Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43108.260ON29432943149890.0
AGR088W8.260ON2887295449760.0
SAKL0H17072g8.260ON2997155628170.0
KLTH0G13728g8.260ON2966153823930.0
Suva_10.1718.260ON2958154823280.0
Kwal_YGOB_56.238088.260ON2941155623260.0
Smik_12.1468.260ON2958160522850.0
YLR087C (CSF1)8.260ON2958155822790.0
Skud_12.1558.260ON2959156322700.0
CAGL0L12210g8.260ON2981155322690.0
NCAS0B050108.260ON2952156022570.0
ZYRO0C01694g8.260ON3006160722200.0
KAFR0B027208.260ON2982159021530.0
TDEL0F038708.260ON2942158621430.0
NDAI0B019808.260ON2959156221240.0
KNAG0G020308.260ON2998157821210.0
Kwal_56.23810singletonOFF2763116821100.0
Kpol_392.78.260ON2995157920630.0
KLLA0F19096g8.260ON2923155519160.0
TBLA0E044208.260ON3148118316350.0
TPHA0J007308.260ON3046143916250.0
Kwal_56.23808singletonOFF62601355e-09
NDAI0G026808.308ON84641776.2
Kpol_1039.432.266ON563119758.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4310
         (2943 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...  5778   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...  1921   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  1089   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...   926   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...   901   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...   900   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...   884   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...   882   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...   879   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...   878   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...   874   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...   859   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...   833   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...   830   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...   822   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...   821   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...   817   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...   799   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   742   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...   634   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...   630   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    57   5e-09
NDAI0G02680 Chr7 complement(611144..613684) [2541 bp, 846 aa] {O...    34   6.2  
Kpol_1039.43 s1039 complement(131645..133336) [1692 bp, 563 aa] ...    33   8.8  

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score = 5778 bits (14989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2829/2943 (96%), Positives = 2829/2943 (96%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND 120
            KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND 120

Query: 121  ENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRVKTDSSV 180
            ENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRVKTDSSV
Sbjct: 121  ENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRVKTDSSV 180

Query: 181  MFDPLDESSEQSKVGQTILNSVSNQSAVPLYLDFLPAEVILSSGAVVVGNKHTPSVAIIQ 240
            MFDPLDESSEQSKVGQTILNSVSNQSAVPLYLDFLPAEVILSSGAVVVGNKHTPSVAIIQ
Sbjct: 181  MFDPLDESSEQSKVGQTILNSVSNQSAVPLYLDFLPAEVILSSGAVVVGNKHTPSVAIIQ 240

Query: 241  YARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKIDGKPFNLW 300
            YARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKIDGKPFNLW
Sbjct: 241  YARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKIDGKPFNLW 300

Query: 301  QKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTFSDEIPFDLQNHE 360
            QKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTFSDEIPFDLQNHE
Sbjct: 301  QKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTFSDEIPFDLQNHE 360

Query: 361  YAKYTTILNADRIKLLYSYDTPGVITETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPW 420
            YAKYTTILNADRIKLLYSYDTPGVITETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPW
Sbjct: 361  YAKYTTILNADRIKLLYSYDTPGVITETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPW 420

Query: 421  AHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDA 480
            AHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDA
Sbjct: 421  AHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDA 480

Query: 481  AFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVN 540
            AFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVN
Sbjct: 481  AFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVN 540

Query: 541  HDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGD 600
            HDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGD
Sbjct: 541  HDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGD 600

Query: 601  AVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPX 660
            AVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLP 
Sbjct: 601  AVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPI 660

Query: 661  XXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYXXXXX 720
                            PKFDIQLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSY     
Sbjct: 661  ETISEESITISYEIYTPKFDIQLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYNDVDI 720

Query: 721  XXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATD 780
                   LECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATD
Sbjct: 721  DNVDTINLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATD 780

Query: 781  IFNNNDDDQTTELVEPNSYGESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLP 840
            IFNNNDDDQTTELVEPNSYGESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLP
Sbjct: 781  IFNNNDDDQTTELVEPNSYGESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLP 840

Query: 841  ESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFI 900
            ESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFI
Sbjct: 841  ESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFI 900

Query: 901  TSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSF 960
            TSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSF
Sbjct: 901  TSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSF 960

Query: 961  GFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSK 1020
            GFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSK
Sbjct: 961  GFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSK 1020

Query: 1021 YSLRANIDIPNFDFLVSSMDDHNIVLGXXXXXXXXXXXXRNPDFKTTNNLQTQHILLSDA 1080
            YSLRANIDIPNFDFLVSSMDDHNIVLG            RNPDFKTTNNLQTQHILLSDA
Sbjct: 1021 YSLRANIDIPNFDFLVSSMDDHNIVLGTISTSISFAIFSRNPDFKTTNNLQTQHILLSDA 1080

Query: 1081 PFCRCSFLHPQEYQTSDLYKXXXXXXXXXXXXXXXXXXXXXNNFDTIFENLLGDIYQDYI 1140
            PFCRCSFLHPQEYQTSDLYK                     NNFDTIFENLLGDIYQDYI
Sbjct: 1081 PFCRCSFLHPQEYQTSDLYKLLYASIPPSSSIPLLPEPIGPNNFDTIFENLLGDIYQDYI 1140

Query: 1141 SEGTFDISNDTKLQLNIDEFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINID 1200
            SEGTFDISNDTKLQLNIDEFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINID
Sbjct: 1141 SEGTFDISNDTKLQLNIDEFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINID 1200

Query: 1201 IHIDVLEVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRL 1260
            IHIDVLEVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRL
Sbjct: 1201 IHIDVLEVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRL 1260

Query: 1261 RMYEYYALEDVKHYFVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKM 1320
            RMYEYYALEDVKHYFVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKM
Sbjct: 1261 RMYEYYALEDVKHYFVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKM 1320

Query: 1321 LSKENFIYPSESSEFSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIK 1380
            LSKENFIYPSESSEFSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIK
Sbjct: 1321 LSKENFIYPSESSEFSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIK 1380

Query: 1381 TLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHH 1440
            TLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHH
Sbjct: 1381 TLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHH 1440

Query: 1441 VRESRSWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFA 1500
            VRESRSWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFA
Sbjct: 1441 VRESRSWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFA 1500

Query: 1501 DVERCFLYKKTYIPAEVTFAKTICFSSDLLTISFNERDKEHLFMNSFMIDIRNDCYVSSA 1560
            DVERCFLYKKTYIPAEVTFAKTICFSSDLLTISFNERDKEHLFMNSFMIDIRNDCYVSSA
Sbjct: 1501 DVERCFLYKKTYIPAEVTFAKTICFSSDLLTISFNERDKEHLFMNSFMIDIRNDCYVSSA 1560

Query: 1561 VGESMAAKSNNVYKTVVSLDELQINVDXXXXXXXXXXXXXXXFEYVYSNPIVVAKDANGR 1620
            VGESMAAKSNNVYKTVVSLDELQINVD               FEYVYSNPIVVAKDANGR
Sbjct: 1561 VGESMAAKSNNVYKTVVSLDELQINVDKKIILKLSKLIHTLKFEYVYSNPIVVAKDANGR 1620

Query: 1621 CKNISLQLNKITTNCFLGNVSLGFIFERIYVYSLIDTLDSGNNSLLSVLLFFDVAKLFFR 1680
            CKNISLQLNKITTNCFLGNVSLGFIFERIYVYSLIDTLDSGNNSLLSVLLFFDVAKLFFR
Sbjct: 1621 CKNISLQLNKITTNCFLGNVSLGFIFERIYVYSLIDTLDSGNNSLLSVLLFFDVAKLFFR 1680

Query: 1681 YKTRNLFSLDFTDLHFNLTYLSKQKTYGFYHSAEFMXXXXXXXXXXXXXEANNEIRLHIN 1740
            YKTRNLFSLDFTDLHFNLTYLSKQKTYGFYHSAEFM             EANNEIRLHIN
Sbjct: 1681 YKTRNLFSLDFTDLHFNLTYLSKQKTYGFYHSAEFMNINSSIPSINDIIEANNEIRLHIN 1740

Query: 1741 EIGQDFASNIQYTELPVLPDSQVLKPIAMVKMXXXXXXXXXXXXXPFILRYSCKEFEINV 1800
            EIGQDFASNIQYTELPVLPDSQVLKPIAMVKM             PFILRYSCKEFEINV
Sbjct: 1741 EIGQDFASNIQYTELPVLPDSQVLKPIAMVKMNIAAINIQLQLLLPFILRYSCKEFEINV 1800

Query: 1801 DFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTDNLGRISLDSSFSK 1860
            DFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTDNLGRISLDSSFSK
Sbjct: 1801 DFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTDNLGRISLDSSFSK 1860

Query: 1861 LSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKSSTVQNEFPFSRLIPIQLNLNVEYI 1920
            LSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKSSTVQNEFPFSRLIPIQLNLNVEYI
Sbjct: 1861 LSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKSSTVQNEFPFSRLIPIQLNLNVEYI 1920

Query: 1921 GLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSSESICFLIKDRRVKETLSK 1980
            GLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSSESICFLIKDRRVKETLSK
Sbjct: 1921 GLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSSESICFLIKDRRVKETLSK 1980

Query: 1981 VLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMKSIYHDIKPR 2040
            VLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMKSIYHDIKPR
Sbjct: 1981 VLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMKSIYHDIKPR 2040

Query: 2041 STSSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLT 2100
            STSSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLT
Sbjct: 2041 STSSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLT 2100

Query: 2101 LLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELD 2160
            LLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELD
Sbjct: 2101 LLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELD 2160

Query: 2161 VSLLAWWFTIVDEATQSLHKFKKLKETILDPLKVTSNDPILGEWNYLDNPLASSVRSINC 2220
            VSLLAWWFTIVDEATQSLHKFKKLKETILDPLKVTSNDPILGEWNYLDNPLASSVRSINC
Sbjct: 2161 VSLLAWWFTIVDEATQSLHKFKKLKETILDPLKVTSNDPILGEWNYLDNPLASSVRSINC 2220

Query: 2221 IINYAGSSMKLYSRDDIQHGTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHN 2280
            IINYAGSSMKLYSRDDIQHGTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHN
Sbjct: 2221 IINYAGSSMKLYSRDDIQHGTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHN 2280

Query: 2281 TLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVG 2340
            TLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVG
Sbjct: 2281 TLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVG 2340

Query: 2341 KQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXX 2400
            KQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSRE  
Sbjct: 2341 KQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREIS 2400

Query: 2401 XXXXXXXXXMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVND 2460
                     MVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVND
Sbjct: 2401 SSLSLQQISMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVND 2460

Query: 2461 IILAPVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNL 2520
            IILAPVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNL
Sbjct: 2461 IILAPVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNL 2520

Query: 2521 WGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVEL 2580
            WGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVEL
Sbjct: 2521 WGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVEL 2580

Query: 2581 SLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSL 2640
            SLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSL
Sbjct: 2581 SLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSL 2640

Query: 2641 AYANLFDIYSTIRRMRNDSGRTNLDLLESNELKKISSFDNSKMLASLLSLRTELSVNAQL 2700
            AYANLFDIYSTIRRMRNDSGRTNLDLLESNELKKISSFDNSKMLASLLSLRTELSVNAQL
Sbjct: 2641 AYANLFDIYSTIRRMRNDSGRTNLDLLESNELKKISSFDNSKMLASLLSLRTELSVNAQL 2700

Query: 2701 LNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFK 2760
            LNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFK
Sbjct: 2701 LNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFK 2760

Query: 2761 HQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNG 2820
            HQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNG
Sbjct: 2761 HQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNG 2820

Query: 2821 VSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIY 2880
            VSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIY
Sbjct: 2821 VSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIY 2880

Query: 2881 KPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940
            KPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL
Sbjct: 2881 KPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940

Query: 2941 GKV 2943
            GKV
Sbjct: 2941 GKV 2943

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score = 1921 bits (4976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1089/2954 (36%), Positives = 1660/2954 (56%), Gaps = 114/2954 (3%)

Query: 34   VFTTFYLWRAIGYIVTKILNWVIWKRYKVVINIQSLGFSIIGGKVYFKNISITDRDQTIS 93
            +F  FY+ R +GYIV+K  N V+WK+Y+V ++IQSL FS + GKV+FKN+S+T +DQ IS
Sbjct: 3    IFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLIS 62

Query: 94   ILKGTFTWRYWLLNPRPTQLKNSNINDENSKCRFKLECDGVELFIYNKIAVYEDILNELA 153
            +LKGT TWRYWL+     + + S   D   +CRF L+ +G E F+YN+  VY+ I  EL 
Sbjct: 63   VLKGTITWRYWLIG----RYRRSGTADGARRCRFALKFEGFEYFVYNRNGVYDRIAREL- 117

Query: 154  KSDKDSSRKFATDDESIFGRVKTDSSVMFDPLDESSEQSKVGQTILNSVSNQSAVPLYLD 213
                                         D  D S+E +    ++   ++     PL   
Sbjct: 118  -----------------------------DGEDTSAEPTVSVPSVEEVIAELQDDPLIRR 148

Query: 214  FLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRV 273
            FLP E + + GA+V+GNK T SVAI+ Y ++ G + +  P         R+E ++S+  V
Sbjct: 149  FLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKISNCTV 208

Query: 274  SVKPNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTS 333
            ++KPNIS+   +  K +    +   LW+K K  LL T+         KK      ++  +
Sbjct: 209  AIKPNISYEVDNPVKIYVEPKRTARLWKKYK-TLLGTVLEATLHAKRKKEQHQTPKWYDN 267

Query: 334  WKGLAMYDVATSDTFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETLIKGY 393
            W+GL+MYDV   +   +E+ FD+++HEYAK TT+L AD++ + YSY  PG    T     
Sbjct: 268  WRGLSMYDVNLDEELDEEVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGTARVTDSDNA 327

Query: 394  ENGDIP-PSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSR 452
            EN  +  P  ++S+D+ +YDAN  YGPWA+RQ+Q  +++FSP V R+F       + +  
Sbjct: 328  ENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLRVFSPTVCRNFKLRTPEEIAQQT 387

Query: 453  EHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIE 512
            E A F+  + IMEDSV R+P KE SKDAAFL+KYK T DE+R FGWIDI++ K++NI++ 
Sbjct: 388  EPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPFGWIDIRIAKESNITVR 447

Query: 513  LGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHF 572
            +    +E GFEN  HANLV+  I TSVNHD L  AK+H I    SYP+ W     W  + 
Sbjct: 448  MAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDFSYPYGWQDKAEWNFNV 507

Query: 573  ISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANI 632
             S+  ELF+LRDH  L+ DL TDF+ G+ V YE FRP  Y+F WDI  YS YLN NDANI
Sbjct: 508  CSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRWDIRGYSAYLNVNDANI 567

Query: 633  VNNPLDFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLH 692
            +NNP+DF ENCY+S+HG+ A I   LP                 P F + L  PPWHT  
Sbjct: 568  INNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFTPHFSLFLNAPPWHTFS 627

Query: 693  EFMAQRFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKL 752
            E +  + +GRS  F+  GSY SY            + C+T++   L YG +L+ ++N+K+
Sbjct: 628  ELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIVVLCYGVILKCMLNVKV 687

Query: 753  NYFGEFAQFRTTEEYSEELAQRND---VATDIFNNNDDDQTTELV--EPNSYGESGFDIL 807
            NYFGE   FRTTEEY EEL +RN         FN++ +   +++V  E N   ++ FD  
Sbjct: 688  NYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDVVATESNEIIDASFDAF 747

Query: 808  HGKK-IDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSY 866
             G   I K++LKR++NE D+W TF  + GCF  PE+ Y F +C G +FDN+   +R+L+Y
Sbjct: 748  GGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDACLGFYFDNLEASLRFLNY 807

Query: 867  YADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEE 926
            Y D A S++S Y KR+ D+ + ++F V           D YLS+F+  +H+M G+ P+EE
Sbjct: 808  YVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEE 867

Query: 927  TYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFA 986
            +Y  + DV +  L    D+  LK F+  +   +FGF + E+ L YE  + FD++ +S   
Sbjct: 868  SYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSLQYEREQVFDLNKISCVI 927

Query: 987  DDISIRLNNIDTNK--FISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHNI 1044
            ++++++L N+D ++  ++SL++P  +L   D    +YS R+++ IP   F +   D  + 
Sbjct: 928  ENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDLSIPELLFGIYRGDSEST 987

Query: 1045 VLGXXXXXXXXXXXXRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKXXXX 1104
             LG            R   F     LQ +HIL++DAPF RCSF+ P EY+   +Y+    
Sbjct: 988  CLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYG 1047

Query: 1105 XXXXXXXXXXXXXXXXXNNFDTIFENLLGDIYQDYISEGTFDISNDTKLQLNIDEFKKHS 1164
                             +NF+ IFE LLG+IYQ+Y S+ ++ I++D+   ++  E   H+
Sbjct: 1048 CIPPSSSLPLFPEPISADNFEVIFEKLLGEIYQEYASDSSYQITDDS---ISSTEHDYHN 1104

