct: 506  ESMKERKLR----EN----VAMLKRL-----FPGVKGLVYDLCHPKKDKYSLAVSTCLGR 552

Query: 665  -LDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPK 723
              D ++V+    AQ+CI +L+K + G A FI L+          T    +P L  ++  +
Sbjct: 553  NFDSVIVDNASVAQECIAYLKKQRAGSASFIPLE----------TIDSEIPTL-SVSNSQ 601

Query: 724  NEIFA-------P----ALYSVLRDTLVAKDLAQANRVAY--GTRRFRVVTLDGKLIDIS 770
              I A       P    A+  V  DT++   L  A R+ +  G +  ++VTL+G LI  +
Sbjct: 602  GCILAINAIEYDPRYERAMQYVCSDTIICDTLVIAKRLKWVEGVKA-KLVTLEGALIHKA 660

Query: 771  GTMSGGGDRVVKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQK 830
            G M+GG  +           SN+ +  EE Q +   L D+  +     +  Q+  A+  K
Sbjct: 661  GLMTGGVSK----------DSNNRWDKEEYQSL-MNLKDKLIH--QIEEVSQQGRASSMK 707

Query: 831  YKDRQPNIDV---EISKHKIDIDTLS-------------------------SELQSKKDT 862
             +D + N+ V   EIS  +I +  ++                         SEL  KK+ 
Sbjct: 708  ARDLENNLSVLNTEISNVRIQLTQITRLIDENKIELGYQNRLINEEYSPKMSELNKKKNN 767

Query: 863  LIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISELRAQIMKIGGLK 922
               LE +  N Q D   L+DI   + A  +E V       VK  +      +IM+  G  
Sbjct: 768  ---LEISISNLQTDKEKLQDI---IFAEFTERVGF----TVK--EYESHSGEIMRKQGKD 815

Query: 923  LQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAENDINHCEIELSKT 982
            LQ   +++ ++  +LQ             ++  L   +   QK  A++D+    IEL   
Sbjct: 816  LQRLQNEILNVENKLQ------------FEQERLFTTKKRSQK--AKSDLEKANIELKDL 861

Query: 983  NNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTHL 1042
                ++LQE ++    +IEV            E                +SEE      L
Sbjct: 862  ETEEKSLQERIK----IIEV------------EVGS-------------QSEE------L 886

Query: 1043 EKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKL------DEHNLPLESLTD-RAVTP 1095
            ++L+N+ +  + +++ TDE LN L++    QL ++       D   L LE ++  +    
Sbjct: 887  DELQNIFNAKQRDLNTTDENLNELQMN--MQLCKRQKNEFTEDVEKLDLERISILKNCKI 944

Query: 1096 SNQCIPEMT---VEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPGLP-KLTE 1151
            SN  IP ++   + D      D EAK      N FN   S+D++ +       LP K  E
Sbjct: 945  SNVSIPLLSSTGLADLPLTSLDDEAK------NIFN---SIDIEYEK------LPAKFKE 989

Query: 1152 AELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKREEIR 1211
            +   ++  ++L  E+ +++E ++    +   +E +      ++    +      +  +I 
Sbjct: 990  SGAFSLK-QQLDTEMKEVEEALNVLQPNARAVERFDDAQERFEVVDTETETLKTEERKIL 1048

Query: 1212 NRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITM---------GGNAELELVDSLDPFSE 1262
             ++  +KK R E F   F  ++  +  IY+ +T          GGNA L L D  +PF+ 
Sbjct: 1049 AQFLKIKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNA 1108

Query: 1263 GVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1322
            G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  
Sbjct: 1109 GIRYHATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVER 1168

Query: 1323 VANYIKER-TKNAQFIVISLRNNMFELAQQLIGIYKSS--NMTKSTTL 1367
            +A YI+     N QFIVISL+N MFE +  L+G+Y+    N +K  TL
Sbjct: 1169 IAAYIRRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  247 bits (630), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 341/1341 (25%), Positives = 593/1341 (44%), Gaps = 220/1341 (16%)

Query: 111  LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
            L LNNFKSY G   VG  +  F ++VGPNGSGKSN++D++ FV G R+N +R   L +LI
Sbjct: 7    LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 171  HK------SENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYI 224
            ++      S+ H      +    F    D+ +  TK+         MR +     S Y I
Sbjct: 67   YRGRMDDRSDEHVASPKSAYVKAFYLKDDNGEQGTKI-------EFMRIIQNTGDSVYRI 119

Query: 225  NGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIG 284
            +GK  S+    ++L  E I +  + FL+ QG+VE IA        +    L +  E + G
Sbjct: 120  DGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQVSG 172

Query: 285  TAKY-------KSQIRDALVEM-DTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAX 336
            + +Y       K + + A  E  D+L     +++++ +L     +S + G  +   +   
Sbjct: 173  SVQYQREYERLKEEYQKATEEYGDSLKS---KRKMQIDL-----KSFKEGVHKEQHYKNL 224

Query: 337  XXXXXXXXXXXXXWDINKETKKLAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDN 396
                         W       +L    D+ S     L++ ++K  +L+ ++T+       
Sbjct: 225  LSERTKLNRQYVLW-------QLYHLEDRRSGLISSLKDSKSKLAQLKSKLTN------- 270

Query: 397  LEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTL-------QVAEKN 449
             EE I  ++  KSQ  KD++ + R+    +EKL  L Q+R+K    L       Q A K 
Sbjct: 271  -EEHI--LHKSKSQAAKDEIVITRK----KEKLSQLQQERSKLNSELLPVGSSRQSASKR 323

Query: 450  IRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKTS---SISEEV--- 503
            I H E  I  L    T                    D++++ ++  +S   ++S+E    
Sbjct: 324  INHIEKRIDSLKRDITRQESYVQQFQNQLKVVTKAKDSLEIDIKASSSGKFNLSKEQLKE 383

Query: 504  -------------ASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRK 550
                         ++LE+++     K E    +I L E    I K S++ +E  + + + 
Sbjct: 384  YESLKETYLCSGGSALEEKMTLLQNKREELLEEISLYERRANISK-SRISVELNVEREKL 442

Query: 551  DIE-SYKDRIENHKKKINKLE-KESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRM 608
            ++E S   R+ N K  ++  + KE   + S I +A  +      KL   K+VL       
Sbjct: 443  ELELSEVTRVLNSKNALHSAKVKEWKEVQSAIESANNKEYELNYKL---KEVLVKLDDLT 499

Query: 609  TDARVALSNVENK-NKVLGALCRLQKSGRIHGFHGRLGDLGTID-DKYDIAISVACPR-L 665
             D R   SN E K  + +  L RL       G  G + DL     DKY +A+S    +  
Sbjct: 500  ADQRE--SNKERKLRENVATLKRL-----FPGVKGLVHDLCRPKKDKYALAVSSMLGKNF 552

Query: 666  DDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNE 725
            D IVV++V  AQQCI +L+K++ G A FI LD +   ++   T P  V  L       N 
Sbjct: 553  DSIVVDSVSVAQQCISYLKKHRSGAASFIPLDTI---DINTPTLP--VRNLKGCILTVNA 607

Query: 726  I-----FAPALYSVLRDTLVAKDLAQANRVAYGTR-RFRVVTLDGKLIDISGTMSGGGDR 779
            I        A+  V  D+++   L  A  + +    + ++VT+ G LI  +G M+GG  R
Sbjct: 608  IEYDSELEKAMQYVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGALIHRAGLMTGGVGR 667

Query: 780  VVKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQE----MEAALQKYKDRQ 835
                     +  + +   E+V    +EL        + +  F+     + + L   + + 
Sbjct: 668  NNTNRWDKAEYQSLLLLKEKVSGQISELVTSIRQNSVLSRGFENELSLLNSELVTLRTQL 727

Query: 836  PNIDVEISKHKIDI----DTLSSELQSK----KDTLIELESTAENNQRDNGPLE-----D 882
              I+  I + K++I    D ++SE   K     +++ EL+    N  ++   L+     D
Sbjct: 728  VQINRLIEEKKVEINYHEDLINSEYSPKISALNNSMKELDEQLSNISKNKETLQGSIYKD 787

Query: 883  IENQLVALNSELVALKDES-KVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIV 941
              N++    +E      E+ +  + ++ +L+ QIM I         +K++  T++LQ   
Sbjct: 788  FANKVGFTIAEYEEHTGETLREHSRELQQLQKQIMTI--------ENKLEFETERLQGTR 839

Query: 942  AKQKKNRTELKKNELEMNRASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIE 1001
             + +K   +L+K + E     +Q+   ++ I   + ++S+ N   E LQE  R+    ++
Sbjct: 840  VRHEKTIGDLEKVKQETESLEEQESKIQSQIEQVDSQISQHNEEIEHLQEASRKKYQSVK 899

Query: 1002 VIEDKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDE 1061
             +E+    LN+  +T+K+ +D     +EK         T +E++ NL  + K     T+ 
Sbjct: 900  ALEEIANDLNEMVQTSKREVDQLKDDIEK---------TGIERV-NLFKNCKM----TNV 945

Query: 1062 ELNTLKLRDVEQLLQKLDEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLIS 1121
            EL T K          LDE  LP+E +   A+  +N                      I+
Sbjct: 946  ELPTDK--------STLDE--LPIERIDSEAIEMANS---------------------IT 974

Query: 1122 EDPNSFNDQESMDVDQDASYIGPGLPKLTEAEL-DNI-DIEELALEI---AQLKEYMDTA 1176
             D +S           D  Y   G   LT  E  D+I DIE    E+   ++  E  D A
Sbjct: 975  VDYSSL----------DNKYKESG-SNLTREEFEDSIKDIENTLRELQPNSKAVERFDEA 1023

Query: 1177 YADIDILEEYALRLAEYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTV 1236
                 +  + + +L E +R             E + +Y  +K+ R++ F+  F  ++  +
Sbjct: 1024 KEQFSVAIDESEKLKEIER-------------ESKEKYLKIKEKRVKTFLSCFQHVTDHI 1070

Query: 1237 KEIYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKT 1287
              IY+ +T          GG+A L L D  +P+  G+ +   PP K ++++  LSGGEKT
Sbjct: 1071 DRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYHATPPMKRFKDMDYLSGGEKT 1130

Query: 1288 LSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMF 1346
            +++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YIK   +   QFIVISL++N+F
Sbjct: 1131 MAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIKRHASPKFQFIVISLKSNLF 1190

Query: 1347 ELAQQLIGIYKSSNMTKSTTL 1367
              +Q + G++++     S  +
Sbjct: 1191 GKSQSMAGVFRNQQANSSMVI 1211

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  238 bits (608), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 326/1356 (24%), Positives = 602/1356 (44%), Gaps = 216/1356 (15%)

Query: 111  LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
            L L+NFKSY     VG   S F++++GPNGSGKSN++D++ FV G R+N++R   L +LI
Sbjct: 7    LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 171  ------------------HKSE-----NHENLSFC-----SVEITFQYVMDDADGNTKVL 202
                              H+S+       EN ++      S  ++  Y  DD D  TK  
Sbjct: 67   YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTKF- 125

Query: 203  PDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQ 262
                     R +  +  S Y IN +  SY +  + L +E I +  K FL+ QG+VE IA 
Sbjct: 126  --------TRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIAS 177

Query: 263  MKPKADHEGDDGLLEYLEDIIGTAKYKSQIRD-------ALVEMDTLNDICMEKEIRFEL 315
              P++       L   LE + G+  YK+           AL E    ++    K+++ +L
Sbjct: 178  QGPES-------LTLLLEQVSGSINYKNDYEKLKEEHKLALAEFTDAHN--SRKKVQNDL 228

Query: 316  VEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAFTEKLEN 375
                 +S + G ++  ++                W++    K+    +D ++    +   
Sbjct: 229  -----KSFKEGVQRDEQYRTSLEIRDQLKHNFILWELFHILKRRKKLVDSLTVSKTETTA 283

Query: 376  ERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQREL--VSSE-----EK 428
             +NK  + ++ +T ++  +   E Q++K+     QL  +K  LQ  L  V SE     ++
Sbjct: 284  LKNKLSDEERILTKIKSTTAKHELQLSKLKDTLVQLENEKTSLQSSLLPVGSERLATIKR 343

Query: 429  LKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAI 488
            + +L ++ +  +K ++  +  ++  EN ++ +++ +  F                  + +
Sbjct: 344  IHNLEKRISSFKKDMERQQAYVKQFENQLKVVSKTKKSFEKELENIHANLNKFNLSEEDL 403

Query: 489  KMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQL 548
            K     K   +S   + +E++L         KN + +L E   LI K  K   E+   +L
Sbjct: 404  KQYELLKEKYLSSGGSHIEEKLAIL------KNDEFELNEESELINKRLKTTRERISDEL 457

Query: 549  RKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRM 608
            + D+++ +  +    +++N     +AA +      Q   +S K K  ++   L +   ++
Sbjct: 458  QVDVDALEADLNEVTQRLNDKNSIAAAKSKEWKGIQTNLESLKNKEYELNFSLRDVLLKI 517

Query: 609  TDARVALSNVENKNKVLGALCRLQKSGRIH-GFHGRLGDLG-TIDDKYDIAISVACPR-L 665
             D        + + K+   +  L+   R++ G  G + DL     +KY IA+S    +  
Sbjct: 518  DDLNADQRETKKERKLRENVSMLK---RLYPGVKGLVHDLCHPKKEKYAIAVSTILGKNF 574

Query: 666  DDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPR------LFDL 719
            D I+V+++  A +CI +L+K + G A FI LD +          P ++P       L  +
Sbjct: 575  DSIIVDSIATAHECITYLKKQRAGSASFIPLDTID-------VNPPSLPVSNVQGCLLTI 627

Query: 720  TTPKNEIF-APALYSVLRDTLVAKDLAQANRVAYGTR-RFRVVTLDGKLIDISGTMSGGG 777
               + E +   A+  V  D+++  +L  A  + +    + ++VTL+G LI  +G M+GG 
Sbjct: 628  NAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIHKAGQMTGG- 686

Query: 778  DRVVKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYK-DRQP 836
                     + Q++ + +  +E Q +   L D+ T         +E+ A   K++ D   
Sbjct: 687  ---------TAQKNQNRWNKDEYQGLMV-LKDQIT---------EELTALSDKFRADNMK 727

Query: 837  NIDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVA 896
            + ++E      +I  L++E+ S +  + +LE T              +N  +  N +L+ 
Sbjct: 728  SRELEN-----EISLLNNEISSLRTQITQLERTLSG-----------KNVEIKHNEDLIT 771

Query: 897  LKDESKVKN--EQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTE-LKK 953
             + E ++K+  ++I EL++++ K+   K   Q       T +    +   ++   E ++K
Sbjct: 772  TEYEPQLKSFTQRIEELKSKLTKLESEKDVLQEQIFRPFTDKYGFSIKDYEQGTGEIMRK 831

Query: 954  NELEMNRASKQKLGAENDINHCEIELSKTNNSH-----------EALQEGLRETEHLIEV 1002
            +  E+ +  KQ L  EN +   +  L  T   H           EAL    ++ + + E 
Sbjct: 832  HSKELQQFQKQILTIENKLEFEKDRLGATAARHTKALSDMDKLKEALGSLEKQEDIITEK 891

Query: 1003 IEDKKEQLNQEHETA---KKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRT 1059
            I++   +++QE +     +K LD+K   +  F S   E+ + ++  +     IK      
Sbjct: 892  IKNADSKISQEQQLVAIQQKELDEKVHNLISFDSNIAEIQSSMQAARRKVDEIK------ 945

Query: 1060 DEELNTLKLRDVEQL--LQKLDEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEA 1117
             E++ TL   D+EQL  L+     N+ L  L             + ++ED   D+ D   
Sbjct: 946  -EDIETL---DLEQLGILKNCKVSNIELPLL-------------DSSLEDISIDVLDSN- 987

Query: 1118 KLISEDPNSFNDQESMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAY 1177
                          +  +  D  Y    LP+           EE   EI +++E      
Sbjct: 988  --------------NTGIISDLEYDFTSLPEKYRLNDGEEVKEEFESEIKKVEE------ 1027

Query: 1178 ADIDILEEYALRLAEYKRRKLDLNESVEKREEIRNR-------YEMLKKSRLEEFMDGFG 1230
              ++IL+  +  +  Y   K  L++   + E +RN+       +  +K  R E F   F 
Sbjct: 1028 -KLEILQPNSKAVQRYDETKHKLDQVSNENERLRNKERKAKEKFLEVKAKRKELFEACFK 1086

Query: 1231 IISMTVKEIYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNL 1281
             +   + +IY+ +T          GGNA L + +  +P+  G+ +   PP K ++++  L
Sbjct: 1087 HVDKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYFATPPLKRFKDMEYL 1146

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK-NAQFIVIS 1340
            SGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YIK     NAQFIVIS
Sbjct: 1147 SGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQFIVIS 1206

Query: 1341 LRNNMFELAQQLIGIYK-----SSNMTKSTTLQNID 1371
            L+N MFE +Q L+GI++     SS M  S  L+N D
Sbjct: 1207 LKNAMFEKSQSLVGIFREQEDNSSRMV-SLNLENYD 1241

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  236 bits (602), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 318/1319 (24%), Positives = 589/1319 (44%), Gaps = 171/1319 (12%)

Query: 111  LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
            L L NFKSY G   V    S+F++++GPNGSGKSN++D++ FV G R++ +R   L +LI
Sbjct: 7    LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 171  HKSENHENLSFCSVEITFQYVMDDADGNTKVLP------DVQELSVMRKVFKNNTSKYYI 224
            ++          S E T     +D +GN           D + + +MR + +   + Y +
Sbjct: 67   YR-------DIISRENTPTGADNDENGNRTAYVKAFYEYDGKVVELMRLISRLGDTSYKL 119

Query: 225  NGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIG 284
            +G   +Y E +QFL ++ I +  K FL+ QG+VE IA   P        GL + +E++ G
Sbjct: 120  DGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GLTKLIEEVSG 172

Query: 285  TAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXX 344
            + +YK +  +   + D +     E   +   +  E ++ + G  +  E+           
Sbjct: 173  SMQYKKEYEELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSRDEEYRKYVQKKKRVQ 232

Query: 345  XXXXXWDI-------NKETKKLAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDNL 397
                 W +        +  +KL  + + +    EKLE E       +K ++    L    
Sbjct: 233  TNLSLWQLYHMEDERYQCLQKLEESQNDVDVIREKLEAEEKNLEVFKKALSKEAVLLTKK 292

Query: 398  EEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNI 457
            +  I  I+ EK +   D   ++    +S  +LK+L+++    +K L+  E N+   ++ +
Sbjct: 293  KNHIRSISKEKEKAESDLKVVKIPQNASINRLKNLDKRVDSLQKDLEREEANLEKYKHQL 352

Query: 458  RRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKM-------SLRDKTSSISEEVASLEKEL 510
            + + +++  F                  D +K+        L +    I + +  L+ + 
Sbjct: 353  KVVTDSKNAFEQEILSKSKNNNKFTLSEDDLKLYDELKGEYLNNGGIEIEDTLNLLDNKK 412

Query: 511  EPWTTKLEAKNSQIKLAESEILIIKESKL--KLEQEISQLRKDIESYKDRIENHKKKINK 568
            E  T  L+  N ++++++  I    E +L  K E++ +++R       ++ + H  K+++
Sbjct: 413  EEITADLKIINDKVEISKQRI----EDELVTKKEEQDAKIRDSTLLLNEKNDLHSHKLDE 468

Query: 569  LEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDARVALSNVENKNKVLGAL 628
            L K            Q + +    K  D+   L +   ++ D          + K+   +
Sbjct: 469  LRK-----------TQKDIEYWNNKEFDLNHKLRDTLVKLDDLNATQRESNKERKLRENV 517

Query: 629  CRLQKSGRIHGFHGRLGDLGTID-DKYDIAISVACPR-LDDIVVETVECAQQCIEHLRKN 686
              L++     G  G + +L     DKY +A+S    +  D ++V+++  AQ+CI  L+K 
Sbjct: 518  AMLKRF--FPGVRGLVHELCKPKRDKYKLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQ 575

Query: 687  KLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPK-NEIFAPALYSVLRDTLVAKDLA 745
            + G   FI LD +      ++  PE+      + T +  +    A+Y V  DT++  +L 
Sbjct: 576  RAGVISFIPLDTIDA-ATPRMPVPESETYTLAINTVEYKDDLVRAMYYVCSDTIICDNLD 634

Query: 746  QANRVAYG-TRRFRVVTLDGKLIDISGTMSGG--GDRVVKGLMKSKQRSNDMYTSEEVQR 802
             A  + +      ++VTLDG LI+ +G M+GG   D   +      Q   D+     V  
Sbjct: 635  IARDLKWNKNANVKIVTLDGALINKTGLMTGGITSDSANRWDKDEYQSLLDLKDKLIVDV 694

Query: 803  MEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDTLSSELQSKKDT 862
             EA    R++   IA    +E+E +L         I  +I++ K  ++   +E+ +  + 
Sbjct: 695  EEAANKSRQSTL-IA----RELEISLSSLTSEISYIRTQITQTKRAVEETETEI-NHHNN 748

Query: 863  LIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISE-LRAQIMKIGGL 921
            LI+ E   +        ++D+EN++  L  E+     +   K E + E   A++ +  G 
Sbjct: 749  LIDREFIPQ--------VKDLENKISGLEDEI----RDWNTKREALQEKCFARLTEKVGF 796

Query: 922  KLQSQNSKVDSL----TQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAENDINHCEI 977
             ++   S    +    T++LQI+   QK+      K E E  R +  K   +N      +
Sbjct: 797  TMKDYESHTGEMIRKQTKELQIL---QKQILNLENKVEFETGRCNATKDRLQN------V 847

Query: 978  ELSKTNNSHEALQEGLRETEHL---IEVIEDKKEQLNQEHETAKKNLDDK---AAYVEKF 1031
            + +K +  HE L E + + + +   IE +E + +  N+E ++ K   D K   A+  E  
Sbjct: 848  QETKNSVQHE-LNELVDQEKSIKLSIETLEGELDGKNEELKSIKAAFDSKQKDASATEDI 906