Query: 1165 ENSFSKHKT-KNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTISD 1223
            +   +   T  +L I   +    + SF+ E   I+  + +   E   ++Y+ LT  ++ +
Sbjct: 1105 QTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPIDGYLDLSATEFMLEIYKYLTEVSLDE 1164

Query: 1224 TIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDF----RLRMYEYYALEDVKHYFVSDI 1279
             ID L + I+N F +TF   + ++E +V+CP I      +   +  + L        S I
Sbjct: 1165 AIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISLSATNKQSKFSMFKLS-------SKI 1217

Query: 1280 NKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSEFSYKS 1339
              LD+  R++        + E     K ++ YK   I   ++     + P + S+  +  
Sbjct: 1218 KNLDITSRIKSSDPNLKPDPE-----KTTLCYKIDYIRANIVQDGIVVPPKQPSQL-FSC 1271

Query: 1340 TFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNF 1399
            + E LEGY  YD   + D N+Q   V ++      + EF+      F+   + ++  ++ 
Sbjct: 1272 SIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPFISTFDLLQRELSSFEDT 1331

Query: 1400 NKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNY 1459
              + KRE L+ I + G+DY IQHDPPVITKPA ITR S  H+R + SWRI+ RLRH+LNY
Sbjct: 1332 LLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNY 1391

Query: 1460 LPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYIPAEV-T 1518
            LPQ W+++ +  L    F S E+A  +FL IF+ WRSWE  DV+  F+++K +       
Sbjct: 1392 LPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDVQGSFVHEKVFTKKRSRP 1451

Query: 1519 FA--KTICFSSDLLTISFNERDKEHLFMNSFMIDIRNDCYVSSAV-GESMAAKSNNVYKT 1575
            FA  +   FSSD + ++  +  +  + +    + IRN+      V G +  +  +  Y +
Sbjct: 1452 FAALQGFTFSSDDIRLNMKDDARVPITVKGVTLGIRNNGLAPEQVDGRTEGSMPDPDYIS 1511

Query: 1576 VVSLDELQINVDXXXXXXXXXXXXXXXFEYVYSNPIVVAKDANGRC-KNISLQLNKITTN 1634
              + DE+ + VD                 +    P+  AK  N     NI+ Q  K+   
Sbjct: 1512 FCTTDEVVMRVDRSFVKTLKEFRDLIH-RFKIGGPVGTAKHDNVSLFSNITFQFGKLYVV 1570

Query: 1635 CFLGNVSLGFIFERIYVYSLIDTLDSGNNSLLSVLLFFDVAKLFFRYKTRNLFSLDFTDL 1694
              L  V L    + +    L       +  + S  L FD  +    Y++    ++D    
Sbjct: 1571 AKLAGVYLRICLDNLSALMLTSQSSVESKVISSSTLSFDHMQAILGYRSFRFMTIDIDMF 1630

Query: 1695 HFNLTYLSKQKTYGFYHSAEFMXXXXXXXXXXXXXEANNEIRLHINEIGQDFASNIQYTE 1754
               L YL  Q  Y     A                E+   +R  I  + +     + + E
Sbjct: 1631 SVLLHYLPGQGCYSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVEALVPEL-FAE 1689

Query: 1755 LPVLPDSQVLKPIAMV-KMXXXXXXXXXXXXXPFILRYSCKEFEINVDFGRILQSSLSLQ 1813
             P+  +S   K  A++ +              PFI+ Y  + FE+  +    +   L+  
Sbjct: 1690 PPIERESSGNKIHAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSG 1749

Query: 1814 DTSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNMRLF 1873
            ++ +E+ S + +  Y KY+H+ LKL G    +      IS D    KLS+F+ K  +   
Sbjct: 1750 ESYMEISSAKQKLDYFKYTHTCLKLSGTS-SSARLFEHISCDIGILKLSVFDLKTRITDL 1808

Query: 1874 LSDIEQAVKNIEILRSTMLETKSSTVQNEF-PFSRLIPIQLNLNVEYIGLLLDFGTTLYV 1932
            L DI+ A+ +++ L   +  ++SS   + F  +  ++P  L+L   Y GLLL FG TLY+
Sbjct: 1809 LQDIKAALFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYI 1868

Query: 1933 LEFNNLEFSFSKDKTSSNPVV-PTFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVI 1991
            LEFNN E   ++D         P F  D+S ES  FLIKDRR+ + L+KV+DF++   ++
Sbjct: 1869 LEFNNFEAKHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMV 1928

Query: 1992 RSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMK------SIYHDIKPRSTSSN 2045
              + L IQS+QIES++L   L+PM++VRLLS +NEF I++      SIY    P S  +N
Sbjct: 1929 HDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIY---TPSSAHNN 1985

Query: 2046 STL------SILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKL 2099
            ST       S+  + IKS HILS++  I WLFD+  ++ +GLI GY+RLF+VY+KPYGKL
Sbjct: 1986 STATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKL 2045

Query: 2100 TLLDAYFSVAHGFSS-STYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEE 2158
            TLL+AYFS A   +S + +Y     K  +N SYL  MQ+ YW  E++   DLFIR++G +
Sbjct: 2046 TLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAK 2105

Query: 2159 LDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKVTSNDPILGEWNY-LDNPLASSVRS 2217
            L V + A   T+++E  QS+  F  LK+ ++DP +    D  + +  Y  +N LA+ VRS
Sbjct: 2106 LAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSDISKEPYNWNNQLATGVRS 2165

Query: 2218 INCIINYAGSSMKLYSRDDIQHGTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNT 2277
            +NCIINYAG ++KL+S D  +      E+ SP++ V IDYKY+P+ +K+H  RTL T   
Sbjct: 2166 LNCIINYAGVTLKLHSHDG-RGDASPLELTSPSYKVAIDYKYFPNLEKTHRFRTLITATP 2224

Query: 2278 THNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAEINYRD---LLEAFDIA 2334
            THNT +     L++++   F+ +LK S ++ +  +    S+  ++   D   LL + D+ 
Sbjct: 2225 THNTFYSTSAFLIHDLCYRFSKLLKTSSTE-NKSSSASTSSSIKVEGSDNSTLLGSIDLV 2283

Query: 2335 VIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHV 2394
            +I+NVGKQE++ +CEP AK+QAT+GFEKFDIKIF N++  +E LCL++++ NLM +SRH+
Sbjct: 2284 IILNVGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIENLMTNSRHI 2343

Query: 2395 FSREXXXXXXXXXXXMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEK 2454
            +SRE           MVF +  S+    YGSTLIS PLFYFN+KQ++DL LF++ W  +K
Sbjct: 2344 YSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQK 2403

Query: 2455 QK----SVNDIILAPVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSL 2510
                  S  + +L    + S  S     K  +   +++F+W Y +I++   AEI+LGPSL
Sbjct: 2404 TPMNTGSYPEGVLVDDISRSIGS-----KFYKGSSSSSFTWGYSVIVAGSCAEIELGPSL 2458

Query: 2511 GLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIIN 2570
            G++ V S+++W +S   +DW+Q+L ++M ++ ++SSGRLGG   +++     ++ WP   
Sbjct: 2459 GVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPK 2518

Query: 2571 NFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSV 2630
            +F  VPLV + L     +TKLSFDYH FFIS+++     LFN++DE G LADLLSV+VS 
Sbjct: 2519 DFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSF 2578

Query: 2631 DNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLLESNELKKISSFDNSKMLASLLSL 2690
            +++ +F+T+LA AN+ DI ++I R++ D+  + L    +++       ++  +  +L  L
Sbjct: 2579 ESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEEDGGIFDTLSLL 2638

Query: 2691 RTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQ 2750
            RT+LS+N  +  L I  T+L  ++V++L   K++ANT  +A      D K++T+L WQL 
Sbjct: 2639 RTQLSLNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQA------DIKIKTDLHWQLD 2692

Query: 2751 DMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIE 2810
            D+SL+L  F + LDE+ L  ++V  Y++L+S I GG I  APSI V M TWQ   SNVIE
Sbjct: 2693 DVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIE 2752

Query: 2811 LLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDE-DIEAKL 2869
            LLYS+SFG  V I WNL PI+FIKDMW  H+NAM+LR       +E  +     + +A  
Sbjct: 2753 LLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVP 2812

Query: 2870 AKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLS 2929
             ++ LG+ Y Y PL+EP+IEMP+IKDLGDATPP+EWFG+NR++FPG THQ V+VPLQKL+
Sbjct: 2813 LEMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLA 2872

Query: 2930 AVAEKEYVRILGKV 2943
              AEKEY +ILG+ 
Sbjct: 2873 RTAEKEYEKILGRA 2886

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 1089 bits (2817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1556 (38%), Positives = 889/1556 (57%), Gaps = 52/1556 (3%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            MD  ++F+AI +  E  F WVFLV+W  ++++++   FY  RA+ Y +T ++ WV+W+RY
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQL----KNS 116
            KV INIQSL  S +GG+V+FKN+++  +DQTIS L+G+FTWRYWLLN R T L    K+ 
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSG 120

Query: 117  NINDENSK---CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGR 173
               D+ S+   CRF LE DG ELFIYN+   Y+ IL  +AK DK+S +KF    E     
Sbjct: 121  EEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFFEGGEDSLH- 179

Query: 174  VKTDSSVMFDPLDESSEQSKVGQTILNSVSNQSAVPLYLDFLPAEVILSSGAVVVGNKHT 233
              ++  +  + L   S  S V  T   +   Q +  + L FLP  + ++ GAV++GN  T
Sbjct: 180  -SSEEKLEDETLASDSSVSNVDSTNDRNFQEQDSRSMLLQFLPIHLKVNRGAVLLGNTTT 238

Query: 234  PSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKID 293
            PSV II Y   EG++DV      LD YK+R + + ++  + +KPNISFG+ +  K + + 
Sbjct: 239  PSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSYIVH 298

Query: 294  GKPFNLWQKLKDCLLFTISHILAFTGNKKGL-TGQEEFLTSWKGLAMY---DVATSD--- 346
             +   +W+K K      +SH LA + N+K +    ++F   W+GLA+Y   +V TSD   
Sbjct: 299  SRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSDHSV 358

Query: 347  -----TFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETLIKGYENGDIP-- 399
                    + +  D+ NHEYAKYT IL + ++ + Y+YD PG++    +   E  D P  
Sbjct: 359  GDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDGPDV 418

Query: 400  ----PSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHA 455
                  PE+S+D +LY A   YGPWAHRQ+QY  +M  P VSRD    +K   G  R + 
Sbjct: 419  GNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGSRRIYT 478

Query: 456  NFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGL 515
             F   +++MED++WRIPT+E SKD  FL +Y+ + ++ R FGW+DIKL K+T++ + +G+
Sbjct: 479  RFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLFMTVGM 538

Query: 516  QASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISS 575
              +  GFEN    +LV P I +SVNHD+ F A A  I A   YP  WNS   W   F S 
Sbjct: 539  CPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVFQFNSK 598

Query: 576  DLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNN 635
             +  F LRDH NLL D+F DF SG   PYELFRP +Y+F W I NYS+YLN NDANI+NN
Sbjct: 599  QVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDANIINN 658

Query: 636  PLDFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEFM 695
            PLDFNENCY+S+HG++ +I   +                  P+F +QL TP W TLHEFM
Sbjct: 659  PLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWSTLHEFM 718

Query: 696  AQRFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNYF 755
              + VGRS++F  +GSY  +            +EC++ + T    GF++RY+MN+ +NYF
Sbjct: 719  KNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNINMNYF 778

Query: 756  GEFAQFRTTEEYSEELAQRNDV-ATDIFNNNDDDQTTELVE----PNSYGESGFDILH-- 808
            G+F  F+TTEEY+ EL ++ +    ++  +N  D+++++       N    + +D LH  
Sbjct: 779  GDFIHFKTTEEYTRELQEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTEYD-LHEF 837

Query: 809  --GKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSY 866
                K+ +A LKR  NEKD+W TF  EDGC V PE+ YD  SC GLHFD++  D+RYL+Y
Sbjct: 838  NEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVDLRYLNY 897

Query: 867  YADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEE 926
            Y DL  S++ TYIKR+ D +  ++FDV  +   +   + G+LSE NIH HRMFGLP  EE
Sbjct: 898  YMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFGLPIIEE 957

Query: 927  TYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFA 986
            TY  K D  +G L  +SDI+  KG I   +K  FG+ ++E++L YE+ +  D++ L+   
Sbjct: 958  TYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMTSLTLVT 1017

Query: 987  DDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHNIVL 1046
            D IS ++ + +TN  ++L +  +S  ++DF   +YS + +  IPN   LVS     N V 
Sbjct: 1018 DSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKSSKNEVQ 1077

Query: 1047 GXXXXXXXXXXXXRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKXXXXXX 1106
            G            +N DF    NLQ  HI L D+P+ RC+FL P +YQ + LY       
Sbjct: 1078 GLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPMQYQKTVLYNKLFGAI 1137

Query: 1107 XXXXXXXXXXXXXXXNNFDTIFENLLGDIYQDYISEGTFDISNDTKLQLNIDEFKKHSEN 1166
                           N  D+IFE+LLG  YQDY      + S +T +      F + S +
Sbjct: 1138 TPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSSFIQGSGS 1197

Query: 1167 SFSKHK----TKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTIS 1222
            + +  +    ++N     ++   E  SF+  L    I I+    +    +Y Q    +I 
Sbjct: 1198 TSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQFCVGSID 1257

Query: 1223 DTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYE-YYALEDVKHYFVSDINK 1281
            D ID   +DIV  FSK F   S+VT  +V+ P+I F     +  + + D  H +V ++N 
Sbjct: 1258 DIIDANEIDIVEKFSKYFVEKSAVTNLRVLAPKICFTFGSPKGKFEVSDYDHLYV-EVNH 1316

Query: 1282 LDLNLRLRQEYDKESANSEMNSKNKLSVYYKTA----LINGKMLSKENFIYPSESSEFSY 1337
              L+L  ++ +  ++ +S++    +++   K +     IN + L  +  +     +   +
Sbjct: 1317 PSLDLCQKKIFG-QTNSSKLEYTEEVTSSLKASSINFFINQQQLKPKTLL----KARPVF 1371

Query: 1338 KSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISK 1397
               FEELE ++   +      N +    F+N    + +S++++ + L       S + SK
Sbjct: 1372 SIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKSK 1431

Query: 1398 NFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVL 1457
               ++ ++EL+ R A A  +Y I HD PVITKPA ITRLS++H+RE+RSWRI+TRLRH+L
Sbjct: 1432 TLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHIL 1491

Query: 1458 NYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYI 1513
            NYLP+ WY+ T   L+K +F+  +DA+ QFL IF+ WRSWEF+DV++C++YK+ ++
Sbjct: 1492 NYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFL 1547

 Score =  984 bits (2545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/1184 (44%), Positives = 752/1184 (63%), Gaps = 47/1184 (3%)

Query: 1786 PFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGN 1845
            PF +  S    E++V+    L + ++++D  +ELLS   ++ Y+K+S S + L+   + N
Sbjct: 1835 PFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLV---ISN 1891

Query: 1846 TDNLGRISLD----SSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTM--LETKSSTV 1899
            T     + L+    S  SKL++ +P++ +   + D   A+KN   L+S      +K+   
Sbjct: 1892 TPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQEK 1951

Query: 1900 QNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPV---VPTF 1956
              +   + +I + L++NVEYIG+++  G+  YVLE NN+  S S + ++   +   +   
Sbjct: 1952 SKQRKQTNIIWL-LHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGI 2010

Query: 1957 SSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMS 2016
              D+S E++  LI   R+K  LSK++D ++ +KV +     +Q++QIESS+    L PMS
Sbjct: 2011 VGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMS 2070

Query: 2017 LVRLLSFVNEFSIMKSIYHDIKPRST------SSNSTLSILPISIKSAHILSYNLCIGWL 2070
            L ++L  +NEF+ +   Y   K RS+      ++ + +S L    +S  ILSYN CIGW+
Sbjct: 2071 LTKVLWAINEFTRVSEAY---KTRSSLLQHKKTAPTDISELSNKFRSIQILSYNFCIGWI 2127

Query: 2071 FDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRS 2130
            FD G   + GLIWGYERLFA Y KPYGKLTLLDAYFS+AHG SS T++ +G EK   NRS
Sbjct: 2128 FDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFFSNGKEKDQFNRS 2187

Query: 2131 YLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILD 2190
            YLPSMQI YW  +E  T +LF+R+ GE LDV+ L+    I + A +S+  F++LK+T++D
Sbjct: 2188 YLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVD 2247

Query: 2191 PLKV--TSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQHGT-CSFEIR 2247
            P     T+  P+  E   LD P+ S +R+ NCI+ YAG   KL+S +DIQ+ +  SFE+ 
Sbjct: 2248 PFATNKTTEKPVNSEAAPLD-PILSKIRAFNCIVKYAGGVFKLFSEEDIQNNSKPSFEVE 2306

Query: 2248 SPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQ 2307
            SP+  V IDYK+ P   KSHWIR L TV+ ++NTLFP CVP+L+ M      MLK+  S+
Sbjct: 2307 SPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSK 2366

Query: 2308 FSNGAPNLASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKI 2367
                  N   + + +NY+ LL AFDIA ++N+GKQ ISL+CEP AK+QA +GFEK  +K+
Sbjct: 2367 -PKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKM 2425

Query: 2368 FTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTYGSTL 2427
            FTN++   EPL LS+D+ +L A+SRH+FSRE            VF LTH E I TYG+TL
Sbjct: 2426 FTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTL 2485

Query: 2428 ISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVNDIILAPVTA-------SSFESVPSMPKL 2480
            +S    YFN+KQ++DLNLFL+IW  + Q     I+  P          SS + +P + K 
Sbjct: 2486 VSDVQIYFNMKQLQDLNLFLDIWKPDSQ-----ILEMPKGGNTRTRSLSSHDKLP-VSKF 2539

Query: 2481 QRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKE 2540
            Q+      F W+Y LI S I  +IDLGPSLG++ V+++  W +S H +DW Q+L + ++ 
Sbjct: 2540 QKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLEN 2599

Query: 2541 ICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFI 2600
            I +SS GRLGG++ I+ + W S+I+WP+   F+  PL+ LSL LG+   K SFDYHMF I
Sbjct: 2600 ILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLI 2659

Query: 2601 STIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSG 2660
            + +++  ++L+N++DE G L DLL+VSV+   I +F+T+LA AN  DIY+TI RMR D+ 
Sbjct: 2660 ANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNK 2719

Query: 2661 RTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLR 2719
             + ++ L +SN     S   N  +L SL  LRT+LSV   L  L +F +TL   EV+VL+
Sbjct: 2720 NSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLK 2779

Query: 2720 TRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKL 2779
               + A+T+      T  D KV+T L WQL +  +SLS+FK+Q +E  + +I+V +Y+K 
Sbjct: 2780 AEDMSAHTQ------TQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKH 2833

Query: 2780 ASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSI 2839
            A+ + GG IL AP+I V M TWQ   SNVIELLY+SSFG  V + WNL PINFI++MW+ 
Sbjct: 2834 ATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWAT 2893

Query: 2840 HINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDA 2899
            H+ A+ LR +           +DE IE K+  VDLG KY+Y PLEEP IEMP+IKDLGDA
Sbjct: 2894 HVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDA 2953

Query: 2900 TPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILGKV 2943
            TPPVEWFG+NR RFPGLTHQ VVVPLQKL+ +AE+EY R+LG V
Sbjct: 2954 TPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGNV 2997

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1538 (33%), Positives = 795/1538 (51%), Gaps = 48/1538 (3%)

Query: 5    TEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYKVVI 64
            ++F+ + +     F WVFLV+W  ++ +++   FY  R  GY +T +L W+ WKRYKV I
Sbjct: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62

Query: 65   NIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNINDENS- 123
            +IQSL  S +GG+++FKN+++  ++QT S L+G+ TWRYWLLN R T    ++ N + S 
Sbjct: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKSV 122

Query: 124  ---KCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKF---ATDDESIFGRVKTD 177
                CRF++EC G+E FIYNK   +++ILN L + D +  + F    +D  +    V  D
Sbjct: 123  EKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSDKNTDECSVDED 182

Query: 178  SSVMFDPLDESSEQSKVGQTILNSVSNQS--AVPLYLDFLPAEVILSSGAVVVGNKHTPS 235
            S+     L+ S+         LN  S QS  + P +L  LP E  +  GAVV+GNK + S
Sbjct: 183  SAGQRSHLETSTSSPSSKSKSLNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIGNKTSSS 242

Query: 236  VAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKIDGK 295
            V ++ Y +++G++D   P S +D YK++   E     +S+KPN+S  + +  K      K
Sbjct: 243  VMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVKRSK 302

Query: 296  PFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTFSDEIPFD 355
               LW +    L F      +         G    L  W+GL +Y       + D   FD
Sbjct: 303  LSKLWHRSYQ-LFFKTDSPSSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRFQFD 361

Query: 356  LQNHEYAKYTTILNADRIKLLYSYDTPGVITETLIKGYENGDIP------PSPEYSIDVQ 409
            L  HEYA+YT ++  D + L Y++D PG++    +  ++  D P      P P+YSID+Q
Sbjct: 362  LSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGPPPDYSIDIQ 421

Query: 410  LYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCEIVIMEDSVW 469
            +  A+ YYGPW+H ++    K+FSP VSRD     +   G  R +   R  I+I+ +SVW
Sbjct: 422  ISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIVGESVW 481

Query: 470  RIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASECGFENTFHAN 529
            RIPT+E SKD  FL +++ T DE+R FGW+++ L++ + +   + +  +  GF+NT   +
Sbjct: 482  RIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDLH 541

Query: 530  LVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELFILRDHFNLL 589
             V P I TSVNHD+L +A+ H + A   YP  WN    W    +S+  ++FIL+DH  LL
Sbjct: 542  FVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHITLL 601

Query: 590  VDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFNENCYISIHG 649
             D+ +DF SG+  PYELFRP  Y F+W+ + YS+YLN NDANIVNNP++FNENCY+S HG
Sbjct: 602  GDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANIVNNPVNFNENCYLSFHG 661

Query: 650  NSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEFMAQRFVGRSHEFSAS 709
            +  R+  ++P                 P F + + TP W+TLHEFM  + VGRS  FS S
Sbjct: 662  DDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSLS 721

Query: 710  GSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQFRTTEEYSE 769
            GSYL +            +EC +   T   YG++LRY + +K+NYFG+F  F+TTEEY E
Sbjct: 722  GSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEYME 781

Query: 770  ELAQRNDVATDIFNNNDDDQTT--ELVEPNSYGESGF-DILHGKKIDKASLKRTVNEKDI 826
            EL   N V     ++  + Q    ++ E +S  E    D L  K   K SLKR VNEKD+
Sbjct: 782  ELRGTNAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPLTAK---KTSLKRMVNEKDV 838

Query: 827  WVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYIKRYPDVS 886
            W TF  EDGCF+LPE+ YD  SC+ L FD++  D+R+++YY D+  +++   I+R  D  
Sbjct: 839  WFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLIDCG 898

Query: 887  SNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYLSFESDIE 946
               VF+  G          G LS  +IH HRMFGLPPAEETY  K D SLG L   SD+ 
Sbjct: 899  CEEVFEQKG-RALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLP 957

Query: 947  ALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNIDTNKFISLSI 1006
               GFI    K  FGF ++E++++Y++A   D++ ++   D I    + I     I L+ 
Sbjct: 958  FTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKDETAIQLNA 1017

Query: 1007 PNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHNIVLGXXXXXXXXXXXXRNPDFKT 1066
             ++S K  D   S YS R ++D+ N    +   +  N  +             +  D   
Sbjct: 1018 QDISAKFADLENSLYSSRVDLDVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDLLA 1077

Query: 1067 TNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKXXXXXXXXXXXXXXXXXXXXXNNFDT 1126
             +  Q  HI  +DAPF RC FL P   Q S  YK                      N   
Sbjct: 1078 HSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKA 1137

Query: 1127 IFENLLG--DIYQDYISEGTFDISNDTKLQLNIDEFKKHSENSFSKHKTK---------N 1175
            +F+  L   +  +D++                ++E K  + +S    K +         +
Sbjct: 1138 VFQGYLKAENASKDFVDR-----------WFPVNEVKNKNSSSLKDFKGQLQPILDDNTS 1186

Query: 1176 LTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTISDTIDGLGVDIVNN 1235
            L+    D   E  + V  L +  + I  +  EV  +   Q     I   ID + +D+V +
Sbjct: 1187 LSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLH 1246

Query: 1236 FSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDINKLDLNLRLRQEYD-K 1294
            F K      +    +V+ P +D     Y      DV+       N++ L+  L++     
Sbjct: 1247 FIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLP 1306

Query: 1295 ESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSEFSYKSTFEELEGYAFYDDDL 1354
             S N   ++ + L +      +  K+  K  F    E+   ++  + +ELE +++ +   
Sbjct: 1307 GSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDEN--IAFGCSVKELEAWSYLNGIA 1364

Query: 1355 VTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQA 1414
             +   L+     +  +  + + +F++  +      I  ++      +  ++E   RI++A
Sbjct: 1365 DSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKA 1424

Query: 1415 GQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNYLPQYWYETTSLELQK 1474
              +Y I HDPPVITKPA ITRL   HVRESRSW+IVTRLRH+LNYLP         +L+ 
Sbjct: 1425 SDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKN 1484

Query: 1475 GKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTY 1512
             ++     A+  FL+IF+ W +W+++DVE+C++Y++ +
Sbjct: 1485 SEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVF 1522

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/1160 (39%), Positives = 687/1160 (59%), Gaps = 45/1160 (3%)

Query: 1810 LSLQDTSVELLSLEFQEPYMKYSHSYLKL-IGMDLGNTDNLGRISLDSSFSKLSIFEPKK 1868
            L+ +   +++ S    + Y+K S S +   +     N  +   + LDS+ +KL +++P+ 
Sbjct: 1826 LAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPTVKLDSNITKLKLYDPRD 1885

Query: 1869 NMRLFLSDIEQAVKNIEILRSTM--LETKS-----STVQNEFPFSRLIPIQLNLNVEYIG 1921
                   DI QA   +  L+S    L TK+     S    +F FS     Q+ LN  Y+G
Sbjct: 1886 ITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVRLN--YVG 1943

Query: 1922 LLLDFGTTLYVLEFNNLEFSFSKDK---TSSNPVVPTFSSDYSSESICFLIKDRRVKETL 1978
            LL+  G+T Y+ E N +    + D+    +S         D S+ SI FLI DR + E L
Sbjct: 1944 LLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAASIAFLINDRMLPEAL 2003

Query: 1979 SKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMKSIYHDIK 2038
            S+V+DF++ IK+ + S   I+SLQIES Y    LSP SLVR+L  VNE S +  +     
Sbjct: 2004 SRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQKRQT 2063

Query: 2039 ----PRSTSSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDK 2094
                P S     T      + +S  +LSYN C+GW+FD+  +   GLIWGY+RLFA ++K
Sbjct: 2064 VGKLPESVEVRETFRFRR-AFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEK 2122

Query: 2095 PYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRV 2154
            PYGKLTLLDAYFS+A G +S  +Y   N     NRS+LPSMQI YW+E +  T +LFIR+
Sbjct: 2123 PYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRI 2182

Query: 2155 NGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKVTSNDPILGEWNYLDN-PLAS 2213
            NGE LDV  L+    +     +SL+ F +LK+  +DP K  +N       +     P  S
Sbjct: 2183 NGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFKSVANPKRPSATSTFSKFPGLS 2242

Query: 2214 SVRSINCIINYAGSSMKLYSRDDIQH-GTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTL 2272
            +++ ++C + YAG   +LYS DD+Q+    SF++ SP+  +  DY+     K SH +R  
Sbjct: 2243 TIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAW 2302

Query: 2273 ATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKA----EINYRDLL 2328
              V ++HNT+FP CVP+LNEM      +LK       N +P  AS K+     ++YR  L
Sbjct: 2303 MIVYSSHNTIFPTCVPVLNEMARDIRQLLKGF-----NRSPQEASHKSVSQESLDYRSFL 2357

Query: 2329 EAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLM 2388
               DI+ +I++GKQ+IS +CEP AK+QA +GFEK  +K+FTN +   EPL LS+D++ + 
Sbjct: 2358 RGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEIT 2417

Query: 2389 ASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLE 2448
            A SRH+FSRE            +F LTH + IHTYG   I     YFN+KQ++DLN+F+ 
Sbjct: 2418 AKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVN 2477

Query: 2449 IWSIEK----QKSVNDIILAPVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEI 2504
            IW  +     Q  ++      +T+   E  P + K ++V    +F W+++LIIS+I  +I
Sbjct: 2478 IWKPDSYVFTQPELDSEHSRALTS---EEKPLVAKFKKVSSTTSFPWNFILIISKIKGDI 2534

Query: 2505 DLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKI 2564
            DLG SLG++ + +D +W ++ H  DWTQKL + M++I +SS GRLGG + +++  W S+I
Sbjct: 2535 DLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRI 2594

Query: 2565 TWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLL 2624
             WP+       PLV L + L  F+ KLSFDYH+  I++++   ++LFN++D RG   +LL
Sbjct: 2595 RWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLL 2654

Query: 2625 SVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLLESNELKKISSFDNSK-M 2683
            SV++S ++ Q+F+T+LA AN+ D+Y+TI RMR D+ ++  + L  +  K   S   SK +
Sbjct: 2655 SVAISSNSTQLFLTALAPANILDVYNTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDI 2714

Query: 2684 LASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQT 2743
            L SL  LRTEL V+ + +++ I+ + L   EV+  + +  +  ++ E       D K++T
Sbjct: 2715 LNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFKAKDFLTQSQIEG------DEKLKT 2768

Query: 2744 ELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQS 2803
             L WQ+  + ++LS FK+QL E    +I V +Y++ A    GG IL  P+I + M TW  
Sbjct: 2769 HLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADGGTILVIPAILIGMTTWHD 2828

Query: 2804 QYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDE 2863
              +N +ELLYS+SFG  + I WNL  INF+++MW+ H+ AM LR    G        +DE
Sbjct: 2829 VATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMALRRSHNGQPRGFF--EDE 2886

Query: 2864 DIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVV 2923
             +E KL  VDLG +Y Y PLEEP+IE+P+ KDLG+ATPPVEWFG+NR +FPGLTHQ ++V
Sbjct: 2887 HLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQAMIV 2946

Query: 2924 PLQKLSAVAEKEYVRILGKV 2943
            PLQKL+ +AE E+ RILG+ 
Sbjct: 2947 PLQKLAHIAETEWARILGRA 2966

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1548 (33%), Positives = 809/1548 (52%), Gaps = 62/1548 (4%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            M+  ++   + + +++ F WVFLV+W   ++  + T FY+ R   Y+V+ IL W++WKR 
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQL----KNS 116
            K+ IN+++L  S++GG++YFK++S+  +D TISIL+G+ TW+YWLLN R  +L    KNS
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120

Query: 117  NINDENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRVKT 176
            +  +    C+F LEC+G+E FIYN+   Y++++N L+K ++D   K+   +E  F    +
Sbjct: 121  SGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYL--NEHSFPEPFS 178

Query: 177  DSSV---MFDPLDESSEQSKVGQTILN----SVSNQSAVPLYLDFLPAEVILSSGAVVVG 229
            D S    + + L ES+  +    +I+N      +N    P  L F P E+ L+ G++++G
Sbjct: 179  DGSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLG 238

Query: 230  NKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKK 289
            NK TPSV I+ Y   EGIIDV  P   LD Y+ ++  EL +  +S+K NI + +    K 
Sbjct: 239  NKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKF 298

Query: 290  HKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTFS 349
                GK   LW+     L      ++   G K G    + F   WKGL++Y  +  D  +
Sbjct: 299  KLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAG-PSDDAFFQKWKGLSLYKASAGDAKT 357

Query: 350  ---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETL------IKGYENGDIPP 400
               D+I FD  +HEYAK+T+IL   ++ L Y  D PGV+          I G + G+   
Sbjct: 358  SDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGA 417

Query: 401  SPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCE 460
             P++++DVQ++  +  YGPWA RQ+ +  ++ SP VSR     +K   G  R +  FR  
Sbjct: 418  PPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMN 477

Query: 461  IVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASEC 520
            I+IMED+ WRIPT+E SKDA FL  YK T++E R FGW+D++  KDT  +  + +  +  
Sbjct: 478  ILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVE 537

Query: 521  GFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELF 580
            GF+N FH + V   I +SVNHD+L  +K   +     YP  WNS   W ++  S  LE F
Sbjct: 538  GFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAF 597

Query: 581  ILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFN 640
            +LR+H  L+ D  +DF++GD  PYELFRP +Y+ +W++  YS+YLN ND NIVNNPLDFN
Sbjct: 598  LLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFN 657

Query: 641  ENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEFMAQRFV 700
            ENCY+S+HG+   I + +P                 P F + L TPPW+TL+EFM  + V
Sbjct: 658  ENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEV 717

Query: 701  GRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQ 760
            GRS++F+  G YL Y            + C +N      YGF++RY++N+K+NYFGEF  
Sbjct: 718  GRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFN 777

Query: 761  FRTTEEYSEELAQRNDVATDIFNNNDDDQTTELVEPNSYGESGFDILHGKKIDKASLKRT 820
            F T+EEY+  L  R +V   +  ++  D  + L      G    D      + ++ LKRT
Sbjct: 778  FVTSEEYTGVLGAR-EVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNGPMKRSDLKRT 836

Query: 821  VNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYIK 880
             NE DIW TF   +G  +LPE+ Y F  C  LHF  +  D R  +YY D+   +N T IK
Sbjct: 837  TNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIK 896