Query: 1032 KSEEIEMCTHLEKLKNLEHHIKAEISRTD-EELNTLKLRDVEQLLQKLDEHNLPLESLTD 1090
             SE       +E  +N    IK +I+R D E+++ LK   V  ++       +P+     
Sbjct: 907  ISEYNNRLASIESDRN---EIKDDITRLDLEKMSILKNCQVSGII-------VPV----- 951

Query: 1091 RAVTPSNQCIPEMTVEDHDADMNDGEAKLISED--------PNSFNDQESMDVDQDASYI 1142
                     + E+ +E+  A   D EA  I++         P  + +  S  V QD +  
Sbjct: 952  ---------VSEVGLEELPASKVDDEAIEIAKKIEIDFSKLPRKYKEATSAAVKQDLN-- 1000

Query: 1143 GPGLPKLTEAELDNID--IEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDL 1200
                      ++ +ID  +EEL    A+  E  D A +  D +++    L   +R+  D 
Sbjct: 1001 ---------NQIRDIDDVLEELQPN-ARAVERFDDAKSRFDEVDKETEGLKTEERKVFD- 1049

Query: 1201 NESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITM---------GGNAEL 1251
                         +  +K+ R E F + F  I+  +  IY  +T          GG+A +
Sbjct: 1050 ------------EFLKVKQKRKELFENAFEKINEHLDAIYSELTRNVNSTSILGGGSASM 1097

Query: 1252 ELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1311
             + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y P+P +++DE+
Sbjct: 1098 TIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTVAALALLFAINSYNPSPFFILDEV 1157

Query: 1312 DAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLIGIYKSS--NMTKSTTL 1367
            DAALD  NV  +A YI+     + QFIVISL+N MFE +  L+G+++    N +K  TL
Sbjct: 1158 DAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVFRQQQENSSKIVTL 1216

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  231 bits (589), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 321/1328 (24%), Positives = 582/1328 (43%), Gaps = 195/1328 (14%)

Query: 111  LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
            L L NFKSY G   VG   S+F +++GPNGSGKSN++D++ FV G +++ +R   L +LI
Sbjct: 7    LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 171  HKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESS 230
            ++    E         T  YV          L     + + R + +N  ++Y +NGK   
Sbjct: 67   YRGVEGEEDEEDGEGRT-AYV------KAFYLKSDSTVELSRSISRNGDTQYKMNGKNCG 119

Query: 231  YTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKS 290
            Y +  +FL  E I +  + FL+ QG+V  IA        +    L +  E+I G+ +YK 
Sbjct: 120  YKQYAEFLEEENILIKAQNFLVFQGDVVQIAS-------QSATDLTKLFEEISGSIQYKK 172

Query: 291  QIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXXXXXXXXXXW 350
            +      ++D+LN    E       +  E +S   G ++  EF                W
Sbjct: 173  EYDSLKGKVDSLNQSAAESIKNRRRIHGELKSYREGIDKNQEFYHQVEKRKELQRHYALW 232

Query: 351  DI-NKETKKLAVTLDKISAFTEKLENERNKYGE----LQKEITDLRELSDNLEEQITKIN 405
             + + ET++  +  DK++     ++  R K       LQ+        S ++ +Q +K+ 
Sbjct: 233  QLYHLETQRHELE-DKLANLKNSIKTIRGKETSQEQILQRSRASFARESASILKQRSKME 291

Query: 406  A---EKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNE 462
            +   EK ++ +  L ++    S+ +++ ++ ++ +  ++ +    + +   EN +  + +
Sbjct: 292  SKSREKEKINQQLLPIKLSQRSAAKRIANVQKRISSLQRDIDRQREYVERFENQLNVVTK 351

Query: 463  AQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKTSSISEEVASLE----------KELEP 512
            A+++F                  D  K+        +++   SLE          +EL  
Sbjct: 352  AKSDFEKEIKESSKDHDKYKLNEDDTKLYASLNEKYLNQGGFSLESQKQLTLNDKQELMD 411

Query: 513  WTTKLEAKN--SQIKLAESEILIIKESKLKLEQEISQLRKDIESYKDRIENHKKKINKLE 570
                L+ +N  S+ ++ + E+ +I E   KLE ++S++   +    +R   H  K+ +L+
Sbjct: 412  EMETLKKRNDISRSRVTD-ELSVIAE---KLESQLSEISSTL---NERNSTHSDKVKELQ 464

Query: 571  KESAAITSFISTAQGECD---SAKKKLVDMKQVLTNHRQRMTDARVALSNVENKNKVLGA 627
            K  + I    S++  E D     ++ LV ++++  + R+ + + ++     EN    +  
Sbjct: 465  KLHSQIE---SSSNKEYDLNYKLREVLVKIEELSASQRETVKERKLR----EN----IAT 513

Query: 628  LCRLQKSGRIHGFHGRLGDLGTI-DDKYDIAISVACPR-LDDIVVETVECAQQCIEHLRK 685
            L R        G  G + DL     DKY +AIS    +  D ++V+ V  AQ+CI +L+K
Sbjct: 514  LKRF-----FPGVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVDNVMVAQECIAYLKK 568

Query: 686  NKLGYARFILLDKLKKFNMAKVTTPENVPRLF-----DLTTPKNEI-----FAPALYSVL 735
             + G A FI LD          T    +P L        T   N I     +  AL  V 
Sbjct: 569  QRAGIASFIPLD----------TIDVEIPTLTLSDSQGCTLAINAIDYEQEYERALQYVC 618

Query: 736  RDTLVAKDLAQANRVAYGTR-RFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQRSNDM 794
             D+++  D+  A  + +    R ++VTL+G LI  +G M+GG          SK  SN  
Sbjct: 619  SDSIICDDMNIAKDLKWNKGVRSKLVTLEGALIHKAGLMTGG---------ISKNTSN-R 668

Query: 795  YTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQ---PNIDVEISKHKIDIDT 851
            +  EE Q +   L D+           Q++E A  + K+       ++  +S    +I  
Sbjct: 669  WDKEEYQSL-MTLKDK---------LLQQVEEAALEGKNASLMARELESTLSLLNTEISE 718

Query: 852  LSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISEL 911
            L ++L   + TL   E+T E +  +    E+ E +L+ L               E+I   
Sbjct: 719  LRTQLTLTQRTL--KENTVERDYHEKLIKEEYEPELLNL--------------EERIQNF 762

Query: 912  RAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTE-LKKNELEMNRASKQKLGAEN 970
               + ++   K + QN   +  T ++   V   + +  E +++   E+ +  +Q L  EN
Sbjct: 763  NFALQELDSQKEKLQNEIFEEFTNRVGFTVKDYESHSGEIMRQQSKELQQLQRQILNVEN 822

Query: 971  DINHCEIELSKT----NNSHE----------ALQEGLRETEHLIEVIEDKKEQLNQEHET 1016
             +   +  LS T      +HE           L+   +ETE  I  I+ +     +E E 
Sbjct: 823  KLQFEKDRLSTTERRFGKAHEDMAKIEFELTQLERQEKETESRINQIDQELADQKKELEQ 882

Query: 1017 AKKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEE----LNTLKLRDVE 1072
             +K LD K   ++  +    E+  +L+ LK  +  +K ++ + D E    L   KL ++ 
Sbjct: 883  FQKKLDAKHGDIDSTEDALHEVTANLQALKRHKDELKEDVEKVDMEKVCVLKNCKLSNIT 942

Query: 1073 -QLLQKLDEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQE 1131
              +L   D   LP++ + +  +  +++   E+   +  A   +  A+ I ED    + + 
Sbjct: 943  IPVLSDTDLDQLPIDRIDEETIAIAHEI--EIDFHELPAKYKESGAETIREDFEK-SIKH 999

Query: 1132 SMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLA 1191
            + D+  D         + +EA+      E +  E  +LK                     
Sbjct: 1000 AEDILNDLQPNAKANERFSEAQ---NKFEAIDYETEELK--------------------- 1035

Query: 1192 EYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMIT------- 1244
                       S EKR  +  ++  +KK R   F   F   S  +  IY+ +T       
Sbjct: 1036 -----------SEEKR--VIAQFLKIKKKRKALFERAFEYASEHIDPIYRELTKNPGSTN 1082

Query: 1245 --MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKP 1302
               GG+A L L D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+F ++ ++P
Sbjct: 1083 ELAGGSASLTLEDEDEPFNAGIRYHATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQP 1142

Query: 1303 TPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLIGIYKSS-- 1359
            +P +V+DE+DAALD  NV  +A YI +   ++ QFIVISL+N MFE +  L+G+Y+    
Sbjct: 1143 SPFFVLDEVDAALDSTNVDRIAAYISRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQE 1202

Query: 1360 NMTKSTTL 1367
            N +K  TL
Sbjct: 1203 NSSKIVTL 1210

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score =  185 bits (470), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 307/1299 (23%), Positives = 559/1299 (43%), Gaps = 194/1299 (14%)

Query: 106  LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
            + ++ LI++ FKSYA   V+  + + F+A+ G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1    MKVEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 165  KLSNLIHKSENHENLSFCSVEITFQYVMDDAD-GNTKV-LPDVQELSVMRKVFKNNTSKY 222
             + +LI+K      ++  SV I F    D++D  N+ +   D  ++SV R++    TSKY
Sbjct: 61   NMQDLIYK-RGQAGVTKASVTIVF----DNSDKSNSPIGFNDSLKISVTRQIVLGGTSKY 115

Query: 223  YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
             ING  +    V Q  ++  +++++  FLI+QG++  +  M+P         +L  +E+ 
Sbjct: 116  LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEEA 168

Query: 283  IGTAKYKSQIRDALVEMDTLNDICME-KEIRFELVEKEKRSLEAGKEQALEFIAXXXXXX 341
             GT  ++ +   A   M        E + +  E +E +   L   K   LEF        
Sbjct: 169  AGTKMFEDRREKAERTMSKKETKLEENRTLLAEEIEPKLNKLRGEKRIFLEFQVTQTDLE 228

Query: 342  XXXXXXXXWDINKETKKLAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQI 401
                    +D +  + +     DK+S+   ++E  +    +   EI  L+E   +LE+  
Sbjct: 229  KISRVVTAFDYHNMSTRRDSARDKVSSNERRMEELKTLISKTTDEIISLKE---DLEQIK 285

Query: 402  TKINAEKSQLVKDKL--QLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRR 459
            T+   +K +L K+ +  +L+++      ++  +N  +    + L+  +K I+  +N +  
Sbjct: 286  TQ---KKDELDKNGVLPKLEKQEGDFLNQISRINATKQICSQNLEENKKKIQKLQNTLES 342

Query: 460  LNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKT---SSISEEVASLEKELEPWTTK 516
            L+    E                   + +K   + ++   S++S  ++S  +    +T +
Sbjct: 343  LSRELQEKLDRYREIETAYKQDESTLNQLKEEHKSRSELLSTLSIGISSTGEAETGYTAQ 402

Query: 517  LEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIESYKDRIENHKKKINKLEKESAAI 576
            L +              +KE   + E  I   RK IE  +  +  +  K+ +  KE+   
Sbjct: 403  LSS--------------VKEQYNETEVNIQTHRKRIEFIEKELAYNGPKLQQARKENEQA 448

Query: 577  TSFISTAQGECDSAKKKLVDM---KQVLTNHRQRMTDARVALSNVEN-----KNKVLGAL 628
             +    ++  C S +K+L       + L   R+  +D +  +  + N     K K     
Sbjct: 449  VANYKHSEMACASLEKELTTFGYDPEFLKQLRKEESDLKQQIYQMNNDIDHLKRKTANLD 508

Query: 629  CRLQKSGR---IHGFHGRLGDLGTIDDK--YDIAISVACP--RLDDIVVETVECAQQCIE 681
               +  G     +   G    L ++D++  Y       C   RL ++VV+    A Q +E
Sbjct: 509  FHYEMPGGKFDPNSVKGIAAQLFSLDEQNFYSATALQVCAGGRLFNVVVDNENTAAQLLE 568

Query: 682  HLRKNKLGYARFILLDKLKK-------FNMAKVTTPENVPRLFDLTTPKNEIFAPALYSV 734
              R  K   A  I L+K+          NMAK   P  V    +L   + E+   A+  +
Sbjct: 569  RGRLRK--RATIIPLNKIAARTLNDNIVNMAKSVAPGRVELALNLIGYEEEV-RRAMEFI 625

Query: 735  LRDTLVAKDLAQANRVAYGTR-RFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQRSND 793
               +LV KD   A  V +  + R R +TLDG + D  GT+SGG       L+   QR N+
Sbjct: 626  FGSSLVCKDAEAAKMVTFNPKIRTRSITLDGDVYDPEGTLSGGSRNNTSSLLIDIQRYNN 685

Query: 794  MYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDTLS 853
                  V+ +E +L D      IA     + E +  K K+ Q   ++E+++HK+ +    
Sbjct: 686  --NCNLVKELETKLND------IAKKIAIQFEIS-NKTKNLQK--ELELAQHKLKLS--E 732

Query: 854  SELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISELRA 913
              LQS         +TA    R N  LE          SE+   K+E K K  QI +L+ 
Sbjct: 733  RNLQS---------NTAAQLIRKNEELE----------SEIAQCKEEIKDKTSQIKQLKK 773

Query: 914  QIMKI----------GGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASK 963
            QI KI           G KL     +V+S++ Q+      +++ R E + +  +  +   
Sbjct: 774  QIAKIEKDADEFSHDKGSKLDELRREVESMSVQIS-----EEEQRCETQYDAYQNFQLEI 828

Query: 964  QKLGAENDINHCEIELSKTNNSHEALQEGLRETE----HLIEVIEDKKEQLNQEHETAKK 1019
            ++LG   DI+  +  L +   + + LQ  + E +     L + ++DK+ +L +E      
Sbjct: 829  EQLGG--DIDSSKDTLEQAELTVKKLQTEVSEHDMNLRDLNQALQDKQVELEEERNRL-M 885

Query: 1020 NLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDV-----EQL 1074
             +DD+   +E            ++   +++++ + +I + + ELN  KLR        +L
Sbjct: 886  GIDDELKEIEAL----------IKSKTDIKNNAELDIQKINHELN--KLRSTSNSFESEL 933

Query: 1075 LQKLDEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMD 1134
             Q LDEH    E L+D +            +E H A +N  E +           Q    
Sbjct: 934  AQLLDEH----EWLSDESQVA-------YIIEQH-ASINLAEYR-------ERGAQLQER 974

Query: 1135 VDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYK 1194
             D     + P +  + E+    ++ +E A     LK  + T   D   ++E   +L EYK
Sbjct: 975  FDDMKRKVNPNIMSMIES----VEKKESA-----LKTMIRTIEKDKVKIQETITKLNEYK 1025

Query: 1195 RRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELV 1254
            R                   E L K+  E+  + FG        ++  +     A+L   
Sbjct: 1026 R-------------------ETLIKT-WEKVTEDFG-------NVFADLLPNSFAKLVPC 1058

Query: 1255 DSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1314
            +  D  +EG+   V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAA
Sbjct: 1059 EGKD-ITEGLEVKVKLGSIWKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAA 1117

Query: 1315 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLI 1353
            LD  +   + + IK R K +QFIV+SL+  MF  A ++ 
Sbjct: 1118 LDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVF 1156

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  182 bits (461), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 205/764 (26%), Positives = 363/764 (47%), Gaps = 108/764 (14%)

Query: 639  GFHGRLGDLG-TIDDKYDIAISVACPR-LDDIVVETVECAQQCIEHLRKNKLGYARFILL 696
            G  G + DL     +KY +A+S    +  D ++VE +  AQ+CI  L+K + G A FI L
Sbjct: 528  GVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPL 587

Query: 697  DKLKKFNMAKVTTPENVPRLFDLTTPKNEI-FAPALYSVLRDTLVAKDLAQANRVAYGTR 755
            D ++   +  ++ P++   +  +     E  +  A+  V  D+++   L  A  + +   
Sbjct: 588  DTIET-ELPTLSLPDSQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKG 646

Query: 756  -RFRVVTLDGKLIDISGTMSGG--GDRVVKGLMKSKQRSNDMYTSEEVQRMEA------- 805
             R ++VT++G LI  +G M+GG  GD            +N+ +  EE Q + +       
Sbjct: 647  IRGKLVTIEGALIHKAGLMTGGISGD------------ANNRWDKEEYQSLMSLKDKLLI 694

Query: 806  ---ELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDTLSSELQSKKDT 862
               EL++ + +  I     +E+E ++        N+  ++++ K  +D    E++   D 
Sbjct: 695  QIDELSNGQRSNSIRA---REVENSVSLLNSDIANLRTQVTQQKRSLDENRLEIKYHND- 750

Query: 863  LIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISELRAQIMKIGGLK 922
            LIE E   +  +     L+D+EN    L      +K++  ++N    E  +   KIG   
Sbjct: 751  LIEKEIQPKITELKK-KLDDLENTKDNL------VKEKEALQNNIFKEFTS---KIGFTI 800

Query: 923  LQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRAS---KQKLGAENDINHCEIEL 979
             + +N   + + QQ + +   QK+  T   K + E +R S   ++   A+ D+ + ++E+
Sbjct: 801  KEYENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQKDLENAQVEM 860

Query: 980  SKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMC 1039
                    A++  +   E  +E  ++  ++L ++  T +  L+     +E       +M 
Sbjct: 861  KSLEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFVTKQSELNSSEDILE-------DMN 913

Query: 1040 THLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEHNLPLESLTDRAVTPSNQC 1099
            ++L+ LK     IK +I + D E  T  L++      K+   N+P+ S            
Sbjct: 914  SNLQVLKRERDGIKEDIEKFDLERVT-ALKNC-----KISNINIPISS------------ 955

Query: 1100 IPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPGLPKLTEAELDNIDI 1159
              E T++D      D EA  IS          S+D++        GLPK  +    +   
Sbjct: 956  --ETTIDDLPISSTDNEAITISN---------SIDINY------KGLPKKYKENNTDSAR 998

Query: 1160 EELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVE--KREE--IRNRYE 1215
            +EL  +I +++E ++    +   LE Y     E + R   +N   E  K EE  I N++ 
Sbjct: 999  KELEQKIHEVEEILNELQPNARALERYD----EAEGRFEVINNETEQLKAEEKKILNQFL 1054

Query: 1216 MLKKSRLEEFMDGFGIISMTVKEIYQMIT---------MGGNAELELVDSLDPFSEGVLF 1266
             +KK R E F   F  +S  +  IY+ +T          GGNA L + D  +PF+ G+ +
Sbjct: 1055 KIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKY 1114

Query: 1267 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1326
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A Y
Sbjct: 1115 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAY 1174

Query: 1327 I-KERTKNAQFIVISLRNNMFELAQQLIGIYKSS--NMTKSTTL 1367
            I + R  + QFIVISL+N MFE +  L+G+Y+    N +K  TL
Sbjct: 1175 IRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITL 1218

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  172 bits (437), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 208/760 (27%), Positives = 363/760 (47%), Gaps = 100/760 (13%)

Query: 639  GFHGRLGDLG-TIDDKYDIAISVACPR-LDDIVVETVECAQQCIEHLRKNKLGYARFILL 696
            G  G + DL     +KY +A+S    +  D +VV+T+  AQ+CI +L+K + G   FI L
Sbjct: 522  GVKGLVSDLCHPKKEKYALAVSTILGKNFDSVVVDTLSVAQECITYLKKQRAGIISFIPL 581

Query: 697  DKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTR- 755
            D +  F     TT      L       ++ +  A+  V  D+++   L+ A  + +    
Sbjct: 582  DTIDAFVPTLPTTNIQGITLVLNAIDYDQEYDKAMQYVCSDSIMCDTLSIAKSLKWKHNV 641

Query: 756  RFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQRSNDMYTSEEVQRMEAE-LTDRETNF 814
              ++VTL+G LI  +G M+GG  +  +G    K+    + T ++   ++ E L++    F
Sbjct: 642  TSKLVTLEGTLIHRAGLMTGGVSKE-QGNRWDKEEYQGLVTLKDKLLIQIEQLSNNSKTF 700

Query: 815  KIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQ 874
             I     +++E+ + +      ++  +IS+    I+   +E+Q  +D +++ E   + NQ
Sbjct: 701  AIEA---RDLESNISQLNSSISDLRTQISQINRSIEENKAEVQYHED-MLKKEYEPKQNQ 756

Query: 875  RDNGPLEDIENQLVALNSELVALKD--ESKVKNEQISELRAQIMKI---GGLKLQSQNSK 929
              N  LE IE       SE++  K+  ++ V  E  ++L   I +     G  L+  N +
Sbjct: 757  L-NTKLESIEKS----KSEIIGQKELLQNTVFKEFHNKLGFTIQEYEHHSGEALRQSNKE 811

Query: 930  VDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAENDINHCEIELSKTNNSHEAL 989
            +  L +Q+  I   + K + E+++ E    R  K            +I+L   N++ E+L
Sbjct: 812  LQQLEKQVLNI---ESKLQFEVERYESTEKRHKK-----------AQIDLENNNSTIESL 857

Query: 990  QEGLRETEHLIEVIEDKKEQLNQEHETAKKNLD---DKAAYVEKFKSEEIEMCTHLEKLK 1046
            QE   E    I+ IE+   ++ +  E   K +D    K A  E   SE+ E+ T      
Sbjct: 858  QENEAEVVAKIKDIENGMLEIKKVLEDFSKEIDRKKKKLAIAEDSLSEKSELLT---TST 914

Query: 1047 NLEHHIKAEISRTDEE----LNTLKLRDVE-QLLQKLDEHNLPLESLTDRAVTPSNQCIP 1101
            N +  IK EI + D E    L   K+ +++  +  K+D +NLP+  +             
Sbjct: 915  NEKISIKEEIEKKDLEKLGILTNCKISNIQVPVASKIDLNNLPIGKI------------- 961

Query: 1102 EMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQ-DASYIGPGLPKLTEAELDNIDIE 1160
                        D +A LIS       ++ S+D     A Y      K+  A    I++ 
Sbjct: 962  ------------DNDAILIS-------NEISLDYKTLPAKYKESSSSKIRSALEHEIEVV 1002