Query: 881  RYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYLS 940
            R+     N VFD    N        G LS+  IH HRM+GLPP E TY  + D++LG L+
Sbjct: 897  RHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELN 956

Query: 941  FESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNIDTNK 1000
              SDIE LKGF     K  FG+++ E++L Y+     D++ L+  A+ I+I LN+     
Sbjct: 957  INSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKS 1016

Query: 1001 FISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSM--DDHNIVLGXXXXXXXXXXX 1058
               +S+ ++   L+DF   +YS R +I +P     +S +  D  N               
Sbjct: 1017 QSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNF 1076

Query: 1059 XRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKXXXXXXXXXXXXXXXXXX 1118
             +  D     + Q ++I+++D+P+ RC FL P  YQ SD Y+                  
Sbjct: 1077 GQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLP 1136

Query: 1119 XXXNNFDTIFENLLGDI---------YQDYISEGTFDISNDTKLQLNIDEFKKHSENSFS 1169
               +  D I E+++G+          ++D  +E     S    L+ +  E          
Sbjct: 1137 TLPDTIDYIIEDIVGEYATLLEATNPFKDLFAETP---STVEPLRASFTEDDDEEAADPL 1193

Query: 1170 KHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTISDTIDGLG 1229
            + K    T +I    HE  ++V ++ +I +DI   +      L  Q  +  +   +D + 
Sbjct: 1194 EFKPVAFTEEIN---HERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIE 1250

Query: 1230 VDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDINKLDLNLRLR 1289
            + IV   S    G  S++   +    ++    +++    E  + Y       LD   R+ 
Sbjct: 1251 IGIVKRLSNLQEGIVSISNIDIHVAYLNL---IWQETGEEGFELY-------LD---RIN 1297

Query: 1290 QEYDKESANSEMNSKN-KLSVYYKTALINGKMLSKENFIYPSESSEFSYKSTFEELEGYA 1348
             +  ++S      SK+ +++V  K   +   +  K+N     E SE    +    LEG+ 
Sbjct: 1298 YQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKN----PELSEDRPPALSLGLEGFE 1353

Query: 1349 FY---DDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNFNKSMKR 1405
             +   +D  V   NL    + I++   + + E+             SV   +N   S K 
Sbjct: 1354 VWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKT 1413

Query: 1406 ELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNYLPQYWY 1465
            EL+ ++  A + Y I HDP VITKPA I RLS+ HVRE+RSW+I+TRLRH+L YLP  W 
Sbjct: 1414 ELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ 1473

Query: 1466 ETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYI 1513
                  L++ K+   +DAK  F+ +F+ WR+WEF+DV R ++Y K ++
Sbjct: 1474 TNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFL 1521

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/1184 (37%), Positives = 666/1184 (56%), Gaps = 52/1184 (4%)

Query: 1786 PFILRYSCKEFEINVD-FG--RILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMD 1842
            PF +R+  K+ +I  + FG   IL   LS+ DT   + S + +E Y+++S   +++ G  
Sbjct: 1794 PFYIRHEAKQLDIYFNKFGSNEIL---LSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGF 1850

Query: 1843 LGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSD---IEQAVKNIEILRSTMLETKSSTV 1899
                 +L  + +  S  KL+  EP++ +  FL D     Q +  +  L S  L T     
Sbjct: 1851 SKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLNSLFLTTDPMNA 1910

Query: 1900 QNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSD 1959
            + E P +++I   L+ N+ Y G+L+   +T +V E + L  S +       P     +  
Sbjct: 1911 KKETP-AKMINWTLDTNISYFGILVPVASTYFVFELHMLLLSLTNTNNGLLPEQTRLTGQ 1969

Query: 1960 YSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVR 2019
             S E+I FLIK+R +   LSK+LDFS+++  ++ +    QS Q+ESS+    LSP SL+R
Sbjct: 1970 LSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLR 2029

Query: 2020 LLSFVNEFSIMKSIYH--------DIKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLF 2071
            L+    +   M   Y         +I+  +  S+    I PI+ +S HILSY  CIGWLF
Sbjct: 2030 LIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKEI-PINFRSIHILSYKFCIGWLF 2088

Query: 2072 DLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSY 2131
              G   + GL++GY RLF+ Y+K +GK T++DA+FSV++G +SST++ +GNEK   NRS+
Sbjct: 2089 QYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSF 2148

Query: 2132 LPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILD- 2190
            LP+MQI+YW +     KD F R +GE LDV+ L  +  ++D   QS+  F++LK+ ILD 
Sbjct: 2149 LPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDM 2208

Query: 2191 ----PLKVTSNDPILGEWNYLDN--PLASSVRSINCIINYAGSSMKLYSRDDIQHGT-CS 2243
                 ++ +S D      N  ++  P   ++RS+NC   Y G   ++Y+ DDI+  +  S
Sbjct: 2209 PHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPS 2268

Query: 2244 FEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKN 2303
            FE++SP  T+   YK+  SK K H IRTL TV+ THNTL+  C PLL E    F+  L+N
Sbjct: 2269 FELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLME----FSESLQN 2324

Query: 2304 SCSQFSNG--APNLASAKAE-INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGF 2360
               + S G   PN      + ++Y+ LL+ FD+AV +   KQ++SL+CEP AK+QA +GF
Sbjct: 2325 MIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGF 2384

Query: 2361 EKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYI 2420
            E F   + TN    ++PL  S+ L    AS +H+FSRE           +    TH + I
Sbjct: 2385 ESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVI 2444

Query: 2421 HTYGSTLISKPLFYFNVKQIEDLNLFLEIW---SIEKQKSVNDIILAPVTASSFESVPSM 2477
              YG++L+S    +FNVKQ+++L LFL+IW   SI   +         V  S+  S    
Sbjct: 2445 SMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSN--- 2501

Query: 2478 PKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLIS 2537
                 V +     W + LI + +  ++DLGPSLG++ ++S   W  + H  +  Q L   
Sbjct: 2502 ---SNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAF 2558

Query: 2538 MKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHM 2597
               I ++S GRL G   + +  W S++ WP+ N+ +  PLV  SL +     K +FDYHM
Sbjct: 2559 TDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHM 2618

Query: 2598 FFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRN 2657
            F I TI N    L N++D +G L DLL VS S D I +  T+L  AN+ DIY+TI RMR 
Sbjct: 2619 FLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQ 2678

Query: 2658 DSGRTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVV 2716
            D+  + ++ L +SN  +         +L SL  LRT+LSVN   L + I   +L   EV+
Sbjct: 2679 DNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVL 2738

Query: 2717 VLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDY 2776
            V+R  KV         S+T S  K++T+L  Q+ D+S +LS+ K +LDE     I + DY
Sbjct: 2739 VVRIDKV------SIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAIDDY 2792

Query: 2777 VKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDM 2836
            +  AS I GG I++ P + V M T Q + +N +E L++ SF + +S+ WNL PINFIK+M
Sbjct: 2793 MHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFIKEM 2852

Query: 2837 WSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDL 2896
            W+ H+ A+ +R  Q  N S      +E++E  + + +  +K+ Y  LEEP IE+P+I+DL
Sbjct: 2853 WTTHVKALAVRRSQTANIS--FGQTEEELEESIKREENASKFNYIALEEPQIEVPQIRDL 2910

Query: 2897 GDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940
            G+ATPP+EWFG+NR R P  THQ  V+P+QKL  +AEK+YV+IL
Sbjct: 2911 GEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/1556 (32%), Positives = 810/1556 (52%), Gaps = 107/1556 (6%)

Query: 5    TEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYKVVI 64
            +EF  + +   + F WVFL +W  ++ +++ + FY  R +GY +T IL ++ WKRY V +
Sbjct: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

Query: 65   NIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNINDENSK 124
                       G+V+FKN+++  +DQT SIL G+ TWRYWLL+ R T L++ +       
Sbjct: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSEKAAKLP 111

Query: 125  CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKF-------ATDDESIFGRVKTD 177
            CRF++EC G+E FIYN+   +++IL+ L + D+++ +KF       AT++ S     + D
Sbjct: 112  CRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETS----TEND 167

Query: 178  SSVMFDPLDESSEQSKVGQTILNSVSNQ--SAVPLYLDFLPAEVILSSGAVVVGNKHTPS 235
            S+     L+ S          LN  + Q  +++P +L  LP E  +  GA+++GNK T S
Sbjct: 168  SAAQKSHLETSMSSPSASTESLNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKTSS 227

Query: 236  VAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKIDGK 295
            V +  + +++G +D   P + +D YK++ + +++  ++S++PN+ + N    K      +
Sbjct: 228  VMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANR 287

Query: 296  PFNLWQKLKDCLLFTISHILAFTGNKKGLTGQE--EFLTSWKGLAMYDVATSDTFSDEIP 353
               L  K  +  L      L+  G+K   T ++    L  W+GL +Y       + D   
Sbjct: 288  LPKLLHKYYETFLRVRKRYLS-RGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVFH 346

Query: 354  FDLQNHEYAKYTTILNADRIKLLYSYDTPGVI------TETLIKGYENGDIPPSPEYSID 407
            F+L  HEYA+Y+ ++  + + + YS+DTPGV+      T   + G + G+    P++S+D
Sbjct: 347  FELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLD 406

Query: 408  VQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCEIVIMEDS 467
            +Q++ AN +YGPWAH ++    K+FSP VSRD     +   G +R     R  I+IM DS
Sbjct: 407  IQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDS 466

Query: 468  VWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASECGFENTFH 527
            +WRIPT+EPSKD  FL +YK T D++R FGW+++ L + + + + + +  +  GF+N   
Sbjct: 467  IWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLD 526

Query: 528  ANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELFILRDHFN 587
             + + P I TSVNHD+L +A+ H I A+  YP  WN+   W     S    +FIL+DH  
Sbjct: 527  LHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHIT 586

Query: 588  LLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFNENCYISI 647
            LL D+ +DF +GD  PY+LFRP +Y+F+W+++ YS+YLN NDANIVNNP+DFNENCY+S 
Sbjct: 587  LLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSF 646

Query: 648  HGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEFMAQRFVGRSHEFS 707
            HG+  RI  ++P                 P F + + TP W+TLHEFM  + VGR+ +FS
Sbjct: 647  HGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFS 706

Query: 708  ASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQFRTTEEY 767
             +GSYL +            +ECK+   T   YG+++R+++ +K+NYFG+F  F+TTEEY
Sbjct: 707  LAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEY 766

Query: 768  SEELAQRNDVATDIFNNNDDDQTTELVEPNSYGESGFDILHGKK--------IDKASLKR 819
             EEL    D   +   N+  +Q+    E  + GE G D  +  K          K SLKR
Sbjct: 767  MEEL---RDAYVEPKANS--EQSANSTETTTAGE-GEDKQNAPKNHTTDPVMAKKLSLKR 820

Query: 820  TVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYI 879
             VNEKD+W TF  EDGC +LP++ YD  +CF   FD++  D+RY++YY DL  +++   +
Sbjct: 821  MVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIV 880

Query: 880  KRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYL 939
            +   D     +F          +N+ G +S+ +IH HRMFGLPP EETY  K D S+G L
Sbjct: 881  RNLSDCDPAHLFSGSEGRCPSRANF-GSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVL 939

Query: 940  SFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNIDTN 999
               SD+  +  F    +K +F F ++E++++Y++    D++ + F A +I +++N++  +
Sbjct: 940  DISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVD 999

Query: 1000 KFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHNIVLGXXXXXXXXXXXX 1059
             +I + + NV+ + +DF   +YS RA++DI +    V        ++G            
Sbjct: 1000 YYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFC 1059

Query: 1060 RNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKXXXXXXXXXXXXXXXXXXX 1119
            +  +F   +  Q  HI  +DAPF RCSFL P   Q SD Y+                   
Sbjct: 1060 QLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYR------------------- 1100

Query: 1120 XXNNFDTIFENLLGDIYQDYISEGTFDISNDTKLQLNIDEFKKHSENSF--------SKH 1171
                       LLG I       G  +      + + +DEF K  +NS         SK 
Sbjct: 1101 ----------KLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCSKK 1150

Query: 1172 KTKNLTIDIVDELH---------EVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTIS 1222
            +      +    L          E  S V +L      I    ++ F     Q  +  + 
Sbjct: 1151 EEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVE 1210

Query: 1223 DTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDINKL 1282
              ID   +++V +F +T          KV  P  +  L  +    +          I ++
Sbjct: 1211 QLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEI 1270

Query: 1283 DLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLS------KENFIYPSESSEFS 1336
             +++ +R+E          NS  K +V   TAL+  + L+        N    +   +  
Sbjct: 1271 SVDISMREE-------PSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQL 1323

Query: 1337 YKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTIS 1396
              ++ ++LE +   +D   +  N      +++ + ++    F+K      +T  + V++ 
Sbjct: 1324 CSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVH 1383

Query: 1397 KNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHV 1456
            K   +  +R+   RI+ A  +Y I HDPPVITKPA ITRL   HVRE++SW+I+TRLRH+
Sbjct: 1384 KERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHI 1443

Query: 1457 LNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTY 1512
            LNYLP          L+   F +  +A   FL+IF++WRSWE +DVE+C++Y+K +
Sbjct: 1444 LNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAF 1499

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/1168 (39%), Positives = 707/1168 (60%), Gaps = 38/1168 (3%)

Query: 1798 INVDFGRILQSSLSL--QDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTDNLG-RISL 1854
            + V F +   SSL L  ++  ++LLS    + Y+K S S ++L        + +  ++ L
Sbjct: 1790 LTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQL 1849

Query: 1855 DSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKS----STVQNEFPFSRLIP 1910
            +S+ +K  + +P++ +     D+  A +N+E L+  +L   +     +   E     L P
Sbjct: 1850 ESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWP 1909

Query: 1911 IQL--NLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSSESICFL 1968
             +    L+++Y+GLL+  GTT Y+ E N L  S S D+ +     P    + S   I FL
Sbjct: 1910 REWLWQLDMKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFSF-PLVHGELSVAGISFL 1968

Query: 1969 IKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNE-- 2026
            I D+ + E LSKVL+F+ RIK+ + +  +++SLQIES++    L P SL+R+LS   E  
Sbjct: 1969 INDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEAT 2028

Query: 2027 -FSIMKSIYHDIKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGY 2085
              S ++++  +   +S+        +  +  S  ILSY+ C+GW+F+    +N GL WGY
Sbjct: 2029 HLSGLQALKDNAGVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGY 2088

Query: 2086 ERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEEN 2145
            +RLFA ++KPYGKLTLLDAYF +A G +S+ +Y   +E    NRS LPSMQI YW E   
Sbjct: 2089 QRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNG 2148

Query: 2146 GTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKV---TSNDPILG 2202
               +LF+R+NGE LDVS L+    I     +SLH F++LK   LDP K        P   
Sbjct: 2149 SEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGS 2208

Query: 2203 EWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQHGTC-SFEIRSPAHTVTIDYKYYP 2261
             ++ L  P+ SS+  +NC + YAG   KLYS DDI+  T  SF++ SP+  V  +Y    
Sbjct: 2209 AFSKL--PILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKML 2266

Query: 2262 SKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAE 2321
            + K+ H +R L +V+++HNTLFP CVP+++EM L    +LK+  ++ S   P  ++ +  
Sbjct: 2267 TGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKD-LNKSSVETPRTSNMQEG 2325

Query: 2322 INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLS 2381
            INYR LL+  DI+ ++N+ KQ+ISL+CEP AK+QA +GFEKF +K+FTN     EPL LS
Sbjct: 2326 INYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLS 2385

Query: 2382 VDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIE 2441
            +D+HN+ A+SRH+FSRE            VF LTH + IHTYG   I     YFN+KQ++
Sbjct: 2386 LDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQ 2445

Query: 2442 DLNLFLEIWSIEKQ-----KSVNDIILAPVTASSFESVPSMPKLQRVPINATFSWDYLLI 2496
            DLN+F+ IW ++ +     +  N  ++ P         P   K ++V  N++F W++++I
Sbjct: 2446 DLNVFINIWKLDSKILSQPELDNKFVIGPTNLEK----PLTSKYKKVISNSSFPWNFVVI 2501

Query: 2497 ISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIK 2556
            +S I  EIDLG SLG++ + ++ +W ++ H  DWTQ L + + ++ +SS GRLGG   ++
Sbjct: 2502 LSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQ 2561

Query: 2557 DIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDE 2616
            +  W S+I WP+       PLV L++ L     KL+FDYH+  I++++  ++ LFN++D 
Sbjct: 2562 NFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDP 2621

Query: 2617 RGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLL-ESNELKKI 2675
            RG + +LLSVS+S D+ QVF+T+LA AN+FD+Y+TI RMR D+ ++ L+ L +SN     
Sbjct: 2622 RGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTK 2681

Query: 2676 SSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKT 2735
             S  + ++L+SL  LRTELSV  + +++ ++ +TL   EV+  + R     ++ E S K 
Sbjct: 2682 GSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKL 2741