Query: 1161 ELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKRE-EIRNRYEMLKK 1219
            E  L+  Q       A A +D  +E   R         D  E+++K+E ++  ++  +KK
Sbjct: 1003 EDLLQDLQ-----PNARA-VDRFDEAKERFDSAS----DETETLKKQERKLLTQFLAIKK 1052

Query: 1220 SRLEEFMDGFGIISMTVKEIYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMP 1270
             R E F   F  +S  ++ IY+ +T          GGNA L L D  +PF  G+ +   P
Sbjct: 1053 KRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKYHATP 1112

Query: 1271 PKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1330
            P K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANYI++ 
Sbjct: 1113 PLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERIANYIRKH 1172

Query: 1331 T-KNAQFIVISLRNNMFELAQQLIGIYKSS--NMTKSTTL 1367
            +  + QFIVISL+N+MFE +  L+GI++    N ++  TL
Sbjct: 1173 SNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVVTL 1212

 Score = 99.0 bits (245), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 85/159 (53%), Gaps = 11/159 (6%)

Query: 111 LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
           L L NFKSY GV  VG   S+F++++GPNGSGKSN++D++ FV GF+++ +R   L +L+
Sbjct: 7   LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 171 HK---SENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGK 227
           ++   S +            +     + DG          + +MR +     S Y I+ K
Sbjct: 67  YRDIASADENEFGEDGERSAYVKAFYEKDGTV--------VELMRAITAGRDSVYKIDNK 118

Query: 228 ESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPK 266
            ++Y   + FL  E I +  + FL+ QG+VE IA   P+
Sbjct: 119 TTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPR 157

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  146 bits (368), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 188/775 (24%), Positives = 354/775 (45%), Gaps = 130/775 (16%)

Query: 639  GFHGRLGDLGTID-DKYDIAISVACPR-LDDIVVETVECAQQCIEHLRKNKLGYARFILL 696
            G  G + DL     ++Y +A+S    R  D I+V+ +  AQ+CI +L+K + G A FI L
Sbjct: 525  GIRGLVSDLCQPKKERYALAVSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPL 584

Query: 697  DKLKKFNMAKVTTPENVPRLFDLTTPKNEI-FAPALYSVLRDTLVAKDLAQANRVAYGTR 755
            D ++    + +   E+   +  +   + +  +  A+  V  D+++   L  A  + +  R
Sbjct: 585  DTIE-VETSTLPASESSGCILAINAIEYDPEYERAMRYVCSDSIICNTLEIARDMKW-KR 642

Query: 756  RFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQRSNDMYTSEEVQ-------RMEAELT 808
              R      KL+ + GT+      +  G+ K    S++ +  EE Q       ++  ++ 
Sbjct: 643  NVR-----SKLVTLEGTLIHRAGLMTGGISKD---SSNRWDKEEYQSLMTLKDKILVQIE 694

Query: 809  DRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDTLSSELQSKKDTLIELES 868
            +  ++ +  +   +E+E  +        +I  +IS+ K  ++  +++++  ++ +     
Sbjct: 695  EVGSHSRACSIRARELEGNISLIYSEASSIRTQISQLKRALEDTNTDIEYHQNLI----- 749

Query: 869  TAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISELRAQIMKIGGLKLQSQNS 928
                 Q  +  ++++E +L  +N     L++E    + Q    +    K+G    + +  
Sbjct: 750  ----KQEYDPKIQELEQKLAIINDSRKQLEEEKD--SLQTQTFKEFTDKLGFSMKEYETH 803

Query: 929  KVDSLTQQLQIIVAKQKK-----NRTELKKNELEM--NRASKQKLGAENDINHCEIELSK 981
              D+  QQ + +   QK+     N+ E +K  L    NR  K     E D+    IEL  
Sbjct: 804  SGDAKRQQSKELQQLQKQILNVENKLEFEKERLTSTSNRLEK----TETDMKKVFIELQS 859

Query: 982  TNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKK-----NLDDKAAYVEKFKSEEI 1036
                 E +  G+ +T+ + + I+D K +L +  E  K      NL+D+           I
Sbjct: 860  LQKQEEDV--GV-QTKKVEKAIKDHKIKLKKVEEELKNKQRTMNLNDEQL---------I 907

Query: 1037 EMCTHLEKLKNLEHHIKAEISRTDEE----LNTLKLRDVE-QLLQKLDEHNLPLESLTDR 1091
            E  + L+ LK     +K  I + D E    L   K+ +++  ++  +D  +LP++ +   
Sbjct: 908  EYNSSLQSLKRERDEVKDVIEKGDLERICVLKNCKISNMQIPIVSDVDLQSLPIDRIDAE 967

Query: 1092 AVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDASYIGPGLPKLTE 1151
            A+  SN    E+ + D+DA             P  + +             G  + K  E
Sbjct: 968  AIRTSN----EIEI-DYDAL------------PAKYKENG-----------GEAVEKGFE 999

Query: 1152 AELDNIDIEELALEIAQLKEYMDTAYADIDILEEYAL---RLAEYKRRKLDLNESVE--K 1206
             EL  +D      EI             +++L+  A    R  E +++   +N+  E  K
Sbjct: 1000 RELKQVD------EI-------------LNVLQPNAKATDRFNEAQQKFGSINDETEQLK 1040

Query: 1207 REE--IRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMIT---------MGGNAELELVD 1255
            ++E  +  ++  +K+ R   F + F  ++  +  IY+ +T          GG+A L L D
Sbjct: 1041 KDEKKVLAQFIKIKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLED 1100

Query: 1256 SLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1315
              +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAAL
Sbjct: 1101 EDEPFNAGIRYHATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAAL 1160

Query: 1316 DFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLIGIYKSS--NMTKSTTL 1367
            D  NV  VA YI+     + QFIVISL+N MFE +  L+G+Y+    N +K  TL
Sbjct: 1161 DTTNVERVATYIRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTSKIVTL 1215

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/186 (33%), Positives = 96/186 (51%), Gaps = 19/186 (10%)

Query: 111 LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
           L L+NFKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R+  +R   L +LI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 171 HKS----ENHENLSFCSVEITFQYVMD-DADGNTKVLPDVQELSVMRKVFKNNTSKYYIN 225
           ++     E  +  S      T  YV    + G++ +     ELS  R + K   + Y +N
Sbjct: 67  YRGVASEEEGDGESDVVNNPTTAYVKAFYSKGDSTI-----ELS--RSISKGGDTTYRMN 119

Query: 226 GKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGT 285
           GK   Y     FL +E I +  K FL+ QG+V  IA             L ++ E+  G+
Sbjct: 120 GKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIASQSAME-------LTQFFEEFSGS 172

Query: 286 AKYKSQ 291
            +YK +
Sbjct: 173 IQYKKE 178

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  139 bits (349), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 109/170 (64%), Gaps = 12/170 (7%)

Query: 1210 IRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMIT---------MGGNAELELVDSLDPF 1260
            +  ++  +++ R + F   F  +S  + ++Y+ +T          GGNA L L D  +P+
Sbjct: 1052 VNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPY 1111

Query: 1261 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1320
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV
Sbjct: 1112 LAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNV 1171

Query: 1321 SIVANYIKERT-KNAQFIVISLRNNMFELAQQLIGIYKSS--NMTKSTTL 1367
              +A YI++R   N QFIVISL+N MFE +Q L+G+++    N +++ TL
Sbjct: 1172 ERIATYIRQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score =  100 bits (248), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 99/191 (51%), Gaps = 26/191 (13%)

Query: 113 LNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHK 172
           L NFKSY G   +G   S+F++V+GPNGSGKSN++D++ FV G ++  +R   L++LI++
Sbjct: 9   LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 173 ------------SENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTS 220
                       SE H+N +  S      +       N     DV EL+  R +  +  S
Sbjct: 69  GTLQDGDADSGYSETHDNENNPSSAYVKAFYSPSGQEN-----DVAELT--RTITLSQES 121

Query: 221 KYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLE 280
            Y +NG+  S+ +   FL +E I +  + FL+ QG+VE +A  KP+        L    E
Sbjct: 122 TYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTTLFE 174

Query: 281 DIIGTAKYKSQ 291
            + G+ +YK +
Sbjct: 175 QVSGSIQYKQE 185

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score =  133 bits (335), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 195/799 (24%), Positives = 349/799 (43%), Gaps = 124/799 (15%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + I+ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  A   +R  
Sbjct: 1   MKIEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRAS 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDAD-GNTKV-LPDVQELSVMRKVFKNNTSKY 222
            L +LI+K      ++  SV + F    D++D  N+ +   +  ++SV R+V    +SKY
Sbjct: 61  SLQDLIYK-RGQAGVTKASVTVVF----DNSDKSNSPIGFTNSAKISVTRQVMLGGSSKY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            ING  +    V Q  ++  +++++  FLI+QG++  +  MKPK        +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEA 168

Query: 283 IGT--------------AKYKSQI---RDALVE--MDTLNDICMEKEIRFELVEKEKRSL 323
            GT              AK ++++   R  LVE     L  +  EKEI  +  E +   L
Sbjct: 169 AGTKMFEDRKDKAERTMAKKEAKLEENRALLVEEIEPKLGKLRSEKEIFIKFQETQSE-L 227

Query: 324 EAGKEQALEFIAXXXXXXXXXXXXXXWDINKETKKL----AVTLDKISAFTEKL-ENERN 378
           E  +     F                   NK +++L    + T D+IS+  E L E +RN
Sbjct: 228 EKTERVVYAFDYHNMINKSSSLKQHLNSSNKRSEQLKELISRTSDEISSLNEDLEETKRN 287

Query: 379 KYGEL--QKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKR 436
           K  E+  Q  + +L E    L  +I++I  +      +    +++L  ++E +K      
Sbjct: 288 KQKEIDEQGTLANLEEREGQLLNEISRIQTQLGICKDNSDDTKQKLSDAKEYIK------ 341

Query: 437 TKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKT 496
            K   +L+    + +  E   ++LN+A                      + +K + + K 
Sbjct: 342 -KCSASLETKSVSYKKTEEEYQKLNDA---------------------LEQLKGTHKQK- 378

Query: 497 SSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIESYK 556
               E +++L+  +          N Q+ LA+  +   + S  KL  +I  L+K+     
Sbjct: 379 ---EELLSTLQTGISSTGATDGGYNEQLILAKQSLNECELSVRKLNLKIDHLKKE----- 430

Query: 557 DRIENHKKKINKL---EKESAAITSFISTAQGECDSAKKKLVDM---KQVLTNHRQRMTD 610
                H   + KL   E E A     +   Q  CD  +K +      + ++ + +Q   +
Sbjct: 431 -----HTLNVPKLQQAESEHAESLKHVQKCQKSCDELQKIITKFGYDETLVESLKQEENN 485

Query: 611 ARVALSNVENKNKVLG---ALCRLQKSGRIHGFH-----GRLGDLGTI-DDKYDIAISV- 660
            R  +S + N++  L    A      S   H F+     G    L T+ +D YD A ++ 
Sbjct: 486 LRHEISRLNNESSYLRRKVANVDFTYSKPTHDFNPRSVKGVAAQLFTLAEDNYDSATALQ 545

Query: 661 --ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKL-------KKFNMAKVTTPE 711
             A  RL ++VV+    A Q +E  R  K      I L+++       +   +A+ T P 
Sbjct: 546 VCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTIIPLNRIAARALNSQTLQLAQKTAPG 603

Query: 712 NVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTR-RFRVVTLDGKLIDIS 770
            V    +L   + E+ + A+  +  ++L+ KD   A ++ +  + R R +TL G + D  
Sbjct: 604 KVELALNLVGYEEEV-SRAMEFIFGNSLICKDAETAKKITFHPQIRTRSITLQGDVYDPE 662

Query: 771 GTMSGGGDRVVKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQK 830
           GT+SGG       L+   Q+ N   T++ ++ +E +L       K  T   +E E+ LQ 
Sbjct: 663 GTLSGGSRNNTSSLLIDVQKYNK--TAKRIEELELKL-------KSITRDLEEQESKLQ- 712

Query: 831 YKDRQPNIDVEISKHKIDI 849
            K R    D+ ++ HK+ +
Sbjct: 713 -KTRSVRNDLNLATHKLTL 730

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1261 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1320
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1321 SIVANYIKERTKNAQFIVISLRNNMF 1346
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  132 bits (333), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 190/785 (24%), Positives = 338/785 (43%), Gaps = 96/785 (12%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRAS 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYI 224
            L +LI+K      ++  SV I F     D   +     +  ++SV R+V    TSKY I
Sbjct: 61  SLQDLIYK-RGQAGVTKASVTIVFNNT--DKLNSPIGFTNSPQISVTRQVVLGGTSKYLI 117

Query: 225 NGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIG 284
           NG  +    V Q  ++  +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 285 TAKYKSQIRDA----------LVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFI 334
           T  ++ +   A          L E  TL  +  E E + E +  EKR         LEF 
Sbjct: 171 TKMFEDRREKAERTMSKKETKLQESRTL--LTEEIEPKLEKLRNEKRMF-------LEFQ 221

Query: 335 AXXXXXXXXXXXXXXWD---INKETKKLAVTLD-------KISAFTEKLENERNKYGELQ 384
           +              +D   I  +   +  TL+       K++ F  K   E     E  
Sbjct: 222 STQTDLEKTERIVASYDYYNIKHKHTSIRETLENGEAHMKKLNDFIRKTSEEIESLNEDI 281

Query: 385 KEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQ 444
           +EI   +E   + E +I K+ A+++ L+    ++ R   S   K+++LN    K    L+
Sbjct: 282 REIKHQKEKELHKEGRIFKLEAQENGLLN---EISRSKTSLSIKMENLNDTNGK----LK 334

Query: 445 VAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKTSSISEEVA 504
             E  I        +LNE +TE+                  D  K           E V+
Sbjct: 335 AVESEIASAS---AKLNEKKTEYIKTEEDYKTAQGQLSKQRDLYKRK--------EELVS 383

Query: 505 SLEKELEPWTTKLEAKNSQIKLAESEI----LIIKESKLKLEQEISQLRKDIESYKDRIE 560
           +L   +          N+Q+  A++E+    L IK+S +K+E     L+K++ + + +++
Sbjct: 384 TLTTGISSTGAADGGYNAQLIKAKTELNDISLAIKKSNMKME----LLKKELLAIEPKLK 439

Query: 561 NHK--KKIN-KLEKESAAITSFISTAQGECDSAKKKLVDMKQ----VLTNHRQRMTDARV 613
           N     ++N K  K+   + + +     E      ++ D+KQ    + + + Q   D+  
Sbjct: 440 NATMDNELNIKHVKDCQEVCNRLQAQLTEYGFDPSRIKDLKQRENELKSRYYQISNDSEY 499

Query: 614 ALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAI-SVACPRLDDIVVET 672
               V N            K+  +HG  G+L  L   + +Y  A+ + A  RL ++VV+ 
Sbjct: 500 LKRRVANLEFNYTTPYPDFKANFVHGVVGQLFQLDYDNIRYSTALQTCAGGRLFNVVVQD 559

Query: 673 VECAQQCIEHLRKNKLGYARFILLDKL-------KKFNMAKVTTPENVPRLFDLTTPKNE 725
            + A Q +E  R  K      I LDK+       +   +AK   P  V    +L    ++
Sbjct: 560 SQTATQLLERGRLRK--RVTIIPLDKIYARTINPQVLELAKTVAPGKVELAINLIKF-DK 616

Query: 726 IFAPALYSVLRDTLVAKDLAQANRVAYGTR-RFRVVTLDGKLIDISGTMSGGGDRVVKGL 784
               A+  +  ++L+ +D   A ++ +  + R R +TL G + D  GT+SGG       L
Sbjct: 617 TVTKAMEFIFGNSLICEDPETAKKITFHPKIRIRSITLQGDVYDPEGTLSGGSKNTSDSL 676

Query: 785 MKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISK 844
           +   Q+ N +   +++  ++A+L          T+  Q   A  QK K  Q   D+ +S 
Sbjct: 677 LVDIQKYNQI--QKKIGTLQADLNH-------VTEELQRQYATSQKTKTVQN--DLSVSV 725

Query: 845 HKIDI 849
           HK+D+
Sbjct: 726 HKLDL 730

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  125 bits (314), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 189/763 (24%), Positives = 332/763 (43%), Gaps = 112/763 (14%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQ 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLP--DVQELSVMRKVFKNNTSKY 222
            L +LI+K      +   SV I F    D++D ++         ++SV R++    TSKY
Sbjct: 61  NLQDLIYK-RGQAGVIKASVTIVF----DNSDPSSSPFGFETYPKISVTRQIILGGTSKY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            ING  +    V    ++  +++++  FLI+QG++  +  MKP       D +L  +E+ 
Sbjct: 116 LINGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEA 168

Query: 283 IGTAKYKSQIRDALVEMDTLNDICME-KEIRFELVEKEKRSLEAGKEQALEFIAXXXXXX 341
            GT  ++ +   A   M        E + +  E +E +   L   K   LEF        
Sbjct: 169 AGTRMFEDRREKAEKTMAKKETKLQEIRALLLEEIEPKLNRLRNEKRAFLEFQQTQTDLE 228

Query: 342 XXXXXXXXWDI-----------------NKETKKLAVTL----DKISAFTEKLEN-ERNK 379
                   +D                   K  K L  ++    D+IS  TE  E+  R K
Sbjct: 229 KTSRIVNTYDYQTLVQKRSSMQERLQSDQKRIKDLEFSVEKYRDEISTLTEDFESIRRQK 288

Query: 380 YGELQKEIT--DLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEK-LKSLNQKR 436
             +LQK+ T   L    ++L  +++++ A         L + R+ ++ E++ L +LN   
Sbjct: 289 EKQLQKDTTLQTLEAKENSLSTELSRVTA--------ALGITRDDLADEQRNLSALNLSI 340

Query: 437 TKAEKTLQVAEKNIRHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDK- 495
            K+E+ L    K     EN    LN A+ E                     +K   R+K 
Sbjct: 341 AKSEQELTSLSKTYSETENEYVVLN-AEIE--------------------KLKTICRNKE 379

Query: 496 --TSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIE 553
              S+++  ++S       +T +L   N++++L E++I +      K+E  I+ LRK++ 
Sbjct: 380 ELLSTLTTGISSTGTTEGGYTAQL--NNAKLQLNEAQIAV-----KKVEMRITMLRKELA 432

Query: 554 SYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKK---LVDMKQVLTNHRQRM-- 608
           + +  +E  KK+      E +   S +   Q    ++  K   L  +KQ     +  +  
Sbjct: 433 TNEPLLERAKKENEVKRAELSENKSHVERLQESLTASGFKPELLKQLKQKEAELKTELYA 492

Query: 609 --TDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISV---ACP 663
             TDA      V N         +      + G   ++  L   ++ +D A ++   A  
Sbjct: 493 ISTDAEYLKRKVANLEFSYSPPSKEFNPKSVKGIAAQVFTLS--EENFDSANALQVCAGG 550

Query: 664 RLDDIVVETVECAQQCIE--HLRK-------NKLGYARFILLDKLKKFNMAKVTTPENVP 714
           RL +++V+  + A Q +E   LRK       NK+  AR I  D L   N AK   P  V 
Sbjct: 551 RLFNVIVDNEKTASQLLERGRLRKRVTIIPLNKIS-ARVINTDAL---NKAKSLAPGAVE 606

Query: 715 RLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTR-RFRVVTLDGKLIDISGTM 773
              +L   + E+ A A+  +   +L+ +D A A +V +  + R R +TLDG + D  GT+
Sbjct: 607 LALNLIGYEAEV-ARAMEFIFGGSLICRDAATAKKVTFHPQVRARSITLDGDIYDPEGTL 665

Query: 774 SGGGDRVVKGLMKSKQRSND-----MYTSEEVQRMEAELTDRE 811
           SGG       L+   Q+ N+     M   +E+ +++A +++ E
Sbjct: 666 SGGSRSHTSSLLIDIQKYNEAAKQMMVLEKELYQVQANISEHE 708

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1275 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMF 1346
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  124 bits (312), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 111/182 (60%), Gaps = 17/182 (9%)

Query: 1200 LNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMIT---------MGGNAE 1250
            L ES  K +E+   Y  +K+ R+  F+  F  +   +  IY+ +T          GG+A 
Sbjct: 1037 LKESERKAKEL---YLKIKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSAS 1093

Query: 1251 LELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1310
            L L D  +P+  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE
Sbjct: 1094 LTLEDEDEPYLGGIRYHATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDE 1153

Query: 1311 IDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLIGIYK----SSNMTKST 1365
            +DAALD  NV  +A YI+   +   QFIVISL++N+F  ++ + G+++    +S+M  +T
Sbjct: 1154 VDAALDVTNVERIAAYIRRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVITT 1213

Query: 1366 TL 1367
             L
Sbjct: 1214 DL 1215

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 94/186 (50%), Gaps = 20/186 (10%)

Query: 110 NLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNL 169
            L + NFKSY GV  VG    +F ++VGPNGSGKSN++D++ FV G R++ +R   L +L
Sbjct: 6   GLEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDL 65

Query: 170 IHKSE------NHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYY 223
           I++         HEN +  S  +T  YV  DA G  +       +   R +     S Y 
Sbjct: 66  IYRGRMEEGGSAHEN-NPKSAYVTAFYVKQDASGAER------RMEFTRVIHNTGDSTYK 118

Query: 224 INGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDII 283
           ++GK   Y E    L  E I +  + FL+ QG+VE I      A   G D L +  E + 
Sbjct: 119 LDGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQI------ASQSGVD-LTKLFEQVS 171

Query: 284 GTAKYK 289
           G+ +Y+
Sbjct: 172 GSVQYQ 177

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
            {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score =  124 bits (311), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 226/969 (23%), Positives = 409/969 (42%), Gaps = 154/969 (15%)

Query: 106  LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
            + I+ LI++ FKSYA   V+  +   F+A+ G NGSGKSNV+D++ FV G  + + +R  
Sbjct: 1    MKIEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRAS 60

Query: 165  KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYI 224
             L +LI+K      ++  SV I F  +  D   +     +  +LSV R++    TSKY I
Sbjct: 61   SLQDLIYK-RGQAGVTKASVTIVFSNL--DPKCSPIGFENSPKLSVTRQIILGGTSKYLI 117

Query: 225  NGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIG 284
            NG  +    V Q  ++  +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118  NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 285  TAKYKSQIRDALVEMDTL------NDICMEKEI--RFELVEKEKRSLEAGKEQALEFIAX 336
            T  ++ +   A   M         N   +++EI  + E +  EKR         LEF   
Sbjct: 171  TKMFEDRKGKAERTMGKKELKLKENRTLLQEEIEPQLEKLRNEKRIF-------LEFQEI 223

Query: 337  XXXXXXXXXXXXXWDINKETKKLAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDN 396
                         ++ +         + K S+  E L+   ++  EL   I+   E   +
Sbjct: 224  QTDLEKIQRIVLAYEYHS-------LVGKQSSIKETLDTGESRMAELHGLISKTGEEVMH 276

Query: 397  LEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENN 456
            L E + +IN EK          Q+EL  S+ KL  L ++ +     L     +   C  N
Sbjct: 277  LTEDLNRINYEK----------QKEL-DSDGKLGKLEKQESTLMNNLSRLRASFDICVEN 325

Query: 457  IRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIK-------------MSLRDKTSSISEEV 503
            I   NE                       +A K               L++  S  SE +
Sbjct: 326  I---NETAKNLESTKANIKTNKGKLEEKSEAWKNMEAEYRHLNKKGKELKESHSKKSELL 382

Query: 504  ASLEKELEP-------WTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIESYK 556
            ++L+  +         +T +L A    ++ AE   +++++S+LK+E     L K++ + K
Sbjct: 383  STLQTGISSVGTTGGGYTEQLAATKGNLQEAE---IVVQKSRLKIE----HLNKELHANK 435

Query: 557  DRIE----NHKKKINKLEKESAAITSFIS--TAQGECDSAKKKL----VDMKQVLTNHRQ 606
             ++E    ++++ +N+++K  +   +F       G   S  K+L      M+Q L N  +
Sbjct: 436  PKLEKARMDNEEGLNQIKKHKSIQDTFTEELNRYGYDPSVVKELRQKEYSMRQELHNVGR 495

Query: 607  RMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISV---ACP 663
                 R +++N+E    +            + G   +L  L   ++ YD A+++   A  
Sbjct: 496  ETEYLRRSVANIEFNYTMPSEKF---DPNSVKGVAAQLFTLS--ENNYDSALALQVCAGG 550

Query: 664  RLDDIVVETVECAQQCIEH--LRK-------NKLGYARFILLDKLKKFNMAKVTTPENVP 714
            RL +++V+    A Q +E   LRK       NK+   R I  + LK   +AK   P  V 
Sbjct: 551  RLFNVIVDDQNTASQLLERGKLRKRVTIIPLNKIA-TRVINSESLK---LAKQLAPGKVQ 606

Query: 715  RLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTR-RFRVVTLDGKLIDISGTM 773
               +L   + E+ + A+  +  ++LV  D   A R+ +  + R R +T  G + D  GT+
Sbjct: 607  LALNLVGYEEEV-SKAMEYIFGNSLVCNDAETAKRLTFHPQIRTRSITQQGDVYDPEGTL 665

Query: 774  SGGGDRVVKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKD 833
            SGG       L+   Q+ N    ++ ++ +E EL        + ++  +E E+A  K K+
Sbjct: 666  SGGSRNNKSTLLVDIQKYNS--AAKRMKVLEDELL-------VISNKLKEQESASAKTKE 716

Query: 834  RQPNIDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSE 893
             Q  ++  +  HK+ I                 + T   N     P   I  +   L  +
Sbjct: 717  IQNKLN--LVSHKLSI----------------FQRTLNEN-----PATQIIKRNDDLTRQ 753

Query: 894  LVALKDESKVKNEQISELRAQIMKI----------GGLKLQSQNSKVDSLTQQLQIIVAK 943
            +   ++E + K   +S+L+ +I KI           G KL+    ++DSLT+++  + + 
Sbjct: 754  IRECEEEIEQKQSYMSQLQDEIRKIQDDMEEFNNDKGTKLEKLKKEIDSLTKEIGKLDSI 813

Query: 944  QKKNRTELKKNELEMNRASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLI--- 1000
              K     +  +LE  + + +    E+ + H    L    N  ++L   L   EH +   
Sbjct: 814  TDKKYDLYQNLQLETEQLTSEISSDEDALEHMNTSLDNFQNQKKSLIAELEHAEHTLADV 873

Query: 1001 --EVIEDKK 1007
              EV E+KK
Sbjct: 874  HSEVDEEKK 882

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
           (SMC1) - SMC chromosomal ATPase family member [contig 7]
           FULL
          Length = 1225

 Score =  112 bits (279), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 115/219 (52%), Gaps = 36/219 (16%)

Query: 111 LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
           L LNNFKSY G   +G   S+F++++GPNGSGKSN++D++ FV G ++  +R   L++LI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 171 HK--------------SENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFK 216
           ++              SENH N ++      F    ++ D       DV ELS  R V +
Sbjct: 67  YRGTLSEEEASSADFESENHPNSAYVK---AFYSPSNNED-------DVVELS--RTVTR 114

Query: 217 NNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLL 276
           +  S Y I+GK   Y + +QFL +E I +  + FL+ QG+VE +A  KP+        L 
Sbjct: 115 SQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-------LT 167

Query: 277 EYLEDIIGTAKYKS---QIRDALVEMDTLNDICMEKEIR 312
           +  E + G+ +YK    +IR+ L    +    C++   R
Sbjct: 168 DLFEQVSGSLQYKQDYDRIREELERARSETSDCIQSRKR 206

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
           complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 90/159 (56%), Gaps = 19/159 (11%)

Query: 111 LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
           L LNNFKSY GV  VG   S+F++++GPNGSGKSN++D++ FV G +++ +R   L +LI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 171 HKS--------ENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKY 222
           ++          N+E+++  S  +   Y  +D            EL  MR +  +  S Y
Sbjct: 67  YRGFLSGDDEDNNNEDVNPNSAYVKAFYQKEDV---------THEL--MRSISNSGDSTY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIA 261
            IN K  SY + T FL +E I +  K FL+ QG+VE IA
Sbjct: 116 KINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
           Anc_8.68 YFL008W
          Length = 1232

 Score =  102 bits (255), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/182 (34%), Positives = 99/182 (54%), Gaps = 19/182 (10%)

Query: 113 LNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHK 172
           L+NFKSY G   +G   S+F++++GPNGSGKSN++D++ FV G R+N +R   + +LIH+
Sbjct: 9   LSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLIHR 68

Query: 173 S---ENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKES 229
           S       N    S  +   Y + DA        ++ EL  MR V  +  + Y INGK +
Sbjct: 69  SVRDSQSSNDDPTSAYVKAFYKVTDA-------SEITEL--MRIVNLSGETIYKINGKTT 119

Query: 230 SYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYK 289
           S+   + +L  E I +  K FL+ QG+VE+IA        +    L +  E + G+ +YK
Sbjct: 120 SFKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLFEQVSGSIQYK 172

Query: 290 SQ 291
            +
Sbjct: 173 KE 174

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score =  101 bits (252), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 102/186 (54%), Gaps = 15/186 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRAS 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDAD-GNTKV-LPDVQELSVMRKVFKNNTSKY 222
            L +LI+K      ++  SV I F    D+ D  N+ +   +  ++SV R+V    TSKY
Sbjct: 61  NLQDLIYK-RGQAGITKASVTIVF----DNTDKTNSPIGFNNSAKISVTRQVVLGGTSKY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            ING  +    V Q  ++  +++++  FLI+QG++  +  MKPK        +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEA 168

Query: 283 IGTAKY 288
            GT  +
Sbjct: 169 AGTKMF 174

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            +QFIV+SL+  MF  A ++ 
Sbjct: 1138 SQFIVVSLKEGMFSNANRVF 1157

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score =  101 bits (252), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 101/186 (54%), Gaps = 15/186 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDAD-GNTKV-LPDVQELSVMRKVFKNNTSKY 222
            L +LI+K      ++  SV I F    D+ D  NT +   +  ++SV R++    TSKY
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVF----DNTDKSNTPIGFSEYPKISVTRQIVLGGTSKY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            ING  +    V Q  ++  +++++  FLI+QG++  I  MKP         +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEA 168

Query: 283 IGTAKY 288
            GT  +
Sbjct: 169 AGTKMF 174

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFTNANRVF 1156

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 91/397 (22%), Positives = 177/397 (44%), Gaps = 53/397 (13%)

Query: 637 IHGFHGRLGDLGTIDDKYDIAISV-ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFIL 695
           + G    L  +   + KY I + + A  RL +++V+  +     ++  R  K      I 
Sbjct: 523 VKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTIIP 580

Query: 696 LDKL-------KKFNMAKVTTPENVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQAN 748
           LDK+        K  +AK   P  V    +L    +E+   A+  +  ++L+  D   A 
Sbjct: 581 LDKVISRPLNQNKLKLAKQLAPGKVELALNLIGYSDEV-VKAMEFIFGNSLICDDAETAK 639

Query: 749 RVAYGTR-RFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQRSNDMYTSEEVQRMEAEL 807
           ++ +    R R +TL+G + D  GT+SGG       L+   Q+ N +   +E+  M  E 
Sbjct: 640 KITFNPGIRTRSITLEGDIYDPEGTLSGGTRNNTNTLLVDIQQYNTL--KKELLAMNEEK 697

Query: 808 TDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEIS--KHKIDI--DTLSSE---LQSKK 860
            +     KI           L+   +   N+  E+S  KH++DI   T++SE   +   +
Sbjct: 698 QNIHKQLKI-----------LEAKSNETSNLQKELSLKKHRLDILERTMNSEPSLMMQNR 746

Query: 861 DTLIE-----LESTAENNQRDNGPL----EDIENQLVALN----SELVALKDESKVKNEQ 907
           +  IE     LE + +    +N  L    E +   +V  +    ++L  LK E    NEQ
Sbjct: 747 NGEIENEVKTLEDSTKQKMLENSSLEAEIEKLRKDMVDFSKNKGAKLKELKAEVHELNEQ 806

Query: 908 ISELRAQIMKIGG----LKLQSQN--SKVDSLTQQLQIIVAK-QKKNRTELKKNELEMNR 960
           I +L ++  K+      +K++++   +++D+ T+ L   V   +KK   E+K N++ +  
Sbjct: 807 IKDLESESEKLNDTYEKIKVETEQIANEIDTDTKSLDSTVQDIEKKLEEEIKINKM-LKT 865

Query: 961 ASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETE 997
           + ++ +  +ND+N     +S  ++  E L+  +++ E
Sbjct: 866 SEEELMSVQNDLNVERKRISNIDDELEELERTIKQKE 902

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score =  100 bits (250), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 180/748 (24%), Positives = 325/748 (43%), Gaps = 152/748 (20%)

Query: 642  GRLGDLGTIDDK-YDIAISV---ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLD 697
            G    L T+D + +D AI++   A  RL +I+V+    A Q +E  R  K      I L 
Sbjct: 525  GVAAQLFTVDQQQFDNAIALQVCAGGRLYNIIVDNEITASQLLERGRLKK--RVTIIPLS 582

Query: 698  KL-------KKFNMAKVTTPENVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRV 750
            K+           +AK   P  V    +L    +E+ + A+  +  + LV KD   A +V
Sbjct: 583  KIATRTLNKNTLALAKELAPGKVELALNLIGYDDEV-SKAMEFIFGNGLVCKDADTAKKV 641

Query: 751  AYGTR-RFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQRSNDMYTSEEVQRMEAELTD 809
             +    R R +T  G + D  GT+SGG     + L+   Q+ N  +   +V  +E +L +
Sbjct: 642  TFHPNIRTRSITQQGDVYDPEGTLSGGSRNTTRSLLVDIQKYN--HAVAKVNELELKLIE 699

Query: 810  RETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDIDTLSSELQSKKDTLIELEST 869
             +   K       E E   QK K  Q  ++  ++ HK++I                    
Sbjct: 700  MQKKLK-------EQEETSQKTKSLQNELN--LADHKLNIA------------------- 731

Query: 870  AENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQISELRAQIMKIGGLKLQSQNSK 929
                QR    +E+   Q++  N EL          +E++     QI+      ++ +N+ 
Sbjct: 732  ----QRR--LVENSAAQIIKRNKEL----------HEELQGCEEQIL------VEKKNAS 769

Query: 930  VDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAENDINHCEIELSKTNNSHEAL 989
                   L+I +   KK+  E  K+  + ++ SK K    N+I      +    N  E+L
Sbjct: 770  A------LEIEIETTKKDAEEFSKD--KNSKLSKLK----NEIEKLNKAIEDVENKSESL 817

Query: 990  QEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTHLEKLKN-- 1047
             +       L + ++ + EQL  E ++ K+ ++   A V K + E++ + +HL++L    
Sbjct: 818  YD-------LYQNLQLETEQLANEIKSNKEMMEQTKANVGKLEEEKVSVDSHLQELNTSL 870

Query: 1048 --LEHHIKAEISR---TDEELNTLKLRDVEQLLQ-KLD---EHNLPLESLTD-----RAV 1093
              ++  +K E +R    DEE     L+++E L++ K D   +H + L+ +T+     R  
Sbjct: 871  IEVQTRVKEERARLLGIDEE-----LKELESLVKSKQDTKSQHEIDLKKITNETNSFRQN 925

Query: 1094 TPSNQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMD--------VDQDASYIGPG 1145
            + + Q   E  +++H+   +    K I    +  N QE  +          +    + P 
Sbjct: 926  STNLQANIEKLIDEHEWLQDMEVVKGIVNQYHGINLQEYTERQKQLHEKFSEMKRKVNPN 985

Query: 1146 LPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVE 1205
            +  + E    N++ +E A     LK  + T   D   ++E   +L EYKR          
Sbjct: 986  IMSMIE----NVEKKETA-----LKTMIRTIEKDKMKIQETIGKLNEYKR---------- 1026

Query: 1206 KREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVL 1265
                     E L K+  E+  + FG       +I++ +     A+L   +  D  +EG+ 
Sbjct: 1027 ---------ETLIKT-WEKVTNDFG-------KIFEDLLPNSFAKLVPCEGKD-VTEGLE 1068

Query: 1266 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1325
              V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + +
Sbjct: 1069 VKVRLGTIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 1326 YIKERTKNAQFIVISLRNNMFELAQQLI 1353
             IK R K +QFIV+SL+  MF  A ++ 
Sbjct: 1129 LIKTRFKGSQFIVVSLKEGMFNNANRVF 1156

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 101/186 (54%), Gaps = 15/186 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRAS 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDAD-GNTKV-LPDVQELSVMRKVFKNNTSKY 222
            L +LI+K      ++  SV I F    D+ D  N+ +   +  ++SV R+V    TSKY
Sbjct: 61  SLQDLIYK-RGQAGVTKASVTIVF----DNTDKSNSPIGFTNSPQISVTRQVVLGGTSKY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            ING  +    V Q  ++  +++++  FLI+QG++  +  MKP         +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEA 168

Query: 283 IGTAKY 288
            GT  +
Sbjct: 169 AGTKMF 174

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFTNANRVF 1156

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 102/186 (54%), Gaps = 15/186 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRAS 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDAD-GNTKV-LPDVQELSVMRKVFKNNTSKY 222
            L +LI+K      ++  SV I F    D+ D  N+ +   +  ++SV R+V    TSKY
Sbjct: 61  SLQDLIYK-RGQAGVTKASVTIVF----DNTDKSNSPIGFTNSPQISVTRQVVLGGTSKY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            ING  +    V Q  ++  +++++  FLI+QG++  +  MKP         +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEA 168

Query: 283 IGTAKY 288
            GT  +
Sbjct: 169 AGTKMF 174

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFANANRVF 1156

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/186 (31%), Positives = 102/186 (54%), Gaps = 15/186 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRAS 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDAD-GNTKV-LPDVQELSVMRKVFKNNTSKY 222
            L +LI+K      ++  SV I F    D+ D  N+ +   +  ++SV R+V    TSKY
Sbjct: 61  SLQDLIYK-RGQAGVTKASVTIVF----DNTDKSNSPIGFANSPQISVTRQVVLGGTSKY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            ING  +    V Q  ++  +++++  FLI+QG++  +  MKP         +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEA 168

Query: 283 IGTAKY 288
            GT  +
Sbjct: 169 AGTKMF 174

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 106/189 (56%), Gaps = 15/189 (7%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +  + R  
Sbjct: 1   MKVEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRAS 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDAD-GNTKV-LPDVQELSVMRKVFKNNTSKY 222
            L +LI+K      ++  SV I F    D++D  N+ +   +  ++SV R++    TSKY
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVF----DNSDKTNSPIGFNNSSKISVTRQIILGGTSKY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            ING  +    V Q  ++  +++++  FLI+QG++  +  MKP       + +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEA 168

Query: 283 IGTAKYKSQ 291
            GT  ++++
Sbjct: 169 AGTKMFENR 177

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFSNANRVF 1156

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
           YFL008W
          Length = 1226

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 97/181 (53%), Gaps = 7/181 (3%)

Query: 111 LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
           L L NFKSY GV  VG   S+F++++GPNGSGKSN++D++ FV G R++ +R   +++LI
Sbjct: 7   LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 171 HKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESS 230
           ++    E       E                 P    + + R + KN  S Y I+ ++ +
Sbjct: 67  YRGVVPEEEDDGEGEGDGDAHRAYVSAFYSKGPQESTVELKRTISKNGDSTYQIDRRQVT 126

Query: 231 YTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKS 290
           Y + ++FL ++ I +  K FL+ QG+VE +A   P         L +  E++ G+A+YK 
Sbjct: 127 YKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------LTKLFEEVSGSAQYKK 179

Query: 291 Q 291
           +
Sbjct: 180 E 180

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
           YFL008W
          Length = 1223

 Score = 99.8 bits (247), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 103/207 (49%), Gaps = 35/207 (16%)

Query: 108 IKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS 167
           +  L L+NFKSY GV  +G   S+F++++GPNGSGKSN++D++ FV G R++ +R   L 
Sbjct: 4   LTGLELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILK 63

Query: 168 NLIHKS----------ENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKN 217
           +LI++           E+ E     S  +   Y MD      KV      + +MR +  N
Sbjct: 64  DLIYRGVIRDFSEEDPEDGEEQHPTSAYVKAFYEMD-----GKV------VELMRTININ 112

Query: 218 NTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLE 277
             + Y I+ K  SY +   FL  E I +  K FL+ QG+VE IA             L +
Sbjct: 113 GDTTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSAL-------DLSK 165

Query: 278 YLEDIIGTAKYKSQIRDALVEMDTLND 304
             E+I G+ +YK        E D+L D
Sbjct: 166 LFEEISGSIQYKK-------EYDSLKD 185

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 97/184 (52%), Gaps = 11/184 (5%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYI 224
            L +LI+K      ++  SV I F     D + +        ++SV R++    TSKY I
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVF--ANSDKNNSPIGFESYPKISVTRQIVLGGTSKYLI 117

Query: 225 NGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIG 284
           NG  +    V    ++  +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 285 TAKY 288
           T  +
Sbjct: 171 TKMF 174

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 177/720 (24%), Positives = 309/720 (42%), Gaps = 138/720 (19%)

Query: 661  ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKK-------FNMAKVTTPENV 713
            A  RL ++VV     A Q +E  R  K      I L+K+          N AK   P++V
Sbjct: 548  AGGRLFNVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDTVNFAKQLAPDSV 605

Query: 714  PRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTR-RFRVVTLDGKLIDISGT 772
                +L   ++E+ A A+  +   +L+ +D   A +V +  + R R +TL G + D  GT
Sbjct: 606  ELALNLIGYEDEV-AKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIYDPEGT 664

Query: 773  MSGGGDRVVKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYK 832
            +SGG       ++   Q+ N    S  +   EA+L D        T   ++    LQK K
Sbjct: 665  LSGGSRNNNSSILIDIQKYNAY--SRNLSESEAKLAD-------VTKRIKQYSEVLQKTK 715

Query: 833  DRQPNIDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNS 892
            + Q  ++  ++ HK  +                    AE N  +N  +     QL++ N 
Sbjct: 716  NLQNELN--LATHKFHL--------------------AERNLANNPSV-----QLMSRNK 748

Query: 893  EL---VALKDES-KVKNEQISELRAQIMKIGGLKLQ---SQNSKVDSLTQQLQIIVAKQK 945
            E+   + +  ES +  +E I +L A++  +    L+    + SK+D L +++  I     
Sbjct: 749  EIQDEIQMCLESMRSGSEDIKKLEAEVASVEKDMLEFSKDKGSKLDELKREISHI----- 803

Query: 946  KNRTELKKNELEMNRASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIED 1005
            +   E KK  LEM   S Q L         ++E+ + N+   A ++  +E+    + +E 
Sbjct: 804  RKDIEEKKIVLEMKDDSNQSL---------QLEMEQLNSDILAARDEFKESVEAAKELEQ 854

Query: 1006 KKEQLNQE-HETAKKNLDDKAAYVEKFKS-----EEIEMCTHLEKLKNLE-HHIKAEISR 1058
            KK  + Q+  ETA +  D K  + E+ K      +EI++ T L + K+ +    + E++R
Sbjct: 855  KKHSVEQKLEETANQLQDTKTEFSEQKKKLHEIDDEIKVLTDLLRTKSDQLRSDEVELAR 914

Query: 1059 TDEELNTLKLR--DVEQLLQKL--DEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMND 1114
               E   LK     VE+ +  L  DE  L  E L    VT  NQ I           +N+
Sbjct: 915  LSNETRKLKTNTSSVEEQITALLKDEDWLQDEGLVSSIVT-QNQGINLEAYRQRADQLNE 973