Query: 2736 TSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIF 2795
             +  K+      ++ ++ L+LS++K QL E    +I V +Y++ AS + GG IL  P+I 
Sbjct: 2742 KTQLKL------KVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAIL 2795

Query: 2796 VTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSS 2855
            + M TW    +N +ELLYS+SFG  + + WNL  INF+++MW+ H  AM LR    G S 
Sbjct: 2796 IGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSK 2855

Query: 2856 EIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPG 2915
                 +DE +  KL  VDLG +Y Y PLEEP+IE+P+ KDLG+ATPPVEWFG+NR +FPG
Sbjct: 2856 SFF--EDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPG 2913

Query: 2916 LTHQIVVVPLQKLSAVAEKEYVRILGKV 2943
            LTHQ V+VPLQKL+ +AE E+ RILG+ 
Sbjct: 2914 LTHQGVIVPLQKLAHLAESEWARILGRA 2941

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/1605 (32%), Positives = 821/1605 (51%), Gaps = 101/1605 (6%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            M+  ++   + + +++ F WVFLV+W   I+  +   FY+ R   Y+V+ IL W++WKR 
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQL----KNS 116
            KV IN+++L  S++GG+++FK++S+  +D TISIL+G+ TW+YWLLN R  +L    K+ 
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120

Query: 117  NINDENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRVKT 176
            + N+    C+F LEC+G+E+FIYN+   Y++++N L+K ++D   K+   +E  F    +
Sbjct: 121  SKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYL--NEHSFPEPFS 178

Query: 177  DSSV---MFDPLDESSEQSKVGQTILNSVSNQSA----VPLYLDFLPAEVILSSGAVVVG 229
            D S    + + L ES+  +    +I+N    Q       P +L FLP E+  S G++++G
Sbjct: 179  DGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLG 238

Query: 230  NKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKK 289
            NK TPSV I+ Y   EGI+DV  P   +D Y+ +++ E  +  +S+K NI + +    K 
Sbjct: 239  NKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKF 298

Query: 290  HKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTFS 349
                GK   LW+     L      +++    K   +  + F   WKGL++Y   + +  +
Sbjct: 299  KLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKA 358

Query: 350  ---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVI------TETLIKGYENGDIPP 400
               D+I FDL NHEYAK+T+IL   ++ + Y  D PGV+      T + I G + G+   
Sbjct: 359  NDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGA 418

Query: 401  SPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCE 460
             P++++DVQ++  +  YGPWA RQ+ +  ++ SP VSR     +K   G  R +  FR  
Sbjct: 419  PPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMN 478

Query: 461  IVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASEC 520
            I I ED+ WRIPT+E SKDA FL  YK T++E R FGW+D++  KDT  +  + +  +  
Sbjct: 479  ISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVE 538

Query: 521  GFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELF 580
            GF+N FH + V   I +SVNHD+L  +K   I     YP  WNS   W ++  S  LE F
Sbjct: 539  GFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAF 598

Query: 581  ILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFN 640
            +LR+H  L+ D  +DF++GD  PYELFRP +Y+ +W++  YS+YLN ND NIVNNPLDFN
Sbjct: 599  LLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFN 658

Query: 641  ENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEFMAQRFV 700
            ENCY+S+HG+   I V +P                 P F + L TPPW+TL+EFM  + V
Sbjct: 659  ENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEV 718

Query: 701  GRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQ 760
            GR+++F+  G+YL Y            +EC +N      YGF++RY+ N+K+NYFGEF  
Sbjct: 719  GRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFN 778

Query: 761  FRTTEEYSEELAQRN--DVAT-----DIFNNNDDDQTTELVEPNSYGESGFDILHGKKID 813
            F T+EEY+  L  R+  DV T     D+ +  D       V+ NS  +          + 
Sbjct: 779  FVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKG--------PMK 830

Query: 814  KASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFS 873
            ++ LKRT NE DIW TF   +G  +LPE+ Y F  C  LHF  +  D R  +YY D+   
Sbjct: 831  RSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAV 890

Query: 874  MNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKID 933
            ++ T IKR+     N VFD    N        G LS+  IH HRM+GLPP E TY  + D
Sbjct: 891  LDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWD 950

Query: 934  VSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRL 993
            ++LG LS +SD+E +KGF     K  FG+++ E++L Y+     D++ L+  A+ I I L
Sbjct: 951  INLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISL 1010

Query: 994  NNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSM--DDHNIVLGXXXX 1051
             +        +S  ++   L+DF    YS R ++ +P     ++ +  D  ++       
Sbjct: 1011 EDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFET 1070

Query: 1052 XXXXXXXXRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKXXXXXXXXXXX 1111
                    +  D     + Q ++I   D+P+ RCSFL P  YQ SD Y+           
Sbjct: 1071 KLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGAIAPSSS 1130

Query: 1112 XXXXXXXXXXNNFDTIFENLLGDI---------YQDYISE--GTFDISNDTKLQLNIDEF 1160
                      +  D I E+++G+          ++D  +E   T + S  +  + + DE 
Sbjct: 1131 IPTLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDE- 1189

Query: 1161 KKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFT 1220
                E S S  K    T D  DE     ++V ++ +I +DI   +      L  QL +  
Sbjct: 1190 ----EASSSGFKPGAFTEDGDDEKD---NYVVDVSYILLDIDPLLFVFTKSLLEQLYSEN 1242

Query: 1221 ISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDIN 1280
            +   +D + + IV   S    G +S++        ID  +        E  +  F   ++
Sbjct: 1243 MVQVLDDIEIGIVKRLSNLQEGITSIS-------NIDIHIAYLNLIWQETGEEGFELYLD 1295

Query: 1281 KLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYP--SESSEFSYK 1338
            ++D  +R +        + E N   KL      A +    ++      P  SE    +  
Sbjct: 1296 RIDYQMREK--------SLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALS 1347

Query: 1339 STFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKN 1398
               E  E ++  +   V   NL    + I++   + + ++             S    ++
Sbjct: 1348 LGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQD 1407

Query: 1399 FNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLN 1458
               S K EL+  +  A + Y I HDP VITKPA I RLS+ HVRE+RSW+I+TRLRH+L 
Sbjct: 1408 TRTSSKTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILT 1467

Query: 1459 YLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYIPAEVT 1518
            YLP  W       L++ K+ S  DAK  F+ +F+ WR+WEF+DV R ++Y K        
Sbjct: 1468 YLPDDWQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGK-------- 1519

Query: 1519 FAKTICFSSDLLTISFNERDKEHLF-------MNSFMIDIRNDCY 1556
                  FS+D      NE+ K++L        M SF + +  + Y
Sbjct: 1520 -----LFSTD------NEKHKQNLIKKLLKCTMGSFYLTVYGEGY 1553

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1186 (36%), Positives = 665/1186 (56%), Gaps = 57/1186 (4%)

Query: 1786 PFILRYSCKEFEINVD-FG--RILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMD 1842
            PF +R+  K+ +I  + FG   IL   +S+ DT   + S + +E Y+++S   +++ G  
Sbjct: 1795 PFYIRHEAKQLDIYFNKFGSNEIL---ISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGV 1851

Query: 1843 LGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEIL---RSTMLETKSSTV 1899
                 +L  + +  S  KL+  EP++ +  FL D + A + I +L   +S    +     
Sbjct: 1852 SKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLCSLKSLFFSSNIPKK 1911

Query: 1900 QNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSD 1959
            + + P + +I   L+ ++ Y G+L+   +T +V E + L  S +       P     +  
Sbjct: 1912 EKQVP-ALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQ 1970

Query: 1960 YSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVR 2019
            +S E+I FLIK+R +   LSKVLDFS+++  ++ ++   QS Q+ESS+    LSP SL+R
Sbjct: 1971 FSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLR 2030

Query: 2020 LLSFVNEFSIMKSIYH--------DIKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLF 2071
            L+   ++   +   Y         +IK  +  S+    I P++ +S HILSY  CIGWLF
Sbjct: 2031 LMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGKSDKPKEI-PLNFRSIHILSYKFCIGWLF 2089

Query: 2072 DLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSY 2131
              G  ++ GL+ GY RLF+ Y++ +GK T++D++FSVA+G +SST++ +GNEK   NRS+
Sbjct: 2090 QYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSF 2149

Query: 2132 LPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDP 2191
            LP+MQI+YW +     KD F R +GE LDV+ +  +  ++D   QS+  F++LK  ILD 
Sbjct: 2150 LPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDV 2209

Query: 2192 LKVT-SNDPILGEWNYLDN------PLASSVRSINCIINYAGSSMKLYSRDDIQHGT-CS 2243
             + + S D  +   + ++N      P  +++RS+N    Y G   ++Y+ +DI+  +  S
Sbjct: 2210 SENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPS 2269

Query: 2244 FEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKN 2303
            FEI+SP  T+   YK+   K + H IRTL TV+ THNTL+  C PLL E   +   M+K 
Sbjct: 2270 FEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKK 2329

Query: 2304 SCSQFSNGAPNLASAKAE-INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEK 2362
                 ++  PN      + ++Y+ LL+ FD+AV +   KQ++SL+CEP AK+QA +GFE 
Sbjct: 2330 HS---TDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFES 2386

Query: 2363 FDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHT 2422
            F   + TN    + PL  S+ L +  AS +H+FSRE           +    TH + I  
Sbjct: 2387 FLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISM 2446

Query: 2423 YGSTLISKPLFYFNVKQIEDLNLFLEIWSIEK-------QKSVNDIILAPVTASSFESVP 2475
            YG  L+S    +FNVKQ+++L LFL+IW           Q+SVN  I           + 
Sbjct: 2447 YGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGI----------DMH 2496

Query: 2476 SMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLL 2535
            S+     V +     W + LI + +  ++DLGPSLG++ +++   W  + H  +  Q L 
Sbjct: 2497 SLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLH 2556

Query: 2536 ISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDY 2595
                 I ++S GRL G   + +  W S++ W      +  PLV  SL +     K +FDY
Sbjct: 2557 AFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDY 2616

Query: 2596 HMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRM 2655
            HMF I TI N   +L N++D +G L DLL VS S D I +  T+L  AN+ DIY+TI RM
Sbjct: 2617 HMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRM 2676

Query: 2656 RNDSGRTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTE 2714
            R D+  + ++ L +SN  +         +L SL  LRT+LSV+   L + I   +L   E
Sbjct: 2677 RQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVE 2736

Query: 2715 VVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVI 2774
            V+V+R  KV         S+T S  K++T+L  Q+ D+S +LS+ K +LDE     I + 
Sbjct: 2737 VLVVRIDKV------SIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAID 2790

Query: 2775 DYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIK 2834
            DY+  AS I GG I++ P + V M T Q + +N +E L++ SF + +S+ WNL P+NFIK
Sbjct: 2791 DYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIK 2850

Query: 2835 DMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIK 2894
            +MW+ H+ A+ +R  Q  N S      +E++E  + K +  +K+ Y  LEEP IE+P+I+
Sbjct: 2851 EMWTTHVKALAVRRSQIANIS--FGQTEEELEESINKEETASKFNYIALEEPQIEVPQIR 2908

Query: 2895 DLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940
            DLGDATPP+EWFG+NR RFP  THQ  V+P+QKL  +AEK+YV+IL
Sbjct: 2909 DLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1558 (33%), Positives = 803/1558 (51%), Gaps = 83/1558 (5%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            M+  ++   + + +++ F WVFLV+W   +++ +   FY+ R   Y+V+ IL W++WKR 
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND 120
            K+ IN+++L  S++GG+++FKN+S+  +D TIS+L+G+ TW+YWLLN R  +L  +N + 
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120

Query: 121  ENSK----CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRVKT 176
               K    C+  +EC+G+E+FIYN+   Y++++N L+K ++D   K+   +E  F    +
Sbjct: 121  SGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYL--NEHSFPEPFS 178

Query: 177  DSSV---MFDPLDESSEQSKVGQTILNSVSNQSA----VPLYLDFLPAEVILSSGAVVVG 229
            D S    + + L ES+  +    +I+N    Q       P  L FLP E+  S G++++G
Sbjct: 179  DGSSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLG 238

Query: 230  NKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKK 289
            NK TPSV I+ Y   +GIIDV  P   LD Y+ +++ E  +  +S+K NI + + +   K
Sbjct: 239  NKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDD-AIGLK 297

Query: 290  HKID-GKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTF 348
             KID GK   LW+            ++     K   T  + F   WKGL++Y  +  D  
Sbjct: 298  FKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYHKWKGLSLYKASAGDAK 357

Query: 349  S---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETL------IKGYENGDIP 399
            +   D++ FDL NHEYAK+T+IL   ++ + Y  D PGV+          I G + G+  
Sbjct: 358  ASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNG 417

Query: 400  PSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRC 459
              P++++DVQ++  +  YGPWA RQ+ +  ++ SP VSR     +K   G  R +  FR 
Sbjct: 418  APPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRM 477

Query: 460  EIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASE 519
             I IMED+ WRIPT+E SKD  FL  YK TN+E R FGW+D++  KDT  +  + +  + 
Sbjct: 478  NISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTV 537

Query: 520  CGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLEL 579
             GF+N FH + +   I +SVNHD+L  +K   I     YP  WNS   W ++  S  LE 
Sbjct: 538  QGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEA 597

Query: 580  FILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDF 639
            F+LR+H  L+ D  +DF++GD  PYELFRP +Y+ +W++  YS+YLN ND NIVNNPLDF
Sbjct: 598  FLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDF 657

Query: 640  NENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEFMAQRF 699
            NENCY+S+HG+   I V +P                 P F + L TPPW+TL+EFM  + 
Sbjct: 658  NENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKE 717

Query: 700  VGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNYFGEFA 759
            VGR+++F+  GSYL Y            +EC +       YGF++RY+ N+K+NYFGEF 
Sbjct: 718  VGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFF 777

Query: 760  QFRTTEEYSEELAQR--NDVATDIFNNNDDDQTTELVEPNSYGESGFD--ILHGKKIDK- 814
             F T+EEY+  L  R   DV T           + + +  S  +SG+    L  +  DK 
Sbjct: 778  NFVTSEEYTGVLGAREVGDVTT----------KSSVADLASTVDSGYQNSSLKNESEDKG 827

Query: 815  ----ASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADL 870
                + LKRT NE DIW TF   DG  +LPE+ Y F  C  LHF  +  D R  +YY D+
Sbjct: 828  PMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDI 887

Query: 871  AFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLF 930
               +N T IKR+     N VFD    N        G LS+  IH HRM+GLPP E TY  
Sbjct: 888  MAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFC 947

Query: 931  KIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDIS 990
            + D++LG L  +SDIE +KGF     K  FG+++ E++L Y+     D++ L+   + I 
Sbjct: 948  QWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIR 1007

Query: 991  IRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDF-LVSSMDDHNIVLGXX 1049
            I L +        +S  ++   L+DF   KYS R ++ IP     L   M D     G  
Sbjct: 1008 IGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGD-----GVD 1062

Query: 1050 XXXXXXXXXXRNPDFKTTNNL------QTQHILLSDAPFCRCSFLHPQEYQTSDLYKXXX 1103
                      R  +F+   ++      Q ++I + D+P+ RC FL P  YQ SD Y+   
Sbjct: 1063 TSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLY 1122

Query: 1104 XXXXXXXXXXXXXXXXXXNNFDTIFENLLGDIYQDYISEGTFD---ISNDTKLQLNIDEF 1160
                              +  D I E+++G+      +   F        + ++ +   F
Sbjct: 1123 GAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASF 1182

Query: 1161 KKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFA-DLYRQLTTF 1219
             +   +  +   +        D  HE  ++V ++ +I +D+   +L +FA  L  QL + 
Sbjct: 1183 SEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVD-PLLFIFAKSLLEQLYSE 1241

Query: 1220 TISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDI 1279
             +   +D + + IV   S    G +S++        ID  +        E  +  F   +
Sbjct: 1242 NMVQVLDDIEIGIVKRLSNLQEGITSIS-------NIDIHIAYLNLIWQETGEEGFELYL 1294

Query: 1280 NKLDLNLRLRQEYDKESANSEMNSKNKL---SVYYKTALINGKMLSKENFIYP--SESSE 1334
            +++D        Y     + E N  NKL   +   K   +   +  K+N   P  SE   
Sbjct: 1295 DRID--------YQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKN---PDLSEDRP 1343

Query: 1335 FSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVT 1394
             +     E  E ++  +D  V   NL    + I++   + + E+             S  
Sbjct: 1344 PALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFN 1403

Query: 1395 ISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLR 1454
              +N   + K EL+ ++  A + Y I HDP VITKPA I RLS+ HVRE+RSW+I+TRLR
Sbjct: 1404 SIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLR 1463

Query: 1455 HVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTY 1512
            H+L YLP  W       L++ K+ S +DAK  F+ +F+ WR+WEF+DV R ++Y K +
Sbjct: 1464 HILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLF 1521

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/1181 (36%), Positives = 661/1181 (55%), Gaps = 47/1181 (3%)