Query: 1115 GEAKLISE-DPNSFNDQESMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYM 1173
              + L  + +PN  +  ES++  + A                             LK  +
Sbjct: 974  KFSALRRKVNPNIMSMIESVEKKESA-----------------------------LKTMI 1004

Query: 1174 DTAYADIDILEEYALRLAEYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIIS 1233
             T   D   ++E   +L EYKR  L     ++  E++             +F + FG   
Sbjct: 1005 STIEKDKRKIQETVAKLNEYKRETL-----IKTWEKV-----------TVDFGNIFG--D 1046

Query: 1234 MTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLAL 1293
            +      +++ + G +           +EG+   +        ++  LSGG+++L +L+L
Sbjct: 1047 LLPNSFAKLVPIEGKS----------VTEGLEVKIRLGSIWKESLVELSGGQRSLIALSL 1096

Query: 1294 VFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLI 1353
            + AL ++KP P+Y++DE+DAALD  +   + + IK R K +QFIV+SL+  MF  A ++ 
Sbjct: 1097 ILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVF 1156

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 95.5 bits (236), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 103/197 (52%), Gaps = 15/197 (7%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + +  LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R  
Sbjct: 1   MKVAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRAS 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQEL--SVMRKVFKNNTSKY 222
            L +LI+K      ++  SV I F    D++D +   +     L  SV R++    TSKY
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVF----DNSDKSKAPIGFETSLTISVTRQIVLGGTSKY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            ING  +    V    ++  +++++  FLI+QG++  +  MKP         +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEA 168

Query: 283 IGTAKYKSQIRDALVEM 299
            GT  ++ +   A+  M
Sbjct: 169 AGTKMFEDRREKAIRTM 185

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 58/82 (70%), Gaps = 1/82 (1%)

Query: 1273 KSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1331
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1332 KNAQFIVISLRNNMFELAQQLI 1353
            K +QFIV+SL+  MF  A ++ 
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRVF 1156

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa]
           {ON} YJL074C (REAL)
          Length = 1229

 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 165/746 (22%), Positives = 301/746 (40%), Gaps = 146/746 (19%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + IK +I+  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGN----TKVLPDVQELSVMRKVFKNNTSK 221
              LIH+      +S  SVEI F     D D +    + VL    +   +R+        
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 222 YYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLED 281
           Y +N +  +  ++ + L   G  +++   ++ QG++ ++   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 282 IIGTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXXX 341
           ++G   ++ +++ +L +M+                E E++                    
Sbjct: 169 VVGAKSFEVKLKASLKKME----------------ETEQKK------------------- 193

Query: 342 XXXXXXXXWDINKETKKLAVTLDKISAFTEKLENERN---KYGELQKE-------ITDLR 391
                   + INKE       +D++++   ++E ER    KY EL+++       + D R
Sbjct: 194 --------FQINKE-------MDELNSKLTEMEQERKELEKYNELERKRKIYQYTLYD-R 237

Query: 392 ELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQV------ 445
           EL+D +  Q+ +++ + +  V    Q  +EL   E+ ++ +++K +  E +L++      
Sbjct: 238 ELNDVIN-QMERLDGDYNNTVYSSEQYIQELDKREDMIEQVSKKLSNIEASLKIKNTTDL 296

Query: 446 AEKNIRHCEN--NIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKTSSIS--- 500
            +  +R  E   N+  +N    E                   + IK  +R +   +S   
Sbjct: 297 QQAKLRESETSQNLTDVNVKIKEVELQIESNSEQRSLDSTTLEEIKSIIRQRKKKLSKIL 356

Query: 501 ---EEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIESYKD 557
              +E+   E   +     L+ K   + L + E    K      E+  + +  +IE  K 
Sbjct: 357 PRYQELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSK----EERDAWIYSEIEELKS 412

Query: 558 RIENHKKKINKLEKESAAITSFISTAQGEC----DSA-----KKKLVDMKQVLTNHRQRM 608
            ++N  ++ NKL+ E A++    S   GE     DS      K +L D    L N +Q++
Sbjct: 413 SVQNLNEQGNKLQTERASLKEQYSKIDGEIEELIDSVNGPDIKGQLEDFDSELINLKQKL 472

Query: 609 T---DAR---------------VALSNV-ENKNKVLGALCRLQKSGRIH----------- 638
               D R                 LS+V +N+  V   + R   +G I+           
Sbjct: 473 NGSLDTRKELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKIS 532

Query: 639 --GFHGRLGDLGTIDDKYDIAISV-ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFIL 695
                G LG+L  ++DKY     V     L  +VV+T E A   +  L + K G   FI 
Sbjct: 533 PESVFGTLGELIKVNDKYKACAEVIGGNSLFHVVVDTEETATLIMNELYRMKGGRVTFIP 592

Query: 696 LDKLKKFNMAKVTTPENVPRLFDLTTPKNEI-----FAPALYSVLRDTLVAKDLAQANRV 750
           L++L     + V  P N       T    +I     F  A+  V   T+V KDL Q  ++
Sbjct: 593 LNRLSL--DSDVKFPSNTTTQIQFTPLIKKIKYQPRFEKAVKHVFGRTIVVKDLGQGLKL 650

Query: 751 AYGTRRFRVVTLDGKLIDISGTMSGG 776
           A    +   +TLDG   D  G ++GG
Sbjct: 651 A-KKHKLNAITLDGDRADKRGVLTGG 675

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 51/79 (64%)

Query: 1277 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1336
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE +KNAQF
Sbjct: 1121 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSKNAQF 1180

Query: 1337 IVISLRNNMFELAQQLIGI 1355
            I  + R +M ++A +   +
Sbjct: 1181 ICTTFRTDMLQVADKFFRV 1199

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 98/186 (52%), Gaps = 15/186 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R  
Sbjct: 1   MRVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQ 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLP--DVQELSVMRKVFKNNTSKY 222
            L +LI+K      +   SV I F    D++D  +  +      ++SV R++    TSKY
Sbjct: 61  NLQDLIYK-RGQAGVIKASVTIVF----DNSDIKSSPIGFERYPKISVTRQIALGGTSKY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            ING  +    V    ++  +++++  FLI+QG++  +  MKP         +L  +E+ 
Sbjct: 116 LINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEA 168

Query: 283 IGTAKY 288
            GT  +
Sbjct: 169 AGTRMF 174

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFNNANRVF 1156

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 93.6 bits (231), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 96/184 (52%), Gaps = 11/184 (5%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQ 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYI 224
            L +LI+K      ++  SV I F     D   +        ++S+ R++     SKY I
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVFNN--SDTSNSPIGFESHAKISITRQIILGGVSKYLI 117

Query: 225 NGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIG 284
           NG  +    V Q  ++  +++++  FLI+QG++  +  MKP+        +L  +E+  G
Sbjct: 118 NGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAG 170

Query: 285 TAKY 288
           T  +
Sbjct: 171 TRMF 174

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 105/213 (49%), Gaps = 34/213 (15%)

Query: 1174 DTAYADIDILEEYALRLAEYKRRKLDLNES------------------VEKRE------- 1208
            DT+  +  + +   + L +YK+R  DL ES                  VEK+E       
Sbjct: 945  DTSMVNSILTQNKNINLDQYKKRGSDLAESFQSLRRKVNPEVMSMIESVEKKETALKTMI 1004

Query: 1209 --------EIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPF 1260
                    +I+   E L + + E  +  +  +S+    I+  +     A+LE  +  D  
Sbjct: 1005 KTIEKDKQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-V 1063

Query: 1261 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1320
            +EG+   V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEVKVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHT 1123

Query: 1321 SIVANYIKERTKNAQFIVISLRNNMFELAQQLI 1353
              + + IK R K +QFIV+SL+  MF  A ++ 
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVF 1156

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 98/186 (52%), Gaps = 15/186 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQG 164
           + ++ LI++ FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRAS 60

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDAD-GNTKV-LPDVQELSVMRKVFKNNTSKY 222
            L +LI+K      ++  SV I F    D+ D  N+ +       +SV R++    TSKY
Sbjct: 61  NLQDLIYK-RGQAGVTKASVTIVF----DNTDKSNSPIGFNTSPRISVTRQIVIGGTSKY 115

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            ING  +    V Q  ++  +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEA 168

Query: 283 IGTAKY 288
            GT  +
Sbjct: 169 AGTKMF 174

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            AQFIV+SL+  MF  A ++ 
Sbjct: 1141 AQFIVVSLKEGMFTNANRVF 1160

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 132/293 (45%), Gaps = 36/293 (12%)

Query: 642 GRLGDLGTIDDKYDIAISV----ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLD 697
           G    L TI+D    + S     A  RL ++VV+    A Q +E  R  K      I L+
Sbjct: 529 GVAATLFTINDNAIESASALQVCAGGRLYNVVVDNETTASQLLEKGRLRK--RVTIIPLN 586

Query: 698 KL-------KKFNMAKVTTPENVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRV 750
           K+          N AK   P  V    +L    +E+ + A+  +   +L+ KD   A +V
Sbjct: 587 KIASRRLNENTVNFAKQLAPGKVDLALNLIGYSDEL-SRAMEFIFGTSLICKDSETAKKV 645

Query: 751 AYGTR-RFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQRSNDMYTSEEVQRMEAELTD 809
            +    R R +TL+G + D  GT+SGG       L+   Q  N   T  E++ +E  L D
Sbjct: 646 TFHQNIRQRSITLEGDVYDPEGTLSGGSRNNKNSLLLDIQHYNK--TCNEIKILEENLRD 703

Query: 810 RETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKI-----DIDTLSSELQSKKDTLI 864
                KI  +  +++ +A +  ++     D+ +++HK+      +D+  S    K++  I
Sbjct: 704 ----IKIKLNEQEKIYSASKVIQN-----DLNLAEHKLAMAQRSVDSNQSTQLIKRNEAI 754

Query: 865 ELE-STAENN-QRDNGPLEDIENQLVALNSELVALKDESKVKNEQISELRAQI 915
            LE  + EN+  ++   LE I+N ++ +  ++    ++   K  ++ EL+ +I
Sbjct: 755 SLEIKSCENSITQEQNKLESIQNSIIQIEKDINEFNND---KGSKLKELQQEI 804

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1228

 Score = 92.0 bits (227), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 101/199 (50%), Gaps = 19/199 (9%)

Query: 111 LILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLI 170
           L L+NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R   L +L+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 171 HKSE---NHENLSFCSVEITFQYVMDDADGNTKVLPDVQE--LSVMRKVFKNNTSKYYIN 225
           ++     + E         +       A      L + +E  +  MR + ++  S Y +N
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEGEESPIEFMRTISRSGESAYKVN 126

Query: 226 GKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGT 285
           GK   Y + T  L  E I +  + FL+ QG+VE IA     +   G+  L +  E I G+
Sbjct: 127 GKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIA-----SQSAGE--LTKLFEQISGS 179

Query: 286 AKYKSQIRDALVEMDTLND 304
            +YK        E + LND
Sbjct: 180 VQYKR-------EYEILND 191

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
           similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 180/736 (24%), Positives = 304/736 (41%), Gaps = 136/736 (18%)

Query: 108 IKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS 167
           IK +I++ FK+Y    VV  F    + VVG NGSGKSN   ++ FV     + +++    
Sbjct: 4   IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRK 63

Query: 168 NLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLP---DVQELSVMRKV-FKNNTSKYY 223
             I++       +F  VEI F    DD + N  + P   D  E+ + R V  K +  +Y 
Sbjct: 64  GFIYQGAGQVMSAF--VEIIF----DDPE-NLMLAPLRNDTGEVRIRRTVGLKKD--EYM 114

Query: 224 INGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDII 283
           IN K S+  +V + L N G    +   ++ QG + S+   K       D   L  LED++
Sbjct: 115 INDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLEDVV 167

Query: 284 GTAKYKSQIRDALVEMDTLNDICMEKE---IRFELVEKEKRSLEAGKEQALEFIAXXXXX 340
           G   ++++++++L +M+       E++   I  EL E +KR  E   E+           
Sbjct: 168 GAKSFENKLKESLKKME-----AAERDRTKITNELNELDKRLSELSDEK----------- 211

Query: 341 XXXXXXXXXWDINKETKKLAVT-----LDKISAFTEKLENERNK--------YGELQKE- 386
                     ++N++ K L        L+ I+   E+LE E N           EL+K  
Sbjct: 212 ---EELEKYNNLNRDRKVLQFCLYDRELNDITNQIEQLEGEYNSIIENSSEYVNELEKRE 268

Query: 387 --ITDLRELSDNLEEQI-TKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTL 443
               +L +  ++LE +I  K + +  QL   KL++  EL   + +L  +  +   ++  L
Sbjct: 269 VLAVELNKRMNSLESEIKIKQSTDLPQLKASKLEVAGELADLDTRLNDIQMQLDASQAHL 328

Query: 444 QVAEKNI----RHCENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKTSSI 499
           +   K I    +  E N   + E Q +F                  + +K+ + +K +  
Sbjct: 329 ESNVKEIGEVKKQIEINCSSIAEVQPKF-----------QKLSNEAEILKVEI-EKLTKR 376

Query: 500 SEEVASLEKELEPWTTKLEAKNSQIK---------LAESEILIIKESKLKLEQEISQLRK 550
             E+ S + + E + T +  +N  I+         L +S IL     K +L  ++S L+ 
Sbjct: 377 QRELLSKKGKYEDFRT-VNERNDWIQEQINLLNQSLNKSNIL-----KDQLTSQLSTLQH 430

Query: 551 DIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKL---VDMKQVLTNHRQR 607
           D+E+    IE+    +N +   +          Q +   AKK+    +D ++ L    QR
Sbjct: 431 DLENLNAEIEDLADSVNGMGSVAQQ-----EDLQNKVTQAKKEYLTKIDQRKQLWRTEQR 485

Query: 608 MTDARVALSN--------------------VENKNKVLGALCRLQKSGRIHGFHGRLGDL 647
           +     +L N                    ++N N ++    RL     + G  G   +L
Sbjct: 486 LQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVN---RLNLHEHVFGPVG---EL 539

Query: 648 GTIDDKYDI-AISVACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAK 706
             + DKY I A  V    L ++VV+  E A   I+ L   K G   FI L+KL       
Sbjct: 540 IKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLHV--DTN 597

Query: 707 VTTPENVPRLFDLTTP-----KNEI-FAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVV 760
            T P N+ +  +  TP     K ++ F   +  V   TLV K L     +A    +   +
Sbjct: 598 FTYPNNLEK--NQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLA-KEYKLNAI 654

Query: 761 TLDGKLIDISGTMSGG 776
           TLDG   D  G +SGG
Sbjct: 655 TLDGDRADSKGVLSGG 670

 Score = 68.9 bits (167), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 53/98 (54%)

Query: 1278 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1337
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1338 VISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILNI 1375
              + R +M  +A     +   + ++  T +   D +N 
Sbjct: 1177 CTTFRTDMINVADTFFRVKFENKVSTVTEVSRQDAVNF 1214

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query: 1256 SLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1313
            S++    GV  SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1314 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNID 1371
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A +    Y+     K +T+  +D
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKF---YRVKYENKISTVIEVD 1210

 Score = 65.5 bits (158), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 90/195 (46%), Gaps = 9/195 (4%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + I+ +++  FK+Y    ++  F    + V+G NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYIN 225
              LIH+     ++   SVEI F          + + P   +   +R+        Y +N
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPSHRIILPSGIPPRENDEVFVRRTVGLKKDDYQLN 118

Query: 226 GKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGT 285
            +  + ++V + L + G  + +   ++ QG + ++   K       D   L  LE+++G 
Sbjct: 119 DRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK-------DRERLHLLEEVVGA 171

Query: 286 AKYKSQIRDALVEMD 300
             ++ ++R +L +MD
Sbjct: 172 KSFEVKLRASLKKMD 186

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 89/186 (47%), Gaps = 41/186 (22%)

Query: 1205 EKREEIRNRYEMLKKSR--LEEFMDG------------FGIISMTVKEIYQMITMGGNAE 1250
            EKREE+ NR E L +S+  +EE +D             F  ++     I++ +   G  +
Sbjct: 1003 EKREELENRAEELARSKESIEELVDSLKKQKIEAVEATFSKVANNFTHIFEKLVPAGVGK 1062

Query: 1251 LELV-------------------------DSLDPFSEGVLFSVMPPKKSWRN--ISNLSG 1283
            L +                          DS++    GV  SV    K+     +  LSG
Sbjct: 1063 LVIHRNESTRNASGGRGPQQGSGASGNEDDSIETMYSGVSISVSFNSKNNEQLYVEQLSG 1122

Query: 1284 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1343
            G+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IKE + +AQFI  + R+
Sbjct: 1123 GQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANVIKELSVHAQFICTTFRS 1182

Query: 1344 NMFELA 1349
            +M ++A
Sbjct: 1183 DMLQVA 1188

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 95/202 (47%), Gaps = 17/202 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + IK++++  FK+Y     V      F+ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGN---TKVLPDVQELSV-MRKVFKNNTSK 221
              LIH+     ++    VEI F     D  G    T  +P  +E  V +R+       +
Sbjct: 61  RQGLIHQGTG--SVMSAYVEIIFH----DPSGQMMITSGIPMTEEHIVRVRRTIGLKKDE 114

Query: 222 YYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLED 281
           Y +NGK    +++++   + G    +   ++ QG + ++   K       D   L  LE+
Sbjct: 115 YSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAK-------DRERLALLEE 167

Query: 282 IIGTAKYKSQIRDALVEMDTLN 303
           ++G   ++ ++R++  +M+  N
Sbjct: 168 VVGAKSFEIKLRESAKKMEATN 189

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (60%), Gaps = 2/99 (2%)

Query: 1259 PFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1316
            P   GV  SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1317 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1355
             +  + VAN +KE +KNAQFI  + R +M ++A +   +
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRV 1197

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 94/198 (47%), Gaps = 18/198 (9%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + IK +I+  FK+Y    ++  F    + ++G NGSGKSN+  ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 166 LSNLIHK-SENHENLSFCSVEITFQYVMDDAD------GNTKVLPDVQELSVMRKVFKNN 218
              LIH+ +    ++  CSVEI F     D D       N  ++P       +R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFH----DPDNRMILASNASIVPRPNNEVFIRRTVGLK 116

Query: 219 TSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEY 278
              Y IN +  + +++ + L   G  + +   ++ QG++ ++   K K         L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------LQL 169

Query: 279 LEDIIGTAKYKSQIRDAL 296
           LED++G   ++ ++ D+L
Sbjct: 170 LEDVVGAKSFEIKLNDSL 187

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 80/171 (46%), Gaps = 26/171 (15%)

Query: 1205 EKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELEL----------- 1253
            + +E I    E LKK ++E     F  ++     I++ +   G   L +           
Sbjct: 1041 QSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGT 1100

Query: 1254 -------------VDSLDPFSEGVLFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALH 1298
                          D+LD    GV  SV    K+     +  LSGG+KT+ ++AL+ A+ 
Sbjct: 1101 GQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQ 1160

Query: 1299 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1349
               P P Y+ DEIDAALD +  + VAN IKE + +AQFI  + R +M ++A
Sbjct: 1161 MVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVA 1211

 Score = 72.0 bits (175), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 98/201 (48%), Gaps = 15/201 (7%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + I+++++  FK+Y  +  V  F   F+ V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADG--NTKVLPDVQELSV-MRKVFKNNTSKY 222
              LIH+     ++    VEI F    D +D    T  +P  +E  V +R+       +Y
Sbjct: 85  RQGLIHQGTG--SIMSAYVEIVFH---DPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEY 139

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            +NGK    +++++   + G    +   ++ QG + ++   K       D   L  LED+
Sbjct: 140 SVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAK-------DKERLLLLEDV 192

Query: 283 IGTAKYKSQIRDALVEMDTLN 303
           +G   ++ ++R++  +M+  N
Sbjct: 193 VGARSFEIKLRESSKKMEATN 213

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
            (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1275 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMF 1346
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 1277 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1336
            ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  + VAN IKE + NAQF
Sbjct: 1119 HVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYRTSVANTIKELSANAQF 1178

Query: 1337 IVISLRNNMFELA 1349
            I  + R++M  +A
Sbjct: 1179 ICTTFRSDMLRVA 1191

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 124/276 (44%), Gaps = 33/276 (11%)

Query: 528 ESEILIIKESKLKLE---QEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQ 584
           +SEI  +K+    LE   QE+SQ R D++     ++   K++N    +   IT+ +    
Sbjct: 402 QSEIADLKQEAQILESTYQELSQERSDLQEQLAELDEQAKELND-SIQGPGITAELEDLN 460

Query: 585 GECDSAKK----KLVDMKQVLTNHRQRMTDARVALSNVENKNKVL----------GALCR 630
            E    K+    K+ + K++  + ++  T     + +V+   + +          G    
Sbjct: 461 SEISQLKQLYTTKIDERKELWRSEQKLQTILETLMDDVKRSERSVNETMDRSLANGLKAV 520

Query: 631 LQKSGRI----HGFHGRLGDLGTIDDKYD-IAISVACPRLDDIVVETVECAQQCIEHLRK 685
            + S R+    +  +G LG+L  +++KY   A +V    L  +VV+T + A   ++ L  
Sbjct: 521 REISERLKLPENAVYGPLGELIKVNEKYKTCAETVGGNSLFHVVVDTEDTAGLLMQELYN 580

Query: 686 NKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPK---NEIFAPALYSVLRDTLVAK 742
            K G   F+ L++L   N   VT P N          K   +E F  A+  V   T+V +
Sbjct: 581 VKGGRVTFMPLNRLHADN--NVTYPSNEQSNCTALIKKIKYDEKFERAVKHVFGKTIVVR 638

Query: 743 DLAQANRVAYGTRRFRV--VTLDGKLIDISGTMSGG 776
           DL    ++A   R++++  +TLDG   D  G ++GG
Sbjct: 639 DLTLGTKLA---RQYKLNAITLDGDRADKRGVLTGG 671

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 99/217 (45%), Gaps = 32/217 (14%)