Query: 1786 PFILRYSCKEFEINVD-FG--RILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMD 1842
            PF +R+  K+ +I  + FG   IL   LS+ DT   + S + +E Y+++S   +++ G  
Sbjct: 1795 PFYIRHEAKQLDIYFNKFGSNEIL---LSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGI 1851

Query: 1843 LGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKSSTV--- 1899
                 +L  + +  S  KL+  EP++ +  FL D + A + I +L S      SS +   
Sbjct: 1852 SREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKK 1911

Query: 1900 QNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSD 1959
            + + P S +I   L+ ++ Y G+L+   +T +V E + L  S +       P     +  
Sbjct: 1912 EKQAP-SIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQ 1970

Query: 1960 YSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVR 2019
            +S E+I FLIK+R +   LSK+LDFS+++  ++ ++   QS Q+ESS+    LSP SL+R
Sbjct: 1971 FSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLR 2030

Query: 2020 LLSFVNEFSIMKSIYHDIKPRS-------TSSNSTLSILPISIKSAHILSYNLCIGWLFD 2072
            L+   ++   +   Y      +       T  +     +PI+ +S HILSY  CIGW+F 
Sbjct: 2031 LMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQ 2090

Query: 2073 LGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYL 2132
             G  +N GL+ GY RLF+ Y+K +GK T++DA+FSVA+G +SST++ +GNEK   NRS+L
Sbjct: 2091 YGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFL 2150

Query: 2133 PSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILD-- 2190
            P+MQI+YW +     KD F R +GE LDV+ +  +  +++   QS+  F++LK+ ILD  
Sbjct: 2151 PNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVS 2210

Query: 2191 -PLKVTSNDPILGEWNYLDN----PLASSVRSINCIINYAGSSMKLYSRDDIQ-HGTCSF 2244
              L+  +++          +    P   ++RS+N    Y G   ++Y+ +DI+     SF
Sbjct: 2211 ESLRAENDNSYASTSVESASSSLAPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSF 2270

Query: 2245 EIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNS 2304
            EI+SP  T+   YK+   K K H  RTL TV+ THNTL+  C PLL E   +   M+K  
Sbjct: 2271 EIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKH 2330

Query: 2305 CSQFSNGAPNLASAKAE-INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKF 2363
                ++  PN     ++ ++Y+ LL+ FD+AV +   KQ++SL+CEP AK+QA +GFE F
Sbjct: 2331 S---TDEKPNFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESF 2387

Query: 2364 DIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTY 2423
               + TN    ++PL  S+ L +  AS +H+FSRE           +    TH + I  Y
Sbjct: 2388 LFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMY 2447

Query: 2424 GSTLISKPLFYFNVKQIEDLNLFLEIW---SIEKQKSVNDIILAPVTASSFESVPSMPKL 2480
            G+ L+S    +FNVKQ+++L LFL+IW   SI   + V   +   +  SS  S       
Sbjct: 2448 GTGLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAG 2507

Query: 2481 QRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKE 2540
              +P      W + LI + +  ++DLGPSLG++ +++   W  + H  +  Q L      
Sbjct: 2508 TEIP------WCFTLIFTNVSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDG 2561

Query: 2541 ICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFI 2600
            I ++S GRL G   + +  W S++ WP   + +  PLV  SL +     K +FDYHMF I
Sbjct: 2562 ISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLI 2621

Query: 2601 STIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSG 2660
             TI N    L N++D +G L DLL VS S D I +  T+L  AN+ DIY+TI RMR D+ 
Sbjct: 2622 GTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNK 2681

Query: 2661 RTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLR 2719
             + ++ L +SN  +         +L SL  LRT+LSVN     + I   +L   EV+V+R
Sbjct: 2682 ISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIR 2741

Query: 2720 TRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKL 2779
              KV         S+T S  K++T+L  Q+ D+S +LS+ K +LDE     I + DY+  
Sbjct: 2742 IDKV------SIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHY 2795

Query: 2780 ASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSI 2839
            AS I GG I++ P + V M T Q + +N +E L++ SF + +S+ WNL P++FIK+MW+ 
Sbjct: 2796 ASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTT 2855

Query: 2840 HINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDA 2899
            H+ A+ +R  Q  N S      +E++E  + K +  +K+ Y  LEEP IE+P+I+DLGDA
Sbjct: 2856 HVKALAVRRSQVANIS--FGQTEEELEESIKKEEAASKFNYIALEEPQIEVPQIRDLGDA 2913

Query: 2900 TPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940
            TPP+EWFG+NR +FP  THQ  V+P+QKL  +AEK+YV+IL
Sbjct: 2914 TPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1563 (33%), Positives = 805/1563 (51%), Gaps = 93/1563 (5%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            M+  ++   + + +++ F WVFLV+W   ++I +   FY+ R   Y+VT IL W++WKR 
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND 120
             + IN+++L  S++GG+++FK++S+  +D TIS+L+G+ TW+YWLLN R  +L  +N  D
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENN-KD 119

Query: 121  ENSK-----CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRVK 175
              SK     C+F LEC+G+E+FIYN+   Y++++N L+K ++D   K+   +E  F    
Sbjct: 120  SLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYL--NEHSFPESF 177

Query: 176  TDSSV---MFDPLDESSEQSKVGQTILNSVSNQSA----VPLYLDFLPAEVILSSGAVVV 228
            +D S    + + L ES+  +    +I+N    Q      +P +L FLP E+  + G++++
Sbjct: 178  SDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLL 237

Query: 229  GNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSK 288
            GNK TPSV I+ Y   EG+IDV  P   LD Y+ +++ E  +  +S+K NI + +    K
Sbjct: 238  GNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLK 297

Query: 289  KHKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTF 348
                 GK   LW+     L      I++    KK     + F   WKGL++Y  A  D  
Sbjct: 298  FKLDTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQKWKGLSLYKAAPGDAK 357

Query: 349  S---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETL------IKGYENGDIP 399
                D+I FD  NHEYAK+T+IL   ++ + Y  D  G +          I G + G+  
Sbjct: 358  PSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNG 417

Query: 400  PSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRC 459
              P++++DVQ++  +  YGPWA RQ+ +  ++ SP VSR     +K   G  R +  FR 
Sbjct: 418  APPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRM 477

Query: 460  EIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASE 519
             ++IMED+ WRIPT+E SKDA FL  YK T++E R FGW+D++  KDT  +  + L  + 
Sbjct: 478  NVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTV 537

Query: 520  CGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLEL 579
             GF+N FH + V   I +SVNHD+L  +K   +     YP  WNS   W ++  S  LE 
Sbjct: 538  EGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEA 597

Query: 580  FILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDF 639
            F+LR+H  L+ D  +DF++G+  PYELFRP +Y+ +W++  YS+YLN ND NIVNNPLDF
Sbjct: 598  FLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDF 657

Query: 640  NENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEFMAQRF 699
            NENCY+S+HG+   I + +P                 P F + L TPPW+TL+EFM  + 
Sbjct: 658  NENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKE 717

Query: 700  VGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNYFGEFA 759
            VGR+++F+  GSYL Y            +EC +N      YGF++RY+ N+K+NYFGEF 
Sbjct: 718  VGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFF 777

Query: 760  QFRTTEEYSEELAQRNDVATDIFNNNDDDQTTELVEPNSYGESGFDILHGKK--IDKASL 817
             F T+EEY+  L  R +V   I  ++  D  + L   + Y  S        K  + ++ L
Sbjct: 778  NFVTSEEYTGVLGAR-EVGEIITKSSVLDLASTL--DSGYQNSSLKNESEDKDPVKRSDL 834

Query: 818  KRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNST 877
            KRT NE DIW TF   +G  +LPE+ Y    C  LHF  +  D R  +YY D+   +N T
Sbjct: 835  KRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGT 894

Query: 878  YIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLG 937
             IKR+     N VFD    N        G LS+  IH HRMFGLPP E TY  + D++LG
Sbjct: 895  SIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLG 954

Query: 938  YLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNID 997
             L+ +SDIE +KGF     K  FG+++ E++L Y+     D++ L+  A+ I I  N+  
Sbjct: 955  DLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPV 1014

Query: 998  TNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSM--DDHNIVLGXXXXXXXX 1055
                  ++  ++   L+DF   +YS R ++ IP     +S +  D  +            
Sbjct: 1015 MKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRF 1074

Query: 1056 XXXXRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKXXXXXXXXXXXXXXX 1115
                +  D     + Q ++I   D+P+ RC FL P  YQ SD Y+               
Sbjct: 1075 TNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTL 1134

Query: 1116 XXXXXXNNFDTIFENLLGDI---------YQDYISE--GTFDISNDTKLQLNID------ 1158
                  +  D I E+++G+          ++D  +E   T + S  +  + + D      
Sbjct: 1135 PLPTLPDTIDFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPL 1194

Query: 1159 EFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFA-DLYRQLT 1217
            EFK  +      H+  N  ID+   L +V   +F               VF   L ++  
Sbjct: 1195 EFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLF---------------VFTKSLLKEFY 1239

Query: 1218 TFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVS 1277
            +  +   +D + + IV   S    G +S++   V    I +   +++    E  + Y   
Sbjct: 1240 SEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDV---HIAYMNLIWQETGEEGFELY--- 1293

Query: 1278 DINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYP--SESSEF 1335
                LD     R +Y     + E N  +KL      A I    ++      P  SE    
Sbjct: 1294 ----LD-----RIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPP 1344

Query: 1336 SYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKT----LYLKFNTF-- 1389
            +     E  E ++  +D  V   NL    + I++   + + E+       +    N+F  
Sbjct: 1345 ALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHS 1404

Query: 1390 IKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRI 1449
            I+S  IS       K EL+ ++  A + Y I HDP VITKPA I RLS+ HVRE+RSW+I
Sbjct: 1405 IQSTRISS------KTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKI 1458

Query: 1450 VTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYK 1509
            +TRLRH+L YLP  W +     L++ K+ S +DAK  F+ +F+ WR+WEF+DV R ++Y 
Sbjct: 1459 ITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYG 1518

Query: 1510 KTY 1512
            K +
Sbjct: 1519 KLF 1521

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1187 (36%), Positives = 663/1187 (55%), Gaps = 58/1187 (4%)

Query: 1786 PFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGN 1845
            PF +R+  K+ +I  +     +  LS+ DT   + S + +E Y+++S   +++ G     
Sbjct: 1795 PFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKE 1854

Query: 1846 TDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKSSTVQNEFPF 1905
              +L  + +  S  KL+  EP++ +  FL D + A + I +L S      +S +  +   
Sbjct: 1855 DYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLKSLLFTSGLPKKKKK 1914

Query: 1906 ---SRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSS 1962
               +R+I   L+ ++ Y G+L+   +T +V E + L  S +       P     +  +S 
Sbjct: 1915 KAPARMINWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSI 1974

Query: 1963 ESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLS 2022
            E+I FLIK+R +   LSK+LDFS+++  ++ ++   QS Q+ESS+    LSP SL+RL+ 
Sbjct: 1975 ENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMW 2034

Query: 2023 FVNEFSIMKSIYH--------DIKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLFDLG 2074
              ++   +   Y         DIK  +  S+    I PI+ +S HILSY  CIGWLF  G
Sbjct: 2035 GAHKLLDLGHYYSRRHAPNIWDIKMFTGKSDKPKEI-PINFRSIHILSYKFCIGWLFQYG 2093

Query: 2075 YNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPS 2134
              ++ GL+ GY RLF+ Y+K +GK T++DA+FSVA+G  SST++ +GNEK   NRS+LP+
Sbjct: 2094 AGSDPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPN 2153

Query: 2135 MQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKV 2194
            MQI+YW +     KD F R +GE LDV+ +  +  ++D   QS+  F++LK+ ILD    
Sbjct: 2154 MQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILD---- 2209

Query: 2195 TSNDPILGEWNYLDNPLASS---------------VRSINCIINYAGSSMKLYSRDDIQH 2239
             S D  + +    DNP A+S               +RS+N    Y G   ++Y+ DDI+ 
Sbjct: 2210 VSEDSHMED----DNPYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEA 2265

Query: 2240 GT-CSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFN 2298
             +  SFEI+SP  T+   YK+  ++ K H IR L  V+ T NTL+  C PLL E   +  
Sbjct: 2266 KSEPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQ 2325

Query: 2299 TMLKNSCSQFSNGAPNLASAKAE-INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQAT 2357
             M+K      ++  P+     ++ ++Y+ LL+ FD+AV +   KQ++SL+CEP AK+QA 
Sbjct: 2326 KMIKKHS---TDDKPSFTKPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQAD 2382

Query: 2358 IGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHS 2417
            +GFE F   + TN    ++PL  S+ L    AS RH+FSRE           +    TH 
Sbjct: 2383 VGFESFLFSMTTNEFDSEQPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHP 2442

Query: 2418 EYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIW---SIEKQKSVNDIILAPVTASSFESV 2474
            + I  YG++L+S    +FNVKQ+++L LFL+IW   SI   + V   I   +  SS  S 
Sbjct: 2443 DVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTST 2502

Query: 2475 PSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKL 2534
                    V + A   W + LI + +  ++DLGPSLG++ +++   W  + H  +  Q L
Sbjct: 2503 ------NYVDVGAEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLL 2556

Query: 2535 LISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFD 2594
                  + ++S GRL G   + +  W S++ W +  + +  PLV  SL +     K +FD
Sbjct: 2557 HAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFD 2616

Query: 2595 YHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRR 2654
            YHMF I TI N   +L N++D +G L DLL VS S D I +  T+L  AN+ DIY+TI R
Sbjct: 2617 YHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVR 2676

Query: 2655 MRNDSGRTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGT 2713
            MR D+  + ++ L +SN  +         +L SL  LRT+LS+N   L + I   +L   
Sbjct: 2677 MRQDNKISYMETLRDSNPGESKQPILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDV 2736

Query: 2714 EVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDV 2773
            EV+V+R + V         S+T S  K++T+L  Q+ D+S +LS+ K +LDE     I +
Sbjct: 2737 EVLVVRIKNV------SIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAI 2790

Query: 2774 IDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFI 2833
             DY+  AS I GG I++ P + V M T Q + +N IE L++ SF + +S+ WNL P+NFI
Sbjct: 2791 DDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFACSFSDKISVKWNLGPVNFI 2850

Query: 2834 KDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKI 2893
            K+MW+ H+ A+ +R  Q  N S      +E++E  +   +  +K+ Y  LEEP I++P+I
Sbjct: 2851 KEMWTTHVKALAVRQSQIANVS--FGQTEEELEESIKTKETTSKFNYIALEEPQIQVPQI 2908

Query: 2894 KDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940
            +DLGDATPP+EWFG+NR RFP  THQ  V+P+QKL  +AEK+YV+IL
Sbjct: 2909 RDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1553 (32%), Positives = 800/1553 (51%), Gaps = 71/1553 (4%)

Query: 7    FEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYKVVINI 66
            F    + ++R F WVFLV+W   +++ + T FYL RA  Y VT IL W++WK+ KV ++I
Sbjct: 10   FRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSI 69

Query: 67   QSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLK----------NS 116
             +L  S++ G+V+FKN++I D+D+TI+IL+G+ TWRYWL+  R ++ +          +S
Sbjct: 70   GALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSS 129

Query: 117  NINDENSK--------------CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRK 162
              +++++K              CRF  EC+G E+FIYN+   Y++I+N L+K +++   K
Sbjct: 130  GNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEK 189

Query: 163  FATDDESIFGRVKTDSSVMFDPLDESSEQSKVGQTILNSVSNQS----AVPLYLDFLPAE 218
            F  +++ +       S    +    S+  S   +TI N  + Q+     +P YL+ LP E
Sbjct: 190  FMAENDFLDPSSDGSSDDKIEET-SSATNSTDEETIANDRTFQNDTRKTLPRYLEALPIE 248

Query: 219  VILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPN 278
             +L+ G++++GNK TP V I+ +     + DV    S LD Y+++ E  L +  + +K N
Sbjct: 249  ALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLEIMMKQN 308

Query: 279  ISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLA 338
            I + N  S       GK   LW +              F  N++     + F+  WKGL+
Sbjct: 309  IDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVP---FPFKSNRRKEQPHDNFMQKWKGLS 365

Query: 339  MYDVATSDTFS-----DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITE------ 387
            MY    +D F      D+I FD+ +HEYAK+T++L + R+ + + YD PG +        
Sbjct: 366  MY---RNDMFGEFDEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAHPPS 422

Query: 388  TLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPV 447
            +   G + G+    P+Y  ++ ++     YGPWA RQ  +   + SP+VSR     +K  
Sbjct: 423  SYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKKLK 482

Query: 448  LGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDT 507
             G  R +   +  I  MED  WRIPT+E SKD  FL  YK TND+ R FGWIDIK+++D+
Sbjct: 483  PGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSRDS 542

Query: 508  NISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAIT 567
                +L +  +  GF+NT    LV+  I +SVNHD+   +K+        YP  WN+   
Sbjct: 543  CGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAEAN 602