Query: 1165 EIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLDLNESVEKREEIRNRYEMLKKSRLEE 1224
            +I+ LK     A+ +     E  L L E + ++LD     E +  I+N    LK+ ++  
Sbjct: 983  DISGLKNVNKKAFENFKKFHEKKLEL-EDRSKELD-----ESKTSIQNLIVKLKQQKVAA 1036

Query: 1225 FMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSE---------------------- 1262
                F  +S    E+++ +   G A+L +  S D   +                      
Sbjct: 1037 VDSTFENVSRNFTEVFEQLVPRGKAKLVIHRSSDARDDDVDAENDTAMTGDDDGTQTESM 1096

Query: 1263 --GVLFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1318
              GV  SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +
Sbjct: 1097 YTGVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQ 1156

Query: 1319 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1355
              + VA  IK  + NAQFI  + R +M ++A +   +
Sbjct: 1157 YRTAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV 1193

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 95/199 (47%), Gaps = 17/199 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + I+ +I+  FK+Y    V+  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGN----TKVLPDVQELSVMRKVFKNNTSK 221
              LIH+     ++   SVEI F     D D      + V P   +  ++R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFH----DPDHRIILPSGVAPRSNDEVLVRRTVGLKKDD 114

Query: 222 YYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLED 281
           Y +N +  +  +V + L + G  +++   ++ QG + ++   K K         L+ LED
Sbjct: 115 YQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDKER-------LQLLED 167

Query: 282 IIGTAKYKSQIRDALVEMD 300
           ++G   ++ ++R +L +M+
Sbjct: 168 VVGAKSFEVKLRASLKKME 186

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 72/146 (49%), Gaps = 10/146 (6%)

Query: 635 GRIHGFHGRLGDLGTIDDKYDI-AISVACPRLDDIVVETVECAQQCIEHLRKNKLGYARF 693
           GR+ G    LG+L  +++KY + A  V    L  IVV+T E A   I+ L + + G   F
Sbjct: 533 GRVFG---TLGELIKVNEKYKMCAEVVGGNSLFHIVVDTDETASLMIQELYRMRGGRVTF 589

Query: 694 ILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEI---FAPALYSVLRDTLVAKDLAQANRV 750
           + L+++  +N   +T P N          K +    F   + +V   T+V +DLA  +++
Sbjct: 590 MPLNRI--YNDPNITYPPNAQSSCTPLIKKIKFDAQFESVVKNVFGKTIVVRDLAAGSKI 647

Query: 751 AYGTRRFRVVTLDGKLIDISGTMSGG 776
           A   +    +TLDG   D SG ++GG
Sbjct: 648 AKHYK-LDAITLDGDRADKSGLLTGG 672

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/98 (41%), Positives = 60/98 (61%), Gaps = 2/98 (2%)

Query: 1257 LDPFSEGVLFSV-MPPKKSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1314
            L+    GV  SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1315 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1352
            LD +  + VAN IK+ +KNAQFI  + R +M  +A + 
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRF 1192

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 93/198 (46%), Gaps = 17/198 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + IK +++  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADG----NTKVLPDVQELSVMRKVFKNNTSK 221
              LIH+     ++   SVEI F     D D     ++ V+P   +   +R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFH----DPDHRIILSSGVIPRPNDEVFVRRTVGLKKDD 114

Query: 222 YYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLED 281
           Y IN +  + +++ + L + G  +     ++ QG + ++   K K         L  LED
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLLED 167

Query: 282 IIGTAKYKSQIRDALVEM 299
           +IG   +++++R +L  M
Sbjct: 168 VIGAKSFETKLRASLKNM 185

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 64/145 (44%), Gaps = 12/145 (8%)

Query: 639 GFHGRLGDLGTIDDKY-DIAISVACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLD 697
              G LG+L  + +KY   A  V    L  +VV+T + A   +  L K K G   F+ L+
Sbjct: 534 AVFGTLGELLKVSEKYKTCAEVVGGNSLFHVVVDTDKTASLLMRELYKMKGGRVTFMPLN 593

Query: 698 KLKKFNMAKVTTPEN------VPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRVA 751
           +L +   + VT P         P L  +       F  A+  V   T+V +DL    ++A
Sbjct: 594 RLHE--DSGVTFPPQDQSAACTPLLKKIKYDAK--FEKAVKHVFGKTIVVRDLTTGVKMA 649

Query: 752 YGTRRFRVVTLDGKLIDISGTMSGG 776
             + +   +TLDG   D  G ++GG
Sbjct: 650 -KSYQLNAITLDGDRADNRGVLTGG 673

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 63/106 (59%), Gaps = 2/106 (1%)

Query: 1252 ELVDSLDPFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1309
            E++++ +    GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1310 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1355
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   +
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV 1197

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 97/198 (48%), Gaps = 13/198 (6%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + IK +++  FK+Y    V+  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLP--DVQELSVMRKV-FKNNTSKY 222
              LIH+      +S  SVEI F          + V+P  +  E+ + R V  K +   Y
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKD--DY 117

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDI 282
            +N +  +  +V + L + G  + +   ++ QG++ S+   K K         L+ LED+
Sbjct: 118 QLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLEDV 170

Query: 283 IGTAKYKSQIRDALVEMD 300
           +G   ++ +++ +L +M+
Sbjct: 171 VGAKSFEVKLKASLKKME 188

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1216

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 151/732 (20%), Positives = 302/732 (41%), Gaps = 121/732 (16%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + I+ +I+  FK+Y    ++  F   ++ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELS-----VMRKVFKNNTS 220
              LIH+     ++   SVEI F        GN+ +LP    ++      +R+       
Sbjct: 61  RQGLIHQGSG--SVMSASVEIQFY-----DPGNSMILPSGVAVNPDSTVSIRRTVGLKKD 113

Query: 221 KYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLE 280
            Y IN +  + +++ + + + G  + +   ++ QG + ++   K K         L+ LE
Sbjct: 114 DYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER-------LQILE 166

Query: 281 DIIGTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAXXXXX 340
           D++G   +++++  +L +M+                E EK+ ++  KE   E        
Sbjct: 167 DVVGAKSFEAKLTASLKKME----------------ETEKKRMQIAKEMK-ELTKKLDEM 209

Query: 341 XXXXXXXXXW-DINKETKKLAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEE 399
                    + D+  + K    TL     +  +L +  N+  +L+ E T++   S+   +
Sbjct: 210 EEERKELEKYNDLEGDRKVFQFTL-----YDRELNDIINQIEKLESEYTNILYTSEQYLQ 264

Query: 400 QITKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRR 459
           ++ K    +  +V D   + + L ++E  LK       K    LQ A+ +    +N +  
Sbjct: 265 ELDK----REGIVVD---ITKTLQNTEASLK------LKGTTELQQAKFHFTDLQNKVAN 311

Query: 460 ----LNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKTSSIS--EEVASLEKELEPW 513
               +N+ Q++                   DAIK   +     +   EE+   E EL   
Sbjct: 312 YDVTINDIQSQINSQEEQTKIDQNNLNILSDAIKEKRKLVAECLPKFEELTKQENELRSV 371

Query: 514 TTKLE----------AKNSQIKLAESEILIIKESKLKLEQEISQLRKDIESYKDRIENHK 563
              L+           K ++    E     I E    +++E + L+ + E      E ++
Sbjct: 372 LASLQERQKNLMIKKGKYAKFTTVEERNKWIDEEVANIKEEFTLLKTNKEQLTSEQEYNE 431

Query: 564 KKINKLEKESAAITSFISTAQ-----GECDSAKKKLVDMKQVLTNHRQRMTDARVALSNV 618
           +++ KL+++   I   I + Q     GE D  K+K+  +K   T + Q+  DAR  L   
Sbjct: 432 QEVKKLDED---IEDLIDSTQGPVVLGELDEVKEKIAKVK---TEYSQKF-DARRELWRE 484

Query: 619 ENK-NKVLGALCR-LQKSGRI------HGFHGRLGDLGTIDDKYDIAISVACPRLDDIVV 670
           E +   +L  +   +++S RI            + ++  I DK ++        L ++ +
Sbjct: 485 EQRLQTILENMSEGVKRSERILNETMHRSVANGIKNVKEIVDKLNLPDDAVLGTLGEL-I 543

Query: 671 ETVECAQQCIEHLRKNKL-------GYARFILLDKLKKFNMAKVT-TPENVPRL-FDLTT 721
           +  E  ++C E +  N L            +++D+L +    +VT  P N  R+  + T 
Sbjct: 544 KVSEKYKRCAEVIGGNSLFNIVVDTDETASLIMDELYRMKGGRVTFMPLNRIRMDSNFTY 603

Query: 722 PKNEI---------------FAPALYSVLRDTLVAKDLAQANRVAYGTRRFRV--VTLDG 764
           P N+                +  A+  V   T+V KDL + +++A   +RF++  +TLDG
Sbjct: 604 PPNDQASCTPLIKKIKFDVRYEKAVMHVFGKTIVVKDLGEGSKLA---KRFKMNAITLDG 660

Query: 765 KLIDISGTMSGG 776
              D  G ++GG
Sbjct: 661 DRADKRGELTGG 672

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 51/79 (64%)

Query: 1277 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1336
            ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQF
Sbjct: 1108 HVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYRTAVADVIKSLSSNAQF 1167

Query: 1337 IVISLRNNMFELAQQLIGI 1355
            I  + R +M ++A +   +
Sbjct: 1168 ICTTFRTDMLQVADKFFRV 1186

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 75.5 bits (184), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 1257 LDPFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1314
            ++P   GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1315 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGI 1355
            LD +  + VA  I++ + NAQFI  + R +M E+A     +
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRV 1199

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 95/201 (47%), Gaps = 20/201 (9%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + IK +++  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGNTK------VLPDVQELSVMRKVFKNNT 219
              LIH+      +S  SVEI F       D N K      V+P   +   +R+      
Sbjct: 61  RQGLIHQGSGGAVMS-ASVEIVFH------DPNHKIILPSGVVPRENDEVYIRRTVGLKK 113

Query: 220 SKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYL 279
             Y +N +  +  +V + L + G  +++   ++ QG++ ++   K K         L  L
Sbjct: 114 DDYQLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDKE-------RLNLL 166

Query: 280 EDIIGTAKYKSQIRDALVEMD 300
           ED++G   ++ +++ +L +MD
Sbjct: 167 EDVVGAKSFELKLKASLKKMD 187

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
           complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 75.5 bits (184), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 96/195 (49%), Gaps = 9/195 (4%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + I  +++  FK+Y    V+  F  +++ V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYIN 225
              LIH+     ++   SVEI F+         + V+P   +   +R+        Y +N
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFRDPGHRMILPSGVVPRENDEIFIRRTVGLKKDDYQVN 118

Query: 226 GKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGT 285
            +  + ++V + L + G  + +   ++ QG + ++   K       D   L+ LED++G 
Sbjct: 119 DRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAK-------DKERLQLLEDVVGA 171

Query: 286 AKYKSQIRDALVEMD 300
             ++S++R +L +MD
Sbjct: 172 KSFESKLRASLKKMD 186

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 51/79 (64%)

Query: 1277 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1336
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE +KNAQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQF 1181

Query: 1337 IVISLRNNMFELAQQLIGI 1355
            I  + R +M ++A +   +
Sbjct: 1182 ICTTFRTDMLQVADKFFRV 1200

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 95/199 (47%), Gaps = 16/199 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + IK +I+  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGN----TKVLPDVQELSVMRKVFKNNTSK 221
              LIH+      +S  SVEI F     D D +    + VL    +   +R+        
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 222 YYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLED 281
           Y +N +  +  ++ + L   G  +++   ++ QG++ ++   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 282 IIGTAKYKSQIRDALVEMD 300
           ++G   ++ +++ +L +M+
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
           Ashbya gossypii AAL182W
          Length = 1232

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 106/215 (49%), Gaps = 16/215 (7%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + I+ +I++ FK+Y     +  F +  + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKV-LPDVQELSVMRKVFKNNTSKYYI 224
             +LI++  +  ++    VEI F     DA+  T + +PD      +R+       +Y I
Sbjct: 61  RRSLIYQGTS--SVMSGYVEIVFH----DAENRTLLGIPDSNGAIRIRRTVGLKKDEYMI 114

Query: 225 NGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIG 284
           N K SS ++V + L + G    +   ++ QG + S+   K       D   L+ LE+++G
Sbjct: 115 NNKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAK-------DRERLQLLEEVVG 167

Query: 285 TAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKE 319
              ++ +++++L  MD        ++IR EL E E
Sbjct: 168 AKSFERKLKESLQRMDATEK--NREKIRIELQEVE 200

 Score = 72.8 bits (177), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 64/123 (52%), Gaps = 2/123 (1%)

Query: 1255 DSLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1312
            D+ D    GV   V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1313 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDI 1372
            AALD +  + VA  IKE +  AQFI  + R++M  +A +   +   + ++    +   D 
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRVKYENKISTVVEVTRTDA 1212

Query: 1373 LNI 1375
            L+ 
Sbjct: 1213 LHF 1215

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 69/143 (48%), Gaps = 15/143 (10%)

Query: 642 GRLGDLGTIDDKYD-IAISVACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLK 700
           G LG+L  + +KY   A  V    L  +VV+T   A   ++ L  +K G   F+ L+++ 
Sbjct: 534 GPLGELIKVSEKYKTCAEVVGGNSLFHVVVDTENTASLIMQELYNSKGGRVTFMPLNRI- 592

Query: 701 KFNMAKVTTPENVPRLFDLTTPKNEI-----FAPALYSVLRDTLVAKDLAQANRVAYGTR 755
            +    +  P N    ++ T    +I     F  A+  V   T+V KDL Q +++A   +
Sbjct: 593 -YVDPNIQYPSNEE--YNCTPLIKKIKFDGKFEKAVKHVFGKTIVVKDLLQGSKLA---K 646

Query: 756 RFRV--VTLDGKLIDISGTMSGG 776
           +F +  VTLDG   D  G ++GG
Sbjct: 647 QFNLNSVTLDGDKADNKGVLTGG 669

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 50/79 (63%)

Query: 1277 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1336
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + NAQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATMIKELSTNAQF 1181

Query: 1337 IVISLRNNMFELAQQLIGI 1355
            I  + R +M ++A +   +
Sbjct: 1182 ICTTFRTDMLQVADKFFRV 1200

 Score = 65.9 bits (159), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 95/199 (47%), Gaps = 16/199 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + IK +++  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGN----TKVLPDVQELSVMRKVFKNNTSK 221
              LIH+      +S  SVEI F     D D +    + VL    +   +R+        
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 222 YYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLED 281
           Y +N +  +  ++ + L   G  +++   ++ QG++ ++   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 282 IIGTAKYKSQIRDALVEMD 300
           ++G   ++ +++ +L +M+
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 72.4 bits (176), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 78/152 (51%), Gaps = 5/152 (3%)

Query: 1217 LKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKS-- 1274
            LK+ ++      F  +S    +I++ +   G  EL +      +S GV   V    K+  
Sbjct: 955  LKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSKNDE 1013

Query: 1275 WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1334
               I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  ++N 
Sbjct: 1014 QLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLSQNG 1073

Query: 1335 -QFIVISLRNNMFELAQQLIGIYKSSNMTKST 1365
             QFI+ + R++M E+A  +I + K  N   S 
Sbjct: 1074 TQFILTTFRSDMIEIA-DMIYMVKYHNKVSSV 1104

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 88/180 (48%), Gaps = 13/180 (7%)

Query: 639 GFHGRLGDLGTIDDKYDIAISV-ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLD 697
             +G LG+L  + +KY   + + A   L +I+V+T E A Q +  L + + G   FI L+
Sbjct: 460 SIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPLN 519

Query: 698 KLKKFNMAKVTTPENVPRLFDLTTPK---NEIFAPALYSVLRDTLVAKDLAQANRVAYGT 754
           +++  N   +  P N          K   ++ F   + +V   T+V KDL   NR+    
Sbjct: 520 RIE--NGVNINYPSNEESNCTALIKKIKYDKKFEKVIRNVFGKTIVVKDLQLGNRLC-KE 576

Query: 755 RRFRVVTLDGKLIDISGTMSGG----GDRVVKGLMKSKQRSNDMY--TSEEVQRMEAELT 808
            + + +TLDG  ID  G +SGG      R     +K  QRS ++Y  T +E+ +++ E++
Sbjct: 577 FKLQAITLDGDRIDSKGVVSGGYFNINRRSRLDNLKELQRSRNVYKNTMKELAQIKDEIS 636

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 72.4 bits (176), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 56/96 (58%), Gaps = 3/96 (3%)

Query: 1259 PFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1316
            P+ EGV  SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1317 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1352
             +    VA  I + + NAQFI  + R++M + A + 
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKF 1186

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 92/196 (46%), Gaps = 9/196 (4%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + IK +I+  FK+Y    ++G F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSV-MRKVFKNNTSKYYI 224
              LIH+      +S  SVEI F          T +  +     V +R+        Y +
Sbjct: 61  RQGLIHQGAGASVMS-ASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQV 119

Query: 225 NGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIG 284
           N +  +  ++ + L + G  + +   ++ QG + S+   K K         L+ LE+++G
Sbjct: 120 NDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEVVG 172

Query: 285 TAKYKSQIRDALVEMD 300
              ++ +++ ++ +MD
Sbjct: 173 AKSFEVKLKASMKQMD 188

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 50/79 (63%)

Query: 1277 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1336
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + +AQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSNDAQF 1181

Query: 1337 IVISLRNNMFELAQQLIGI 1355
            I  + R +M ++A +   +
Sbjct: 1182 ICTTFRTDMLQVADKFFRV 1200

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 94/199 (47%), Gaps = 16/199 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + IK +++  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGN----TKVLPDVQELSVMRKVFKNNTSK 221
              LIH+      +S  SVEI F     D D +    + VL    +   +R+        
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 222 YYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLED 281
           Y +N +  +  ++ + L   G  + +   ++ QG++ ++   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 282 IIGTAKYKSQIRDALVEMD 300
           ++G   ++ +++ +L +M+
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 49/79 (62%)

Query: 1277 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1336
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181

Query: 1337 IVISLRNNMFELAQQLIGI 1355
            I  + R +M  +A +   +
Sbjct: 1182 ICTTFRGDMIAVADRFYRV 1200

 Score = 65.5 bits (158), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 104/218 (47%), Gaps = 19/218 (8%)

Query: 106 LSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           + IK +I+  FK+Y     +  F    + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSV--MRKVFKNNTSKYY 223
             +LI++  +  ++    VEI F           + L   Q+  V  +R+       +Y 
Sbjct: 61  RRSLIYQGTS--SVMSGYVEIVFH------GAENRTLLGAQDGGVIHIRRTVGLKKDEYM 112

Query: 224 INGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDII 283
           IN K +S ++V + L + G    +   ++ QG + S+   + +         L+ LE++I
Sbjct: 113 INNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVI 165

Query: 284 GTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKR 321
           G   ++ +++++L +M+T       ++IR EL E E +
Sbjct: 166 GAKSFERKLKESLQKMETTEK--NREKIRIELEEVEAK 201

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar to
            uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
            Component of the condensin complex essential SMC
            chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFTNANRVF 1156

 Score = 40.0 bits (92), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 67/144 (46%), Gaps = 15/144 (10%)

Query: 642 GRLGDLGTIDDK-YDIAISV---ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLD 697
           G    L ++D+K Y  A ++   A  RL ++VV+    A Q +E  R  K      I L+
Sbjct: 525 GVAAQLFSLDEKNYSSATALQVCAGGRLFNVVVDNEGTASQLLERGRLRK--RVTIIPLN 582

Query: 698 KLKKFNM-------AKVTTPENVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRV 750
           K+   ++       AK   P NV    +L   + E+ + A+  +   +L+ +D   A +V
Sbjct: 583 KISARSLHQNAVKAAKELAPGNVELALNLIGYEEEV-SKAMEFIFGTSLICQDAETAKKV 641

Query: 751 AYGTR-RFRVVTLDGKLIDISGTM 773
            +  R R R +TL G + D  GT+
Sbjct: 642 TFHPRVRARSITLQGDIYDPEGTL 665

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] {ON}
            similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score = 67.4 bits (163), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 1275 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1333
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1334 AQFIVISLRNNMFELAQQLI 1353
            +QFIV+SL+  MF  A ++ 
Sbjct: 1137 SQFIVVSLKEGMFTNANRVF 1156

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 102/220 (46%), Gaps = 26/220 (11%)

Query: 642 GRLGDLGTID-DKYDIAISV---ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLD 697
           G    L T++ + +D A ++   A  RL ++VV+    A Q +E  R  K      I L+
Sbjct: 525 GVAAQLFTLEKENFDSATALQVCAGGRLFNVVVDNEVTASQLLERGRLRK--RVTIIPLN 582

Query: 698 KLKK-------FNMAKVTTPENVPRLFDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRV 750
           K+           +AK   P NV    +L   ++E+ + A+  +   +L+ KD   A RV
Sbjct: 583 KIASRTLNENALKLAKSVAPGNVELALNLIGYEDEV-SRAMEFIFGTSLICKDAETAKRV 641

Query: 751 AYGTR-RFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQRSNDMYTSEEVQRMEAELTD 809
            +  + R R +TLDG + D  GT+SGG       L+   Q  N    S+ +  ME EL  
Sbjct: 642 TFHPQIRARSITLDGDIYDPEGTLSGGSRNTKNSLLIDIQTFN--AASKRLNEMELEL-- 697

Query: 810 RETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDI 849
           ++ N KIA     E E   QK K  Q  ++  ++ HK+ +
Sbjct: 698 KQINSKIA-----EYEQTSQKTKSLQNELN--LATHKLSL 730

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 78/170 (45%), Gaps = 32/170 (18%)

Query: 107 SIKNLILNNFKSYAGVQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQ 163
           SI  L L NF +YA    +  FH   S + ++GPNGSGKS  + ++      +   + R 
Sbjct: 46  SIVTLRLENFVTYA----LTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRS 101

Query: 164 GKLSNLIHKSENHENLSFCSVEITF--------QYVMDDADGNTKVLPDVQELSVMRKVF 215
            K+ + I   E+        +E+T         +YV   +DG TKV          R + 
Sbjct: 102 TKIEDYIKNGEDR-----SVIEVTLKRDPEAEDRYVA--SDGTTKV---------TRVLH 145

Query: 216 KNN-TSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMK 264
           +N   S+Y++NG+  + + V + +    I LD+    + Q  VE  A++K
Sbjct: 146 RNRKASEYFLNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1339 IS 1340
            ++
Sbjct: 1049 VT 1050

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 98/213 (46%), Gaps = 34/213 (15%)

Query: 107 SIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL 166
           ++  L L+NF +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + + K 
Sbjct: 56  NVVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKR 113

Query: 167 SNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNN--TSKYYI 224
           S+   K  N  + +   V     ++  +  G T        L V R + +N+   S YY+
Sbjct: 114 SDSFIK--NGADSARIDV-----WLAGEDPGTT--------LKVSRVLTRNHKKASLYYV 158

Query: 225 NGKESSYTEVTQFLRNE-GIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDII 283
           +G E+S   V Q +  +  I LD+    + Q  V+  A+++P       D LL  LE + 
Sbjct: 159 DGVETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP-------DKLL--LETVR 209

Query: 284 GTAKYKSQIRDALVEMDTLN--DICMEKEIRFE 314
              +   Q+ D   ++  L    I ++KE++ E
Sbjct: 210 ACDR---QLLDCWTQLAQLQREHISLDKEVQLE 239

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 86/208 (41%), Gaps = 59/208 (28%)

Query: 1136 DQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKR 1195
            D +  YIG  + +L E+E+  I+ +E                + I IL+E   +LA+ K 
Sbjct: 876  DFNTEYIGEQVERL-ESEIRMINHDE----------------SSIAILQEVERKLADVKA 918

Query: 1196 R------KLDLNESV--EKREEIRNRYEMLKKSRLEEFMDGF------GIISMTVKEIYQ 1241
            R      KLD   +     + E+  R + + +   E F + F      G I ++   +YQ
Sbjct: 919  RLPAMVRKLDAATASMSTMQAELEPRLDTIVEKISERFTNLFTNVGSAGAIQLSKPHLYQ 978

Query: 1242 ------MITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVF 1295
                  M+    NA L+ +DS                         SGGE+ +S++  + 
Sbjct: 979  EWEMKIMVKFRDNAPLKRLDS----------------------HTQSGGERAVSTVLYII 1016

Query: 1296 ALHKYKPTPLYVMDEIDAALDFRNVSIV 1323
            AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1017 ALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 83/184 (45%), Gaps = 17/184 (9%)

Query: 85  IKNSRLELQKIYDGKQTTTKRLSIKNLILNNFKSYAGVQVVGPFH--SSFSAVVGPNGSG 142
           + + RL+L K+     T  +  SI  + L NF +YA    +  FH   S + ++GPNGSG
Sbjct: 28  LPSKRLKLSKV---NYTDFQPGSIIKIRLKNFVTYA----LTEFHLSPSLNMIIGPNGSG 80

Query: 143 KSNVIDSMLFVFGFRANKM-RQGKLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKV 201
           KS  + ++      R   + R  ++ + I   E+      C +EIT +       G   V
Sbjct: 81  KSTFVCAICLGLAGRPEYIGRSKRVEDFIKNGEDE-----CEIEITLKN-NSKIQGIANV 134

Query: 202 LPDVQELSVMRKVFKNN-TSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESI 260
           L     + + R + ++   S Y+IN + +S   V   +    I LD+    + Q  VE  
Sbjct: 135 LSSDDVIKITRVLIRHRKKSDYFINDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEF 194

Query: 261 AQMK 264
           A++K
Sbjct: 195 ARLK 198

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 11/83 (13%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1339 ISLRNNMFELAQQLIGIYKSSNM 1361
            I+         + L G+Y    M
Sbjct: 1054 IT--------PKLLTGLYYHEKM 1068

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 3/85 (3%)

Query: 1259 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1318
            P  + +++++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1319 NVSIVANYIKERTKN---AQFIVIS 1340
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 72/166 (43%), Gaps = 25/166 (15%)

Query: 107 SIKNLILNNFKSYAGVQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 164
           SI  L L NF +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + +G
Sbjct: 68  SIVKLRLENFVTYS----LTEFHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRG 123

Query: 165 KLSNLIHKSENHENLSFCSVEI------TFQYVMDDADGNTKVLPDVQELSVMRKVFKNN 218
           K  +   K  N EN     V +      T  +V    DG TKV          R ++   
Sbjct: 124 KRVDSFIK--NGENRGLIEVTLKRDPGRTGSFVA--VDGTTKV---------SRVLWVGK 170

Query: 219 TSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMK 264
            S+YY+N +  S   V   +    I LD+    + Q  VE  A++K
Sbjct: 171 KSEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK 216

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 64/128 (50%), Gaps = 7/128 (5%)

Query: 1219 KSRLEEFMDGF--GIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR 1276
            +S LE  +DG   GI S+    ++Q +  GG+  LE  +    +   ++          +
Sbjct: 947  RSVLEPNVDGIVEGI-SINFSRLFQNVGSGGSVVLEKNELFSNWKINIMVRFRDSALMKK 1005

Query: 1277 NISNL-SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---K 1332
              S + SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K
Sbjct: 1006 LDSQIQSGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEK 1065

Query: 1333 NAQFIVIS 1340
             +Q+I+++
Sbjct: 1066 TSQYILVT 1073

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 85/189 (44%), Gaps = 31/189 (16%)

Query: 97  DGKQTTTKRLSIKNLILNNFKSYAGVQV---------VGPFH--SSFSAVVGPNGSGKSN 145
           + K  +TKRL I++  LN F+  A V++         +  FH   S + ++GPNGSGKS 
Sbjct: 36  NSKNLSTKRLRIQHSELNEFQPGAVVKLKLTNFVTYALTEFHLSPSLNMIIGPNGSGKST 95

Query: 146 VIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQ---------YVMDDAD 196
            + ++      +   + + K      K+   E +    +EIT +         + M + D
Sbjct: 96  FVCAICLGLAGKPEYIGRSKKVEEYIKNGTDEGV----IEITLKNSSALLHSDFNMINTD 151

Query: 197 GNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGE 256
            +   +  V  LS+ +K      SKYYIN K  +   V   +R   I LD+    + Q  
Sbjct: 152 DDVVHVKRV--LSMEKK-----KSKYYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQER 204

Query: 257 VESIAQMKP 265
           VE  A++KP
Sbjct: 205 VEEFARLKP 213

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 65/151 (43%), Gaps = 27/151 (17%)

Query: 1209 EIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSV 1268
            EIRN  E     RL++ +     IS     ++  +   G  EL+  DS + +        
Sbjct: 947  EIRNSLE----PRLDDIVKQ---ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------C 992

Query: 1269 MPPKKSWRNISNL--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1320
            +  K  +R+ S L        SGGE+ +S++  + AL ++  +P  V+DEI+  +D  N 
Sbjct: 993  IEIKVKFRDNSELQQLNPHVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNE 1052

Query: 1321 SIVA-----NYIKERTKNAQFIVISLRNNMF 1346
             IV      N   E T     I   L  N+F
Sbjct: 1053 RIVHRIMVENACAENTSQYFLITPKLLTNLF 1083

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 73/162 (45%), Gaps = 20/162 (12%)

Query: 107 SIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGK 165
           SI  + L NF +Y+  +       S + ++GPNGSGKS  + ++      +   + R  K
Sbjct: 43  SIIKIKLWNFVTYSLAEFT--LSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSK 100

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSK---Y 222
           L + I   E+        VE+T + V  ++D NT         +++ K   N   K   Y
Sbjct: 101 LEDYIKNGEDQ-----SVVEVTLKNV-PESDFNTD--------TILIKTTINRGKKKPEY 146

Query: 223 YINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMK 264
            ING   + T +  F++   I LD+    + Q  VE  A++K
Sbjct: 147 AINGSTVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLK 188

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1323
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERII 1025

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1265 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1324
            +F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 996  IFILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGT 1055

Query: 1325 NYIKERTKN---AQFIVIS 1340
              I  + K+    Q I+I+
Sbjct: 1056 KLILNKLKDIARTQTIIIT 1074

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 108 IKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 165
           IK ++L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G RA    +G  
Sbjct: 75  IKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGNS 131

Query: 166 LSNLI 170
           L +LI
Sbjct: 132 LKDLI 136

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
           complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 127/287 (44%), Gaps = 56/287 (19%)

Query: 80  IQLSPIKNSRLELQKIYDGKQTTTKRLSIKNLILNNFKSYAGVQVVGPFHSSFSAVVGPN 139
           I+LSPI+         YD  Q      SI  + + NF +Y  V+       SF+ ++GPN
Sbjct: 36  IKLSPIQ---------YDDYQAG----SIIKIKMKNFMTYGLVEY--QLCPSFNMIIGPN 80

Query: 140 GSGKSNVIDSMLFVFGFRANKMRQGKL-SNLIHKSENHENLSFCSVEITFQYVMDDADGN 198
           GSGKS V+ ++      + +   +G + +  I   +     +   +EIT +Y   D   N
Sbjct: 81  GSGKSTVVCALGLGLASKLDITGRGDIVTQYIQNGK-----TSGKIEITLKY--SDRIKN 133

Query: 199 TK-VLPDVQELSVMRKV-FKNNTSKYYINGKESSYTEVTQFLRNEGIDLDH--------- 247
            K V P+ + +++ R++      S Y IN    +  +V   +    I LD+         
Sbjct: 134 VKGVNPNRETVTIKREISIDAKKSNYKINNTVVNEKDVRDIVSKLNIQLDNLCQYLPQER 193

Query: 248 -KRFLILQGE---VESIAQMKPK--AD-HEGDDGLLEYLEDIIGTAKYKSQIRDALVEMD 300
            K F  L+GE   +E+I  + P   +D +E  +   E + D +  AK KS+I +   E +
Sbjct: 194 LKDFARLKGEKLLLETIRAVDPALLSDFNEMKELQEEQIRDDVTLAKNKSRIEELKKEGE 253

Query: 301 TL--------------NDICMEKEIR-FELVEKEKRSLEAGKEQALE 332
            L              +D+ + K+ R +  + + K SL + K+Q LE
Sbjct: 254 RLKHLVDEYNTYVKIKSDLKLCKDARPYFYINEHKESLRSLKQQFLE 300

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1339 IS 1340
            ++
Sbjct: 1055 VT 1056

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 114/242 (47%), Gaps = 50/242 (20%)

Query: 1114 DGEAKLISEDPNSFNDQESMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYM 1173
            D E   +SE  N + D+ S  +    + +   + KL E E+  I+ +E A++I  LK+ +
Sbjct: 847  DDERTELSEWANKYEDESSFTL----TTVLETIAKL-ETEIQIINHDESAIKI--LKQTL 899

Query: 1174 DTAYADIDILEE----YALRLAEYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGF 1229
                +DI  L+E       RL+  +R+   +   +E               RL+E ++  
Sbjct: 900  ----SDIKYLQEKLPGQVKRLSSIRRKMWSIRSELE--------------PRLDEIVEN- 940

Query: 1230 GIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNL-------- 1281
              IS   ++++  + +G   E+ LV   D +SE  +      K  +R+++ L        
Sbjct: 941  --ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWKI----EIKVKFRDVAELKKLDSHIQ 991

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER--TKN-AQFIV 1338
            SGGE+ +S++  + +L ++   P  V+DEI+  +D RN  IV   + E    KN +Q+ +
Sbjct: 992  SGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIVHKAMVENACAKNTSQYFL 1051

Query: 1339 IS 1340
            I+
Sbjct: 1052 IT 1053

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 75/163 (46%), Gaps = 16/163 (9%)

Query: 107 SIKNLILNNFKSYAGVQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQ 163
           +I  L L NF +Y+    +  FH   S + ++GPNGSGKS+ + ++      +   + R 
Sbjct: 45  AIIKLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRA 100

Query: 164 GKLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSK-- 221
            K+ + I K+   E++    +E+T +     A     ++    E+  ++ V      K  
Sbjct: 101 KKVEDFI-KNGTEESV----IELTVK--NSKAVSGYSMIGGSDEVINIKTVIMKAKKKCI 153

Query: 222 YYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMK 264
           YYING+     +V   +    I LD+    + Q  VE  A++K
Sbjct: 154 YYINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK 196

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1268 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1327
            + P    +R +S  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1328 KERTK---NAQFIVIS 1340
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 97/440 (22%), Positives = 186/440 (42%), Gaps = 55/440 (12%)

Query: 108 IKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK- 165
           IK L L+NF  +    V +GP     + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 80  IKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 166 LSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELS----VMRKVFKNNTSK 221
           L +LI    N   ++         Y+ +   G    +P  ++      + R + + +T+ 
Sbjct: 137 LKDLITAGCNSSRITI--------YLSNSGIG--AYVPKGKQYGDTIIIERTISRTSTAG 186

Query: 222 YYI---NGKESSYT--EVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKAD---HEGDD 273
           + +   NG E S    ++ + L    I + +    + Q    S        D   H    
Sbjct: 187 FSLKSENGTEISNKKRDLQEILDYFAIPISNPMCFLSQDSARSFLTASTPTDKYNHFVKG 246

Query: 274 GLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEF 333
            LL+ ++D +  A        A +E+ T  +   E + R++  + + R +    +     
Sbjct: 247 TLLQQIKDYLERATEVHNESAAAMELHT--ESLRELQERYDKAKTDLRQISKTSDLNERL 304

Query: 334 IAXXXXXXXXXXXXXXWDINKETKKLAVTLDKISAFTEKLENERNKYGELQKEITDLRE- 392
                            +INK   K++   ++IS  TEK ++  N+   L+ EIT + + 
Sbjct: 305 KLLTGKSLWLNVDENVMNINKLKNKISHYENEISKLTEKSDSRMNQIDSLKSEITIIEQG 364

Query: 393 LSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRH 452
           LS  L + + K   E+ QL+ +K+   RE  S  E      Q+    ++ L     NI  
Sbjct: 365 LSGKLSKMVEK--EEQFQLMNEKI---REAKSKYE------QEENNEKEILD----NIER 409

Query: 453 CENNIRRLNEAQTEFXXXXXXXXXXXXXXXXXXDAIKMSLRDKTSSISEEVASLEKELEP 512
           C++ I++LN++ +E                   D +   +   T+S SE    L+K++E 
Sbjct: 410 CKSIIKKLNKSISEL------QEKQEKEQGGDKDNMLQEIEKLTASNSE----LKKDIEA 459

Query: 513 WTTKLEAKNSQIKLAESEIL 532
           + TK++  N++++  + E L
Sbjct: 460 YMTKIQDINAKLRTVKMESL 479

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1265 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1324
            +F +    +  RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 981  MFVLTANDEKPRNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGT 1040

Query: 1325 NYIKERTKN---AQFIVIS 1340
              + ++ K+    Q I+I+
Sbjct: 1041 TLVVKKLKDLARTQTIIIT 1059

 Score = 36.2 bits (82), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 10/75 (13%)

Query: 97  DGKQTTTKRLS------IKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDS 149
           DG  TT + +       IK + L NF  +   ++ +GP     + +VG NGSGKS ++ +
Sbjct: 47  DGTATTDEEVDEIRSGYIKKVSLRNFMCHENFELELGP---KLNFIVGSNGSGKSAILTA 103

Query: 150 MLFVFGFRANKMRQG 164
           +    G +A+   +G
Sbjct: 104 ITIALGAKASDTNRG 118

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 76/161 (47%), Gaps = 12/161 (7%)

Query: 107 SIKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 165
           +I  + L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   +++ K
Sbjct: 35  AIVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSK 91

Query: 166 -LSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNT-SKYY 223
            + + I   E+       S+EIT +      +G   V  +   + + R++ K+ + S+Y 
Sbjct: 92  RVEDFIKNGEDR-----GSIEITLKN-SPKVEGMPGVDSEADTIKITRELIKSKSKSRYM 145

Query: 224 INGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMK 264
           IN +  S  +V   +    I LD+    + Q  VE  A++K
Sbjct: 146 INDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLK 186

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1336
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1337 IVIS 1340
             +I+
Sbjct: 1039 FLIT 1042

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1333
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1334 -AQFIVIS 1340
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 108 IKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 166
           IK + L NF  +   ++   F    + +VG NGSGKS V+ ++    G +A+   +G  L
Sbjct: 85  IKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNSL 142

Query: 167 SNLIHKSENHENLSFC 182
            +LI +  N   ++  
Sbjct: 143 KDLIREGCNSTKITIV 158

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1333
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1334 -AQFIVIS 1340
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 108 IKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 166
           IK +IL NF  +   ++     S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 82  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 139

Query: 167 SNLIH 171
            +LI 
Sbjct: 140 KDLIR 144

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1333
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1334 -AQFIVIS 1340
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 108 IKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 166
           IK +IL NF  +   ++     S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 88  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 145

Query: 167 SNLIH 171
            +LI 
Sbjct: 146 KDLIR 150

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1333
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 1008 RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLL 1067

Query: 1334 -AQFIVIS 1340
              Q I+I+
Sbjct: 1068 RTQTIIIT 1075

 Score = 36.6 bits (83), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 108 IKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 164
           IK +IL NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A+   +G
Sbjct: 76  IKKVILRNFMCHEHFELDLGP---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRG 130

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1333
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1334 -AQFIVIS 1340
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 108 IKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 166
           IK +IL NF  +   ++     S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 83  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 140

Query: 167 SNLI 170
            +LI
Sbjct: 141 KDLI 144

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1333
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1334 -AQFIVIS 1340
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 108 IKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 166
           IK +IL NF  +   ++     S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 82  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 139

Query: 167 SNLI 170
            +LI
Sbjct: 140 KDLI 143

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1095

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1339 IS 1340
            I+
Sbjct: 1050 IT 1051

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 102/242 (42%), Gaps = 33/242 (13%)

Query: 107 SIKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 164
           SI  + L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 37  SIVKIKLQNFVTYRLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAK 93

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKV-----LPDVQELSVMRKVFKNNT 219
           ++ + I   E+        +EI  +   D  +  + +     L     L V R + ++  
Sbjct: 94  RVDDFIKNGEDT-----SRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGN 148

Query: 220 ---SKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKP-----KADHEG 271
              S Y+IN K  +   +   ++   I LD+    + Q  VE  A++K      +     
Sbjct: 149 KCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSI 208

Query: 272 DDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKEIRFELVEKEKRSLEAGKEQAL 331
           D  LL+ L+D+  +   ++ + +   E+D        K+ RF  +E ++  LEA      
Sbjct: 209 DAQLLQILDDLKSSQNDETTLEN---EVDI-------KQKRFNELETDRNKLEASVRSLK 258

Query: 332 EF 333
           EF
Sbjct: 259 EF 260

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 11/83 (13%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1339 ISLRNNMFELAQQLIGIYKSSNM 1361
            I+         + L G+Y    M
Sbjct: 1047 IT--------PKLLTGLYYHEKM 1061

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1339 IS 1340
            I+
Sbjct: 1074 IT 1075

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1333
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1334 -AQFIVIS 1340
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 5/65 (7%)

Query: 108 IKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 165
           IK ++L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A +  +G  
Sbjct: 82  IKKVVLKNFMCHEHFEMDLGP---KLNFIVGNNGSGKSAILTAITVGLGAKAAETNRGNS 138

Query: 166 LSNLI 170
           L +LI
Sbjct: 139 LKDLI 143

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
            (REAL)
          Length = 1092

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1339 IS 1340
            I+
Sbjct: 1047 IT 1048

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 71/168 (42%), Gaps = 26/168 (15%)

Query: 107 SIKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 164
           SI  + L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 41  SIIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 97

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFK-------- 216
           K+ + I   ++        +EIT +        N+  + D++ ++   +  K        
Sbjct: 98  KVEDFIKNGQDT-----SRIEITLK--------NSPKIHDIEFINTHDETIKVTRIITRS 144

Query: 217 NNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMK 264
              S Y IN ++ S   V   +    I LD+    + Q  VE  A++K
Sbjct: 145 KRRSDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1339 IS 1340
            I+
Sbjct: 1047 IT 1048

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 76/168 (45%), Gaps = 26/168 (15%)

Query: 107 SIKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 164
           S+ ++ L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 41  SVISVRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 97

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFK-------- 216
           ++ + I   +N +++S   +EIT +        N+  + D++ ++   +  K        
Sbjct: 98  RVEDFI---KNGQDVS--RIEITLK--------NSPKVNDIENVNAHDETIKITRIITRS 144

Query: 217 NNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMK 264
              S Y IN  E S + V   +    I LD+    + Q  VE  A++K
Sbjct: 145 KRRSDYLINDCEVSESVVKALVAQLNIQLDNLCQFLSQERVEEFARLK 192

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 5/70 (7%)

Query: 108 IKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 165
           IK + L NF  +   ++  GP     + +VG NGSGKS ++ ++  VFG +A+   +G  
Sbjct: 62  IKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKASDTNRGTS 118

Query: 166 LSNLIHKSEN 175
           L +LI +  N
Sbjct: 119 LKSLIREGCN 128

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1327
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMI 1052

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] {ON}
            similar to uniprot|Q08204 Saccharomyces cerevisiae
            YOL034w SMC5
          Length = 1105

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 72/144 (50%), Gaps = 19/144 (13%)

Query: 1207 REEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDPFSEGVLF 1266
            R+E+ ++ ++L+  RLE  + G G       E+++ +   G   L     L  FS+  L 
Sbjct: 927  RKEMSDKQKVLE-PRLESIVSGIG---RKFSELFKDVGTAGGVTLNRKSKL--FSDWKL- 979

Query: 1267 SVMPPKKSWRNISNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD--FRN 1319
             +M   +    +S L     SGGE+ +S++  + AL K+   P  V+DEI+  +D  F  
Sbjct: 980  EIMVQFRDEGKLSGLDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFER 1039

Query: 1320 V---SIVANYIKERTKNAQFIVIS 1340
            +   ++V N  +E T  +Q+ +I+
Sbjct: 1040 LVHKAMVQNACEEGT--SQYFLIT 1061

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 77/174 (44%), Gaps = 18/174 (10%)