Query: 568  WALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNA 627
            W +   S+ LELF+LR+H  L+ D  TDF+SG+ VPYELFRP +Y   W++  YS YLN 
Sbjct: 603  WTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYLNV 662

Query: 628  NDANIVNNPLDFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPP 687
            ND NIVNNPLDFNENCY+SIHG+   + V +P                 P F + L TPP
Sbjct: 663  NDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRLLLNTPP 722

Query: 688  WHTLHEFMAQRFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYV 747
            W+TL+EFM  + VGRSH+F   GSYL Y            +EC +       YGF++RY+
Sbjct: 723  WNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFVIRYL 782

Query: 748  MNLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTTELVEPNSYGESGFD-- 805
            +N+K+NYFGEF  F T+EEY+    +  D+   I  +  DD  +     +    +  D  
Sbjct: 783  INVKMNYFGEFFHFVTSEEYTGN-TRPTDLENIISEDRRDDDFSSYESVSRISSNSSDKN 841

Query: 806  --ILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRY 863
                    + K+ LKRT NE DIW TF   DG  +LPE+ Y+   C  LHF  +  D+R 
Sbjct: 842  PKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVDLRS 901

Query: 864  LSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPP 923
             +YY D+  +     +KRY    ++ +++    N        G LS+  IH HRM+GLPP
Sbjct: 902  CNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGLPP 961

Query: 924  AEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLS 983
             E TY  + D+  G+L+ +S++  L+G      K  FG+ + E++L YE     D++ L+
Sbjct: 962  TEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTSLT 1021

Query: 984  FFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHN 1043
             F + I IRLN++DT     L +      L+DF   +YS R +I IP+ +F + S +D++
Sbjct: 1022 IFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNIFSNEDND 1081

Query: 1044 IVLGXXXXXXXXXXXXRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKXXX 1103
            + L             +N DF     +Q  +I+L+DAP+ RC+FL P+ YQ S +Y    
Sbjct: 1082 LSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIYNELF 1141

Query: 1104 XXXXXXXXXXXXXXXXXXNNFDTIFENLLGDIYQDYIS--EGTFDISNDTKLQLNIDEFK 1161
                              +  + + E+LL    +DY+   EG +DI   +   L +   +
Sbjct: 1142 GAIAPSSSLPPLPIPLTADTIEYVLEDLL----EDYMGLFEGNYDIKESSVENLELSAIE 1197

Query: 1162 K-HSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFT 1220
               +       +T +  I + D   E  ++V ++  I IDI+  +      L + +    
Sbjct: 1198 ATRAITGIGAERTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTTIEKLLKHIYDQD 1257

Query: 1221 ISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDIN 1280
                IDG+ + IV   S    G +++T  KV     +     +     ++V  +F    +
Sbjct: 1258 AVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNL---FWGEKESDNVSMFF----D 1310

Query: 1281 KLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSEFSYKST 1340
            K+D  L  +        NSE N   +++V  K   +   ++ +   I P++    +    
Sbjct: 1311 KMDFALTEKT----LEQNSEKNLL-EMTVLAKIKAVRLTVVQQPGLI-PTQERPPAITVG 1364

Query: 1341 FEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNFN 1400
             E  E ++   +  V   ++    + ++    +   ++I      F   ++S    +N  
Sbjct: 1365 VEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNR 1424

Query: 1401 KSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNYL 1460
               ++EL+ R+  A + Y I HDP VITKPA I RLSR HVRE++SW+I+TRLRH+L YL
Sbjct: 1425 IESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYL 1484

Query: 1461 PQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYI 1513
            P+ WY      L+  KF   +DA+  F+ IF+ WRSWEF+DV R ++Y K ++
Sbjct: 1485 PKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFL 1537

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1252 (34%), Positives = 679/1252 (54%), Gaps = 72/1252 (5%)

Query: 1730 EANNEIRLHINEIGQDFASNIQYTELPVLPDSQVLKPIAMVKMXXXXXXXXXXXXXPFIL 1789
            EA  +I+L I++I +      + T+ P + D    K   +                PF L
Sbjct: 1761 EAIKDIKLKIDQISEQLELERRLTQHPTVYDPN--KSNVIASCLFSNVSMDIMPVSPFAL 1818

Query: 1790 RYSCKEFEINVDFGRILQSS--LSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTD 1847
            + S K+  I+  + +    S  + L+DT   L S + +E YM+ S   L++      +  
Sbjct: 1819 KNSAKQ--IDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKP 1876

Query: 1848 NLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRS-----TMLETKSSTVQN- 1901
             L  I+L ++  KL+  EPK  +  FL D   A +++ +L++     ++ + K ST Q+ 
Sbjct: 1877 KLVDINLSTNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLKPLFSISDDKESTPQSY 1936

Query: 1902 ----EFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFS 1957
                E+ +S      L+ +++Y G+L+   +T YV+EF++   S S    + +  +   +
Sbjct: 1937 QEKTEYLWS------LDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANGAPSGNL-DIT 1989

Query: 1958 SDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSL 2017
               S E+I FLIK+  + + LSKV+D ++ +  ++      +S+Q+ESS+    LSP SL
Sbjct: 1990 GHMSVENILFLIKESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPDSL 2049

Query: 2018 VRLLSFVNEFSIM---------KSIYH-----DIKPRSTSS-NSTLSILPISIKSAHILS 2062
            +RLL   N+   +         KS++      D K + T+S  S  +    SI S H LS
Sbjct: 2050 LRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLS 2109

Query: 2063 YNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGN 2122
            YNLC+GWLF+      +GLI GY RLF+ Y+   GKLT++D+YF+ A G +SST+YP+ N
Sbjct: 2110 YNLCVGWLFEYELGPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETN 2169

Query: 2123 EKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFK 2182
             K   NR YLP+MQI +W +   G KD+++R  GE LDV  L+ +   ++    S+  F+
Sbjct: 2170 VKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQ 2229

Query: 2183 KLKETIL------DPLKVTSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYS-RD 2235
            KLK+ ++      + + +  + P+    N L N     ++S+NC   Y G +  +++  D
Sbjct: 2230 KLKKELIVETPKREVVHIKEDKPVNSSNNILKN-----IKSVNCHFKYDGGTYSVFNISD 2284

Query: 2236 DIQHGTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWL 2295
               + T + EI+SP  +V + YK+     K H IR L  ++ THN L+  C PL+     
Sbjct: 2285 GSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNFVE 2344

Query: 2296 TFNTMLKNSCSQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQ 2355
               ++     S+  +      S +  I+Y  LLE +D+A+ +   KQ++SL+CEP AK+Q
Sbjct: 2345 DVRSIFGRYESENKHSETTPTSVQ-NIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQ 2403

Query: 2356 ATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLT 2415
            A +GFE   + + TN    DEPL  S  + +  AS +H+FSRE           +    T
Sbjct: 2404 ADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLLFT 2463

Query: 2416 HSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVNDIILAPVTASSFESVP 2475
            H+  I+TYG++LIS    YFNVKQ+++L LFL+IW + +       +L PVT+S  E V 
Sbjct: 2464 HTNRINTYGTSLISDIDLYFNVKQLQNLYLFLDIWQLSE-------LLNPVTSSQ-EQVI 2515

Query: 2476 SMPKLQRV--PIN--ATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWT 2531
               K + V  PI+  +   W + LI + +  +IDLGPSLGL+ ++    W  + H     
Sbjct: 2516 RKDKKKSVDKPIHNESQLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKR 2575

Query: 2532 QKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKL 2591
            Q L   + ++ + S GRL G V I    W S++ W   +    +PLV LSL       K 
Sbjct: 2576 QILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKA 2635

Query: 2592 SFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYST 2651
            +FDYHMF I T+ N   +L +++D  G   DLL VS S + I++  T+L  AN+ DIY+T
Sbjct: 2636 AFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNT 2695

Query: 2652 IRRMRNDSGRTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTL 2710
            I RMR D+  + ++ L +SN      +     +L SL  LRT+L+V+   L L I   +L
Sbjct: 2696 IIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISL 2755

Query: 2711 IGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDK 2770
                        VI      A S+T S+AK+ T L  ++ D +LSLS+ K +LDE+ L K
Sbjct: 2756 FDV------EVVVINVVSVSARSETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSK 2809

Query: 2771 IDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPI 2830
            I V DY+  AS I GG I+E P + V M TWQ + S+++E LYS  F + V++ WNL P+
Sbjct: 2810 ITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPV 2869

Query: 2831 NFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEM 2890
            NF+K+MW+ H+ A+ +R  Q    S      ++D+E ++ + +  TK  Y P+EEP I+M
Sbjct: 2870 NFMKEMWTTHVKAIAVRRSQVLTGS--FNVSEKDVEKRIKEEENITKLNYVPVEEPQIDM 2927

Query: 2891 PKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILGK 2942
            P+IKDLGDATPPVEWFG+NR RFP  THQ  VVP+Q L  +A+K+Y + LG+
Sbjct: 2928 PQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGR 2979

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/1560 (32%), Positives = 808/1560 (51%), Gaps = 83/1560 (5%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            MD  ++F+ + +  +R F W+FLV W   +++++   FYL R I YI+T IL W++WK  
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND 120
            KV +NIQSL  S++GG+++FKN++I  +D TISIL+G  TWRYWL N R  + + +++++
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120

Query: 121  ENSK----------CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESI 170
              +K          CRF +  +G+E+F+YNK   Y++I+   +K ++    KF   +E I
Sbjct: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFL--NEQI 178

Query: 171  F---GRVKTDSSVMFDPLDESSEQSKVGQTILNSV--SNQSAVPLYLDFLPAEVILSSGA 225
                  VK+     FD  + +S          + V    ++    +L FLP + +++ G+
Sbjct: 179  LSDSATVKSMDDSQFDTSESTSTDKSESSATNDRVFQEEETDTSSFLRFLPIQFLVTRGS 238

Query: 226  VVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGS 285
            +++GNK TPS+ I+     + ++D A P   LD YK +   EL +T  ++K NI F +  
Sbjct: 239  LILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGF-DED 297

Query: 286  SSKKHKID-GKPFNLWQKLKDCLLFTISHILAFTG-NKKGLTGQEEFLTSWKGLAMYD-- 341
             S K K+D GK   +W      +L  +   L FT  +++    +++F   W+GLA+Y   
Sbjct: 298  VSMKFKLDRGKVSEVWNHFTR-MLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKGT 356

Query: 342  -VATSDTFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVI------TETLIKGYE 394
             +       D+I FD  NHEYAK+++IL + ++     +D PG++      T +++ G +
Sbjct: 357  GLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGPD 416

Query: 395  NGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREH 454
             G+    P+YS+D+Q++  +  +GPWA RQ  +  K+ SP VSR     ++   G  R +
Sbjct: 417  VGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRIY 476

Query: 455  ANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELG 514
               +  + IM+D+ WRIPT+E SKD  FL  Y+ TN E R FGWID+K +K+T ++    
Sbjct: 477  TYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTFA 536

Query: 515  LQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFIS 574
            L  +  GF+N    +L      +SVNHD+L   K        S+P  WN   TW ++  S
Sbjct: 537  LCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLNS 596

Query: 575  SDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVN 634
            S +E FILR+H  L+ D  TDF+SG+  PYELFRP +Y  +W I  YSLYLN ND NIVN
Sbjct: 597  SQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIVN 656

Query: 635  NPLDFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEF 694
            NPLDFNENCY+S HG+   +   +P                 P F + L TPPW+TL+EF
Sbjct: 657  NPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWNTLNEF 716

Query: 695  MAQRFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNY 754
            M  + VGRS++F   GSYL Y            ++C +   T   YGF++RY++N+K+NY
Sbjct: 717  MKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMNY 776

Query: 755  FGEFAQFRTTEEYSEEL-AQRNDVATDIFNNNDDDQTTELVEPNSYGESGFDILHGKKID 813
            FG+F  F T+EEY+  + A  +D+     +++D    +           G   LH  ++ 
Sbjct: 777  FGDFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQGNDAPGRRRLH-TELQ 835

Query: 814  KASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFS 873
            ++ LKRT NE D+W TF   +G  +LPE+ Y+   C GLHF  +  D+R  +YY DL  +
Sbjct: 836  RSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLAN 895

Query: 874  MNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKID 933
            MN   IKRY     + +F+    N     +  G LS   IH HRM+GLPP E TY  + D
Sbjct: 896  MNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWD 955

Query: 934  VSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRL 993
              LG L   SDIE L+GF    T+  FG+ + E++L YE     D++ ++   + +S+ L
Sbjct: 956  FDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVML 1015

Query: 994  NNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDF--LVSSMDDHNIVLGXXXX 1051
                 N + S  + N+    +DF   KYS R ++ IP  +F   +   D     L     
Sbjct: 1016 QEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLET 1075

Query: 1052 XXXXXXXXRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKXXXXXXXXXXX 1111
                    ++ DF      Q ++I L DAP+ RCSF+ PQEYQ ++ Y+           
Sbjct: 1076 KVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAPSSS 1135

Query: 1112 XXXXXXXXXXNNFDTIFENLLGDIYQDYISEGT------------FDISND-TKLQLNID 1158
                      +  D I E+LLG+ +QD +   +             D+S+D T+  ++  
Sbjct: 1136 LPPLPVPLIPSTTDFIIEDLLGE-FQDLLETSSPFRMPFSDQDYATDVSDDETEEDIDPL 1194

Query: 1159 EFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTT 1218
            EF   SE              I ++  E  SF+ ++  I+I+I  D+L+         +T
Sbjct: 1195 EFNTPSEA-------------IQNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFST 1241

Query: 1219 FTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSD 1278
              I   ID + +  VN  S    GA  +T  K+    +D     +       V  Y    
Sbjct: 1242 ENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDL---FWGSRTDTGVGIY---- 1294

Query: 1279 INKLDLNLRLRQ-EYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSEFSY 1337
            ++++D  +  +  E +KE    E+   NK+     T  +N    + +N   P   S    
Sbjct: 1295 LDRIDFAMCEKTVEENKEKKLIELTVLNKIRSVRGT--VNQTAANSKNEERPPALSLV-- 1350

Query: 1338 KSTFEELEGYAFYD---DDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVT 1394
                  +EG+  +    +D V   N+    + +++   + +  +     L+    IK+  
Sbjct: 1351 ------IEGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSD 1404

Query: 1395 ISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLR 1454
              +      ++EL+  +  A + Y I HDP VITKPA ITRLSR HVRE+RSW+I+TRLR
Sbjct: 1405 TIQKRKIESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLR 1464

Query: 1455 HVLNYLPQYWYETTSLELQKGK-FRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYI 1513
            H+L YLP+ W+ T +  L + K   + +DAK  F+ +F+ WR+WEF+D+ R ++Y+K ++
Sbjct: 1465 HILTYLPEDWHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFL 1524

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1185 (36%), Positives = 668/1185 (56%), Gaps = 63/1185 (5%)

Query: 1786 PFILRYSCKEFEINVD-FG--RILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMD 1842
            PF +R+  K+ +I  + FG   IL   LS+ D  + L S   ++ Y ++S   L+L G +
Sbjct: 1800 PFFIRHEAKQLDIYFNRFGSNEIL---LSVWDADIYLTSHLTKQQYFRFSFGDLQLKG-N 1855

Query: 1843 LGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTML-------ETK 1895
            + N      + L +S  KL++ + +K +  FL D +   ++IE   +  L       ++K
Sbjct: 1856 MVNDPYHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQKSK 1915

Query: 1896 SSTVQNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPT 1955
                 N+F +S      ++ N+ Y GLL   G+  ++ E   L  S +K   S  P    
Sbjct: 1916 PEKDNNKFSWS------IDTNINYFGLLAPIGSAYFLFELRMLLASLTK-MGSDIPNQSD 1968

Query: 1956 FSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPM 2015
             S  +S E++ F IK+R +   LSK+LDFS+++  ++       + QIESS+    LSP 
Sbjct: 1969 ISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPE 2028

Query: 2016 SLVRLLSFVNEFSIMKSIYHDIKP------RSTSSN-STLSILPISIKSAHILSYNLCIG 2068
            SLVRLL   N+ S     Y D         RS  +N      LP+++ S HILSYN C+G
Sbjct: 2029 SLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFCVG 2088

Query: 2069 WLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMN 2128
            WLF +   +  GLI GY RLF+ Y+K  GKLTL+D +FS+A+G SS  ++ +G EK   N
Sbjct: 2089 WLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYN 2148

Query: 2129 RSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETI 2188
            RSYLP+MQI+YW ++    +DLF+R +GE LDV+ L+ +  +++ A  S+  F++LK+ +
Sbjct: 2149 RSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDL 2208

Query: 2189 LD--PLKVTSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQ-HGTCSFE 2245
            +   P K   ND    E N L +P  +++RSI+C   Y G   K++S +D +     SFE
Sbjct: 2209 IPGLPKKQKVNDDKTLELNTL-SPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFE 2267

Query: 2246 IRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSC 2305
            + SP   + ++YK+  ++ K HWIR+L  +N+THN L+  C PLL++ +     M+K   
Sbjct: 2268 VNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVKKHS 2327