Query: 107 SIKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 164
           SI  + L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 37  SIVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSK 93

Query: 165 KLSNLIHKSENHENLSFC-----SVEITF---QYVMDDADGNTKVLPDV-----QELSVM 211
           ++ + I   ++   +        +++I F    +     +GN K L  +     +   + 
Sbjct: 94  QVEDFIKNGQDTSKIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTKIG 153

Query: 212 RKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKP 265
           R + K  T +Y ING  ++ + V   +    I LD+    + Q  VE  A+++P
Sbjct: 154 RNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP 207

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1339 IS 1340
            I+
Sbjct: 1047 IT 1048

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 74/168 (44%), Gaps = 26/168 (15%)

Query: 107 SIKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 164
           SI  + L +F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 41  SIIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 97

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFK-------- 216
           K+ + I   +N +++S   +EIT +        N+  + D++ +    +  K        
Sbjct: 98  KVEDFI---KNGQDVS--KIEITLK--------NSPNVTDIEYIDARDETIKITRIITRS 144

Query: 217 NNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMK 264
              S Y IN  + S + V   +    I LD+    + Q  VE  A++K
Sbjct: 145 KRRSDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1339 IS 1340
            I+
Sbjct: 1072 IT 1073

 Score = 37.0 bits (84), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 74/163 (45%), Gaps = 16/163 (9%)

Query: 107 SIKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 164
           SI  + L+NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 65  SIIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSR 121

Query: 165 KLSNLIHKSENHENLSFCSVEITFQY--VMDDADGNTKVLPDVQELSVMRKVFKN-NTSK 221
            + + I   E H       +EIT +    + D +G   VL     +++ R + ++   S+
Sbjct: 122 NVDDYIKNDEEH-----GEIEITLKNSEAIHDVEG---VLEGSDTITITRILTRSKKKSE 173

Query: 222 YYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMK 264
           Y IN    +   V + +    I LD+    + Q  VE  A++K
Sbjct: 174 YKINDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLK 216

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 15/85 (17%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1336
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1337 IVISLRNNMFELAQQLIGIYKSSNM 1361
             +I+         + L G+Y    M
Sbjct: 1056 FLIT--------PKLLTGLYYHEKM 1072

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1080

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1339 IS 1340
            I+
Sbjct: 1035 IT 1036

 Score = 39.3 bits (90), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 82/184 (44%), Gaps = 27/184 (14%)

Query: 107 SIKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 164
           +I  L L N  +Y+  +  + P   S + +VGPNGSGKS  + ++      +   + R  
Sbjct: 36  NIVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 92

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNT-SKYY 223
           K+ N I   EN   +       TF        G+   +P+ + + + R + +N   S+YY
Sbjct: 93  KIDNFIKNGENTAQID------TF------LRGH---MPN-EVIKITRIMTRNKKKSEYY 136

Query: 224 INGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKP-----KADHEGDDGLLEY 278
           I+   S+ T V +      I LD+    + Q  VE  A++K      +     +  LLE 
Sbjct: 137 IDDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPSLLET 196

Query: 279 LEDI 282
           LED+
Sbjct: 197 LEDL 200

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.4 bits (93), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 7/92 (7%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1330
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1331 TKNAQFIVISLRN--NMFELAQQLIGIYKSSN 1360
              + Q I+I+ ++   M  +  +   I+K  N
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKN 1088

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 40.0 bits (92), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 72/165 (43%), Gaps = 20/165 (12%)

Query: 107 SIKNLILNNFKSYAGVQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 164
           +I ++ L NF +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + + 
Sbjct: 45  AIVSIRLTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRA 100

Query: 165 KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQ---ELSVMRKVFKNNTSK 221
           K      K+   E+    ++EI  +        N   LP +    E   +R V      K
Sbjct: 101 KRVEDFIKNGTAES----TIEIQLR-----NSRNVSGLPMISAEDEAINVRTVLMKARRK 151

Query: 222 --YYINGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMK 264
             YYING+  S  ++   +    I LD+    + Q  VE  A++K
Sbjct: 152 CAYYINGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLK 196

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 1282 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1338
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R   IV   + E       +Q+ +
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1339 IS 1340
            I+
Sbjct: 1052 IT 1053

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 39.7 bits (91), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1260 FSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1317
            FS+G L  ++  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1318 RNVSI----VANYIKERTKNAQFIV 1338
             N  I    + N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 84/211 (39%), Gaps = 32/211 (15%)

Query: 98  GKQTTTKRLSIKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGF 156
           G +TT     IK + L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G 
Sbjct: 60  GNETTHPPGFIKKVQLRNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGA 116

Query: 157 RANKMRQG-KLSNLIHKSENHENLSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVF 215
           +A    +G  L +LI +      +S       F        G+        E+ + R + 
Sbjct: 117 KATDTNRGSSLKDLIREGCQSSKISIVLNNEGFGGYDQGTYGS--------EIRIERTIK 168

Query: 216 KNNTSKYYI---NGKESSYTEVTQFLRNEGIDLDHKRFLILQGEVESIAQMKPKADHEGD 272
           +N  + + +   NGKE S               + KR L +  +  ++  M P       
Sbjct: 169 RNGPATFSLKSENGKEVS---------------NKKRDLQVIVDYFAVPVMNPMC-FLSQ 212

Query: 273 DGLLEYLEDIIGTAKYKSQIRDALVEMDTLN 303
           D    +L     T KYK  +R  L+E   +N
Sbjct: 213 DAARSFLTASTPTDKYKHFMRGTLLEDTEMN 243

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 39.7 bits (91), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 75/178 (42%), Gaps = 27/178 (15%)

Query: 1178 ADIDILEEYALRLAEYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVK 1237
            +DI +  E AL L E    K     + EK  E+ N   +L  S          I S TV 
Sbjct: 900  SDIGVSYEKALELYEQTMSKFL--SAKEKYIEMDNALSILNHS----------IKSRTVN 947

Query: 1238 EIYQMITMGGNAELELVDSLD--PFSEGVLFS--------VMPPK--KSWRNISNLSGGE 1285
              YQ  +   +A+ +  +SL    F   + F            P+  K  RN+  LSGGE
Sbjct: 948  FGYQKTSTFADADFDFRNSLRIRKFKGKLDFGKTKETLNVYTGPQTDKEPRNVDTLSGGE 1007

Query: 1286 KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1340
            K+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K+    Q I+I+
Sbjct: 1008 KSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLKDDSRTQTIIIT 1065

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 108 IKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK- 165
           IK + L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +AN   +G  
Sbjct: 71  IKKIKLVNFMCHEHFELTLGP---RLNFIVGNNGSGKSAILTAITIGLGAKANSTNRGNS 127

Query: 166 LSNLIHKSENHENLS 180
           L +LI    N   ++
Sbjct: 128 LKDLIKNGCNQSKIT 142

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1928

 Score = 39.3 bits (90), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 72/140 (51%), Gaps = 12/140 (8%)

Query: 489 KMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQL 548
           K++L+D    + ++ A LEKE    + KL  K   I     E+  ++ +   LE E ++ 
Sbjct: 854 KIALKD----LQKKTAVLEKEKRQLSDKLNEKEKDITRLNEELATLENTVKSLESEKNEK 909

Query: 549 RKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQV-------L 601
           RK++E +K + +NH   + KL  +  ++ +     + E DS +++L +++         L
Sbjct: 910 RKEVEEWKSKFQNHDNLVPKLTDKLKSLATSFKELEKERDSLQEQLTELESANLSHETEL 969

Query: 602 TNHRQRMTDARVALSNVENK 621
            N+ ++MT+  V L+  ENK
Sbjct: 970 KNNIKQMTENNVTLT-TENK 988

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 108 IKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 166
           +K + L NF  +   ++   F    + +VG NGSGKS ++ ++  VFG +A+   +G  L
Sbjct: 62  MKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKASDTNRGVSL 119

Query: 167 SNLI 170
            +LI
Sbjct: 120 KSLI 123

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1327
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 3/75 (4%)

Query: 108 IKNLILNNFKSYAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-KL 166
           I+ +IL NF  +    V      + + +VG NGSGKS ++ +++   G +A++  +G  L
Sbjct: 73  IRKVILRNFMCHENFSV--ELTPNLNFIVGNNGSGKSAILTAIIVALGVKASETSRGSSL 130

Query: 167 SNLIHKSENHENLSF 181
             LI K  N   ++ 
Sbjct: 131 KELIRKGCNSSKVTL 145

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1322
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1279 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1338
            + LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1339 ISL 1341
            IS+
Sbjct: 655  ISI 657

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]
           {ON} Anc_4.237 YLR383W
          Length = 1102

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 39/67 (58%), Gaps = 5/67 (7%)

Query: 107 SIKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG- 164
           S+K +IL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A++  +G 
Sbjct: 71  SLKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGV 127

Query: 165 KLSNLIH 171
            L +LI 
Sbjct: 128 SLKDLIR 134

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1333
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1334 -AQFIVIS 1340
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1276 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1322
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

 Score = 36.6 bits (83), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 108 IKNLILNNFKSYAGVQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 165
           IK +IL NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A    +G  
Sbjct: 75  IKKVILKNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 131

Query: 166 LSNLI 170
           L +LI
Sbjct: 132 LKDLI 136

>SAKL0H03300g Chr8 (309151..314274) [5124 bp, 1707 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1707

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 54/100 (54%), Gaps = 5/100 (5%)

Query: 529  SEILIIKESKLKLEQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECD 588
            SEI   K   L LE+E S + +  +SY+ + +N++ ++  L  E   +   +S+A+ E +
Sbjct: 1200 SEIDTFKSKILALEEEKSSIERSCDSYRTQRQNNEAELKDLRSEMTTLRDSLSSAKNEMN 1259

Query: 589  SAKKKLVDMKQVLTNHRQRMTDARVAL-SNVENKNKVLGA 627
            SAK    D+   L N  + + D  + L + +ENKN+ + A
Sbjct: 1260 SAK----DLSLHLQNDTKDLNDRILELEAEIENKNENISA 1295

>Smik_12.393 Chr12 complement(687243..689975) [2733 bp, 910 aa] {ON}
            YLR309C (REAL)
          Length = 910

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 56/255 (21%), Positives = 120/255 (47%), Gaps = 47/255 (18%)

Query: 821  FQEMEAALQKYKDRQPNIDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPL 880
            ++EMEA L+  K+   +   +++K   ++ TL++EL   K +L E           N  L
Sbjct: 348  YEEMEAELKNTKESGAS---QLAKSAEELKTLNTELSDTKKSLKE----------KNSEL 394

Query: 881  EDIENQLVALNSELVALKDESK-VKNEQISELRAQIMKIGGLKLQSQN------------ 927
            E++ + L  + +ELV  KDE K   ++Q  E +A  +++  L+ ++              
Sbjct: 395  EEVRDMLRTVGNELVDAKDEIKGFSSKQTEEAKAVKLELDNLRHKNATMVEAHEIKNAEL 454

Query: 928  -SKVDSL---TQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAENDINHCEIELSKTN 983
             +++DSL    + L+ +  +++K +T LK   +++N           +I+    E S T 
Sbjct: 455  KNRLDSLNKKVEHLKALSVEKEKEQTTLKNKVVKLNE----------EISQLTAEKSSTT 504

Query: 984  NSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTHLE 1043
                +L+   ++ E  +  +E++ +Q +++ + A+K       + E+ K E   M   L+
Sbjct: 505  KELNSLRTSYKQKEKTVGYLEEQVKQFSEQKDAAEK-------FTEQLKKEHANMSNRLD 557

Query: 1044 KLKNLEHHIKAEISR 1058
             LK     + ++I++
Sbjct: 558  LLKRENESLHSDIAK 572

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 37.0 bits (84), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1304 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLIG 1354
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1355 IYKSSNMTKST 1365
              K  +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%)

Query: 1270 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1327
            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +DE D  +D  N  I    I
Sbjct: 996  PNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRQIGTKLI 1053

>Smik_2.273 Chr2 complement(486425..488911) [2487 bp, 828 aa] {ON}
           YBR133C (REAL)
          Length = 828

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 224 INGKESSYTEVTQFLRNEG---IDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLE 280
           + G ES+Y E   +L  +G   ++ +  R  +LQ E   +  +KP +D+  +   L + +
Sbjct: 291 VKGGESAYLEYINYLLKKGDKVLNSNGNRQFLLQEESRIMPPLKPHSDNLSNSTYLTFEK 350

Query: 281 DIIGTAKYKSQIRDALVEM 299
           D++    Y+S I +AL ++
Sbjct: 351 DLVKYDLYESAILEALQDL 369

>Smik_14.85 Chr14 (154519..158457) [3939 bp, 1312 aa] {ON} YNL250W
            (REAL)
          Length = 1312

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 90/177 (50%), Gaps = 19/177 (10%)

Query: 880  LEDIENQLVALNSELVALKDESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQI 939
            + DI++++ AL S ++ LKD+       + +L+ +   I     Q   + V+ L  + Q 
Sbjct: 906  IRDIDSRVEALESRIITLKDKKDEAQTVLDKLKYE-RDIQIHNKQKTVADVNRLIDRFQA 964

Query: 940  IVAK----QKKNRTELKKN--ELEMNRASKQKLGAENDINHCEI-----ELSKTNNSHEA 988
            I  +    + K  TEL+    ELE+N+   Q+L  + D+   EI     +LS++NN  + 
Sbjct: 965  IYKEVIDFETKGFTELQTTIKELELNKVRMQELKEQLDLKLDEINEEKRKLSESNNEEKN 1024

Query: 989  LQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTHLEKL 1045
            L++ L       E+IE K +  + E E +K ++ +  A  +K++ E + + T+ EKL
Sbjct: 1025 LKQNL-------ELIELKLQLQDIESEISKLDVQNAEAERDKYQEESLRLRTNFEKL 1074

>SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa]
           {ON} similar to uniprot|P08964 Saccharomyces cerevisiae
           YHR023W MYO1 Type II myosin heavy chain required for
           wild- type cytokinesis and cell separation localizes to
           the actomyosin ring binds to myosin light chains Mlc1p
           and Mlc2p through its IQ1 and IQ2 motifs respectively
          Length = 1871

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 69/138 (50%), Gaps = 21/138 (15%)

Query: 495 KTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKDIES 554
           KT  I+E+V SLEKELE               +E E   ++E     E E++++R+ + +
Sbjct: 805 KTKKIAEQVKSLEKELES--------------SEMERSKLREQNTNYEDELNKVREMLTT 850

Query: 555 YKDRIENH-------KKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQR 607
             + +ENH       K K  +LE+E   IT    T   +  +AKK+  D ++ +T+ ++ 
Sbjct: 851 TTESLENHQRLLSTAKSKEAELEREVKEITLLKKTLDDQKLNAKKQYEDAQREITSFKEI 910

Query: 608 MTDARVALSNVENKNKVL 625
            ++   ++  +E++ K L
Sbjct: 911 SSERESSIKQLESEKKEL 928

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1260 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1319
            F EGV   V P        + LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1320 VSIVANYIKERT 1331
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>NDAI0D02930 Chr4 complement(687858..690740) [2883 bp, 960 aa] {ON}
           Anc_4.46 YLR309C
          Length = 960

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 52/101 (51%), Gaps = 14/101 (13%)

Query: 534 IKESKLKLEQEISQLRKDIESYKDR----IENHKKKINKLEKESAAITSFISTAQGECDS 589
           IKES L   +EI++    +E+ K+     I  +K K ++LEK +AA+T        E + 
Sbjct: 467 IKESSLGKNEEIARWTAQVENLKNENEKIISENKTKQSELEKNTAALT-------DEIEK 519

Query: 590 AKKKLVDMKQVLTNHRQRMTDARVALSNVENKNKVLGALCR 630
            K K +D  + L ++  RM +   ALS ++N+N  L    R
Sbjct: 520 LKTKYMDASKRLKDNEARMNE---ALSKIQNENNRLSNQMR 557

>Suva_15.317 Chr15 (551916..554789) [2874 bp, 957 aa] {ON} YHR120W
           (REAL)
          Length = 957

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 3/83 (3%)

Query: 804 EAELTDRETNFKIATDTFQEMEA---ALQKYKDRQPNIDVEISKHKIDIDTLSSELQSKK 860
           E E TDR+   +  T T +E+ A    L    D  PN  +     +  + T   ++ S+ 
Sbjct: 309 EKEATDRQLRIQFQTFTQKELAALRNTLIYVSDHLPNFSINFQIPQRQLATAIMQIDSRT 368

Query: 861 DTLIELESTAENNQRDNGPLEDI 883
            T +EL ST  +N R    L  I
Sbjct: 369 STALELHSTVRDNNRKGSLLSSI 391

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 58/112 (51%), Gaps = 5/112 (4%)

Query: 352 INKETKKLAVTLDK-----ISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINA 406
           +N+++  L  TLDK     ++A +E+L++ + +  EL++ +  LR L+  +EEQ +   +
Sbjct: 253 LNRKSDALQKTLDKDLKIRLAAKSEELKDLKTRLKELEERLGSLRSLNSQIEEQTSTFAS 312

Query: 407 EKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIR 458
              + +  + +L R + SS  +L+ + +   K E   +     ++    NIR
Sbjct: 313 HTIEALAKRDELDRYISSSNSELEQIGEILMKEETMRRKLHNELQELRGNIR 364

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 58/112 (51%), Gaps = 5/112 (4%)

Query: 352 INKETKKLAVTLDK-----ISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINA 406
           +N+++  L  TLDK     ++A +E+L++ + +  EL++ +  LR L+  +EEQ +   +
Sbjct: 253 LNRKSDALQKTLDKDLKIRLAAKSEELKDLKTRLKELEERLGSLRSLNSQIEEQTSTFAS 312

Query: 407 EKSQLVKDKLQLQRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIR 458
              + +  + +L R + SS  +L+ + +   K E   +     ++    NIR
Sbjct: 313 HTIEALAKRDELDRYISSSNSELEQIGEILMKEETMRRKLHNELQELRGNIR 364

>Ecym_5271 Chr5 complement(556773..557693) [921 bp, 306 aa] {ON}
           similar to Ashbya gossypii AER204WA
          Length = 306

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 38/64 (59%)

Query: 358 KLAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQ 417
           KL   ++   +  ++L+   +   EL++E  DL  L DN  +++TK+N +  ++VKD  Q
Sbjct: 166 KLQACINAKRSLEKRLKETSDINSELEREKMDLEILCDNKLKELTKLNKKYLKVVKDYEQ 225

Query: 418 LQRE 421
           +QRE
Sbjct: 226 VQRE 229

>KAFR0B00590 Chr2 complement(117951..121736) [3786 bp, 1261 aa] {ON}
            Anc_7.488 YBL047C
          Length = 1261

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 81/163 (49%), Gaps = 11/163 (6%)

Query: 928  SKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGA-----ENDINHCEI---EL 979
            ++V+SLT+Q  I   K+ +   ELK+  +EM  + + KLG      E ++   E+   +L
Sbjct: 547  NQVNSLTKQASITNDKKSRASQELKR-VIEMKLSIQDKLGKIRAAHEENVKKTEMLENQL 605

Query: 980  SKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMC 1039
             + NN + +LQ+    TE   +  E+K  ++  +   A +   +  A + +F  +   + 
Sbjct: 606  IELNNENNSLQQQFSVTEANFQASENKMNEVTLQFNNATRENQELKAKISQFNEQNNLLL 665

Query: 1040 THL-EKLKNLEHHIK-AEISRTDEELNTLKLRDVEQLLQKLDE 1080
            + L EK   L+  +  A+++R   ELN + + ++   +  LDE
Sbjct: 666  SQLNEKQALLQKEMSIADVNRKQVELNDITVANLTNEISGLDE 708

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 33.1 bits (74), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 59/112 (52%), Gaps = 11/112 (9%)

Query: 1260 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1319
            F EG+  +V P        + LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGPRG------TQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1320 VSIVANYIKERTKNAQF-IVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNI 1370
              IVA+ + +R + A+  I I+ R +  + + ++I + K  ++ ++ T Q +
Sbjct: 605  EDIVASTLLQRCQEAKITISIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQL 656

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 11/135 (8%)

Query: 511 EPWTTKLEAKNSQIKLAESEILIIKESKLKL----------EQEISQLRKDIESYKDRIE 560
           EP    +  K S IK+  +E++  K   L            E+  S+L K +ESYK++I+
Sbjct: 435 EPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQ 494

Query: 561 NHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTDARVALSNVEN 620
           N K  IN+L K+   I     T +   +  + KL ++++ ++N    +       S +EN
Sbjct: 495 NSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELEN 554

Query: 621 -KNKVLGALCRLQKS 634
            K K+   L  +QKS
Sbjct: 555 IKIKLHSILGNMQKS 569

>SAKL0H08426g Chr8 complement(726923..729373) [2451 bp, 816 aa] {ON}
           weakly similar to uniprot|Q08581 Saccharomyces
           cerevisiae YOR195W SLK19 Kinetochore-associated protein
           required for normal segregation of chromosomes in
           meiosis and mitosis component of the FEAR regulatory
           network which promotes Cdc14p release from the nucleolus
           during anaphase potential Cdc28p substrate
          Length = 816

 Score = 32.7 bits (73), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 43/78 (55%)

Query: 492 LRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRKD 551
           L++ +    E++  L+ +L+  T +LE K +++     +I  IK+SK+ LE+ I      
Sbjct: 558 LKENSERDKEQMYQLKTQLDLATDQLEVKTAEVTEFTQDIDEIKQSKMLLEESIKAREDT 617

Query: 552 IESYKDRIENHKKKINKL 569
           I+ +KD+ E   K+  KL
Sbjct: 618 IQEWKDKFEEKAKECEKL 635

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 32.7 bits (73), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 1279 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1334
            + LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +  
Sbjct: 588  AQLSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG 639

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 136,575,962
Number of extensions: 6215036
Number of successful extensions: 46041
Number of sequences better than 10.0: 1908
Number of HSP's gapped: 41761
Number of HSP's successfully gapped: 4306
Length of query: 1376
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1254
Effective length of database: 39,492,147
Effective search space: 49523152338
Effective search space used: 49523152338
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)