Query: 2306 SQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDI 2365
            S   +     +S    ++Y+ LL++FDIA+ I   KQ++SL+CEP AK+QA IGF+ F  
Sbjct: 2328 SSEESTLSKPSSQN--LDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIF 2385

Query: 2366 KIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTYGS 2425
             + TN +   EPL  S+ +    AS +H+FSRE           +    TH + I+ +G+
Sbjct: 2386 TVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGT 2445

Query: 2426 TLISKPLFYFNVKQIEDLNLFLEIWSIE---KQKSVNDIILAPVTASSFESVPSMPKLQR 2482
             LIS    +FNVKQ+++L LFL+IW +    K K  NDI+ A   +S   +  S P+   
Sbjct: 2446 ALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSSLSIAQLSDPE--- 2502

Query: 2483 VPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEIC 2542
                +   W + LI + +  ++DLGPSLG++ V+    W  + H  +  + L        
Sbjct: 2503 ----SIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTS 2558

Query: 2543 MSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFIST 2602
            +SS GRL G   +K   W S++ WP     +  PLV +++ +   +TK +FDYHMF I  
Sbjct: 2559 LSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGA 2618

Query: 2603 IQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRT 2662
            I N  + L +++D  G + DLL V+   ++I +  T+L  AN+ DIY+T  RMR D+  +
Sbjct: 2619 INNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKIS 2678

Query: 2663 NLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTR 2721
             ++ L ESNE +     + + +L SL  L+T++SV+   LN+ I   TL   EV+V+   
Sbjct: 2679 YIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIE 2738

Query: 2722 KVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLAS 2781
             +       A S+T S  K+ TEL  Q+ D S+SLS+ K ++DE  + KI V +Y++ AS
Sbjct: 2739 SI------SARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYAS 2792

Query: 2782 IIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHI 2841
             I GG I+E P + V+M T+Q + S+++E LY+  F + +S+ WNL PINFIK+MW+ HI
Sbjct: 2793 KIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHI 2852

Query: 2842 NAMKLRHMQ-----KGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDL 2896
             A+ +R  Q      G S       +ED+E ++ + +  +++ Y  LE P I+MP+I+DL
Sbjct: 2853 RAIAVRRSQVVGVLDGQS-------EEDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDL 2905

Query: 2897 GDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILG 2941
            GDATPP+EWFG+NR RFP  THQ  V  +QKL   AE+EY  ILG
Sbjct: 2906 GDATPPMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILG 2950

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1607 (32%), Positives = 792/1607 (49%), Gaps = 129/1607 (8%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            MD ++ F+ + +   R F WVFLV+W    ++ +   FYL R  G+++T IL WV+WKR 
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND 120
            KV INI+SL  + +GG + F+N+ I  RD TIS L+GT  WRYWL N R +Q +  N+++
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQ-ENLDN 119

Query: 121  ENSK----------------CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFA 164
            E  +                CRF L C+G+E+F+YNK + YE+I++  +K ++    KF 
Sbjct: 120  EEERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFV 179

Query: 165  TDDE--SIFGRVKTDSSVMFDPLDESSEQSKVGQT------------ILNSVSNQSAVP- 209
             D     +F   + ++ V+ +    S     VG                    N    P 
Sbjct: 180  DDQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPN 239

Query: 210  -----------------LYLDFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAG 252
                             +Y+ FLP ++     ++V+GN+ TPS+ ++     +GIID+  
Sbjct: 240  NLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCP 299

Query: 253  PTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFTIS 312
            P   LD +K++ E EL     SVK NI F +  S+      G+   LWQK     L    
Sbjct: 300  PKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLLP-- 357

Query: 313  HILAFTGNKKGLTGQEE--FLTSWKGLAMYDVATSDTFSDEIPFDLQNHEYAKYTTILNA 370
                 T   K L  QE+  F  +WKGL++Y     +   + + FD  NHEYA+  +IL +
Sbjct: 358  -----TLGPKHLQTQEDITFRENWKGLSLYRQNMEEDELENVDFDFANHEYARVISILKS 412

Query: 371  DRIKLLYSYDTPGVIT---ETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQY 427
             +I   Y YD PG++    E  ++G E G+    PE+ +D+QLY AN  YGPWA RQL Y
Sbjct: 413  AKIVFTYEYDIPGLVPKEPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGPWAERQLSY 472

Query: 428  FIKMFSPAVSRDFSAHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYK 487
               + SP VSR     +    G  R +  F+  I IME+S WRIPT+E SKD  FL  Y 
Sbjct: 473  LRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYV 532

Query: 488  STNDESRAFGWIDIKLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNA 547
             T +E R FGWID+K  KD+   ++  +  +E G  N  + +  N  I TSVNH++L  A
Sbjct: 533  ETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRA 592

Query: 548  KAHQIIARQSYPHQWNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELF 607
            K+    A   YP  WN    W ++  S+ LE+FILR+H  L+ D+F DF+SGD  PYELF
Sbjct: 593  KSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELF 652

Query: 608  RPVLYQFSWDISNYSLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPXXXXXXXX 667
            RP +Y+ +W++  YS+YLN ND NIVNNPLDFNENCY+S+HG+     VK+P        
Sbjct: 653  RPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRC 712

Query: 668  XXXXXXXXXPKFDIQLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYXXXXXXXXXXXX 727
                     P F + L TPPW+TL+EFM  + VGRS+ F  +G Y  +            
Sbjct: 713  TEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTIS 772

Query: 728  LECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDD 787
            +EC +   T   YGF++RY+MN+K+NYFG+F+ F T EEY+       +   +  N N  
Sbjct: 773  VECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNA-----NHTEEPKNENLG 827

Query: 788  DQ-------TTELVEPNSYGESGFDILHGKKIDKAS-LKRTVNEKDIWVTFFFEDGCFVL 839
            D+       +TE VE +     G     G  + K S LKRT NE DIW  F   +G  +L
Sbjct: 828  DEHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALIL 887

Query: 840  PESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPF 899
            PE+ Y+   C  LHF+ +  D+R  +YY DL  +MN+T +KRY     + +F+    +  
Sbjct: 888  PETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNG 947

Query: 900  ITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFS 959
                  GYLS   IH HRM+GLPP E TY  +  V +  L   SD+E  KGF+   +K  
Sbjct: 948  RQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIG 1007

Query: 960  FGFDNFEDVLHYEMARSFDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTS 1019
            FGF N E++L YE    FD++ ++    ++   +N+ DT+    L    ++   +DF   
Sbjct: 1008 FGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFENE 1067

Query: 1020 KYSLRANIDIPNFDFLVSSMDDHNI---VLGXXXXXXXXXXXXRNPDFKTTNNLQTQHIL 1076
             YS R +   P+ +FL+  +D++      L             +N  F      Q ++I 
Sbjct: 1068 AYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYIT 1127

Query: 1077 LSDAPFCRCSFLHPQEYQTSDLYKXXXXXXXXXXXXXXXXXXXXXNNFDTIFENLLGD-- 1134
            L D+ + RCSFL P  +Q S LYK                        D I E+ LG+  
Sbjct: 1128 LHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLGEYA 1187

Query: 1135 -------IYQDYISEG--TFDISNDTKLQLNIDEFKKHSENSFSKHKTKNLTIDIVDELH 1185
                         SEG  T   + DT+ Q N   F  H  ++   ++ +           
Sbjct: 1188 PTVKPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHNPPNNRDR----------- 1236

Query: 1186 EVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASS 1245
               ++V ++ ++N+++   V  V  +  ++  T   +D ID   + IV       +GAS 
Sbjct: 1237 -YNNYVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASF 1295

Query: 1246 VTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDINKLDLNLRLRQEYDKESANSEMNSKN 1305
            VT +++    + F     E   +E         +N  D +LR +           + +++
Sbjct: 1296 VTTSRLHVKDLHFLYDFEEGSGVELA-------LNSFDFDLRRKT----------IENED 1338

Query: 1306 KLSVYYKTALINGKMLSKENFIYPSESSEFSYKS-----TFEELEGYAFYDDDLVTDANL 1360
            +  +  KT   N   L     +  +  S  S K      + E+LE ++   D+ V   N+
Sbjct: 1339 EKVILEKTMFSNIHTLRIS--LLEAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNV 1396

Query: 1361 QRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGI 1420
                  +++   + IS ++          I S    +N  K  +++L+  +  A + Y I
Sbjct: 1397 TSFGFTLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQI 1456

Query: 1421 QHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNYLPQYWYET---TSLELQKGKF 1477
             HDP VITKPA I RLS  HVRE+RSWRI+TRLRH+L YLP  W       +++  +   
Sbjct: 1457 SHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPN 1516

Query: 1478 RSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYIPA-EVTFAKTI 1523
              + D  + F+ +F+ WR+W+ +D+ R ++YKK ++P  E +F K +
Sbjct: 1517 VPQRDEDI-FVSVFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKKEL 1562

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1167 (34%), Positives = 637/1167 (54%), Gaps = 33/1167 (2%)

Query: 1786 PFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGN 1845
            PF L    K+  I       ++  L   +  V L S    E + K+S + L+        
Sbjct: 1856 PFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCEVADE 1915

Query: 1846 TDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKSSTVQNEFPF 1905
               +  + + +S  KL++ EP++ +   L D +  V++++ ++      +S++  N+   
Sbjct: 1916 VVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGGNDRSP 1975

Query: 1906 SRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSSESI 1965
            SR     L+ N++Y GLL+   +  Y+ E ++L  S +            FS     ES 
Sbjct: 1976 SRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEYDRHFSGQIVVESC 2035

Query: 1966 CFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLL---- 2021
              L+K+  +   LSKVLDFS+R    +    ++QS QIESSY    L P  LV +L    
Sbjct: 2036 YLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWSVH 2095

Query: 2022 ---SFVNEFSIMKSIYHDIKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNAN 2078
               S +N F   K  +    P S++  +      +  +S HILSYN C+GWLF++G N+ 
Sbjct: 2096 YLQSLLNHF---KKHHTPWLPYSSNKTAKSGESTLDFRSIHILSYNFCVGWLFEVGDNSE 2152

Query: 2079 EGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQIN 2138
             GLI GY+RLF+ Y+K +GKLTL+D Y SVA+G +S T+Y   +EK +  R+YL +MQI 
Sbjct: 2153 PGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYLSNMQIF 2212

Query: 2139 YWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKVTSND 2198
            YWL+ EN  KDLF+R +GE +DV  L+  F +V++   S+ +F ++K+  +     ++  
Sbjct: 2213 YWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGSSTKS 2272

Query: 2199 PILGEW--NYLDNPLASSVRSINCIINYAGSSMKLYSRDDI-QHGTCSFEIRSPAHTVTI 2255
             +  E   N L  P  + +R+IN  +N+AG   K+YS  ++        EI+SP   + I
Sbjct: 2273 KLNMEAASNTL-APFLAHIRTINSQLNFAGGVFKVYSPTELDSKAEPLLEIKSPGVQMAI 2331

Query: 2256 DYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNL 2315
            +Y++  +++KSH IR   T+  THN LF  C PLL++       M++N  S+     P+ 
Sbjct: 2332 NYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRNLSSE-DKSHPSK 2390

Query: 2316 ASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPD 2375
                + I+Y+ LL  +DIA  I  GKQ++S +CEP AK+Q   GF  F  ++ T+ +   
Sbjct: 2391 PVTDS-IDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDKVDSV 2449

Query: 2376 EPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTYGSTLISKPLFYF 2435
            EP  +S  +  + +S RH+FSR+           +V   T   Y + YG  L+S    Y 
Sbjct: 2450 EPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFT---YPNVYGVALVSDMNIYC 2506

Query: 2436 NVKQIEDLNLFLEIWSIE-KQKSVNDIILAPVTASSFESVPSMPKLQRVPINATFSWDYL 2494
            N+KQ ++LN+FL+IW +  + ++      A   + + +S+              F W + 
Sbjct: 2507 NMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKSLSPPFSPSSNDSRKVFPWSFT 2566

Query: 2495 LIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVF 2554
            +I + +G  +DLGPSLG++ +  + +W  + H  D  +        I ++S GRL G   
Sbjct: 2567 IIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSGMFE 2626

Query: 2555 IKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQ 2614
            +      S+I+WP  +     PL+ +S+A+   + K +FDYHMF I ++++  + L N+ 
Sbjct: 2627 LDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLHNES 2686

Query: 2615 DERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLL-ESNELK 2673
            D    L DLL VS+  ++I +  T+L  AN  DIY+TI RM+ D+  + ++ L ESN   
Sbjct: 2687 DTYAILPDLLQVSLEFESIVLCATALTAANALDIYNTIMRMQQDNRISYIETLKESNISA 2746

Query: 2674 KISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASS 2733
              +S    ++L SL  LRT++SV  + L +HI   +L   EV+V+  R V       A S
Sbjct: 2747 SSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDV------NARS 2800

Query: 2734 KTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGIILEAPS 2793
            +T S  K++TEL  Q+ D++ SLSS K +LDE  + KI V DY+  AS   GG I++ P 
Sbjct: 2801 ETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVDDYMLYASKFSGGTIIKLPQ 2860

Query: 2794 IFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHMQKGN 2853
            + V+M TWQ Q S V+E L++  F + +S+ WNL P+NFIK+MW+ H+ ++ +R  Q GN
Sbjct: 2861 LLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRRTQLGN 2920

Query: 2854 SS-EIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSR 2912
            SS E+ +  + D E  +      +K+IY PL+EP IEMP+IKDLGDATPP+EWFG++R  
Sbjct: 2921 SSPELEVANESDKEDTVK-----SKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKN 2975

Query: 2913 FPGLTHQIVVVPLQKLSAVAEKEYVRI 2939
             P  THQ  V+ +QKL   AEKEY ++
Sbjct: 2976 LPAATHQTAVLLIQKLVHTAEKEYAKL 3002

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/1590 (33%), Positives = 806/1590 (50%), Gaps = 127/1590 (7%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            M   +EF+++ +   + F WVFL++W  L+++ +   FY+ RAI YI + IL W++WKR 
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPR-PT---QLKNS 116
             + +NI+SL  S++GG+++FKN++I  +D TIS+L+GT TWRYWLL  R P+   + K+S
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 117  N----INDENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFG 172
            N      +E   CRF L C+G E+F+YN+   Y++I+N  +K ++   +KF   DE IF 
Sbjct: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFL--DEQIFN 178

Query: 173  RVKTDSSVMFDPLDESSEQSKVGQTILN-------SVSNQSAV----------------P 209
               + SS   +  + S+ +S    T LN         S+QS                   
Sbjct: 179  DHSSYSSKTTNGANSSTGESN-SDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDS 237

Query: 210  LYLDFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELS 269
            L+L   P E+ +   ++  GNK TPS+ II      GIID   P   LD YK++   E  
Sbjct: 238  LFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETH 297

Query: 270  STRVSVKPNISFGNGSSSKKHKID-GKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQE 328
            +  V+VKPNI +       K KID GK   LW++    +   I+  L  T  KK      
Sbjct: 298  NFAVTVKPNIGYKE-EMLLKFKIDRGKLSRLWKRFTP-ITGIITRPLGLTQRKKKRNEPP 355

Query: 329  E-FLTSWKGLAMYDVA----TSDTFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPG 383
            + F+  W+GL++Y       T+D   D+I FD  NHEYAK+++++   +    Y YD PG
Sbjct: 356  DLFIQKWQGLSLYKGTIFEPTTDDL-DDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPG 414

Query: 384  VI------TETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVS 437
             +      T + I G + G+    P +S+D+Q++  +  YGPW  RQ+ +   M +PAVS
Sbjct: 415  CVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVS 474

Query: 438  RDFSAHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFG 497
            R  S  ++ V G +R +   +  I IM+D+ WRI T+EPSKD  FL  YK TND+ R FG
Sbjct: 475  RTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFG 534

Query: 498  WIDIKLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQS 557
            WID++ +K++       L  +  GF+N  + +L    I +SVNHD+L   K        S
Sbjct: 535  WIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVS 594

Query: 558  YPHQWNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWD 617
            YP  WN   TW +   S+ LE F+LR+H  L+ D  TDF SG+  PYELFRP     +W 
Sbjct: 595  YPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWK 654

Query: 618  ISNYSLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXP 677
            +  Y +YLN ND NIVNNPLDFNENCY+S+HG+   I V +P                 P
Sbjct: 655  MDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTP 714

Query: 678  KFDIQLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATF 737
             F + L TPPW+TL+EFM  + VGRS++FSA GSYL Y            + C++   T 
Sbjct: 715  MFRLLLNTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTL 774

Query: 738  LAYGFLLRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTTELVEPN 797
              YGF++RY+ N+K+NYFG+F  F T+EEY+            I +N  D++    V   
Sbjct: 775  QCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSDNEDNGDVY-- 832

Query: 798  SYGESGFD------ILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFG 851
            S GESG D      I     + ++ L+RT NE D+++TF   DG  +LPE+ Y+  +C  
Sbjct: 833  SDGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTA 892

Query: 852  LHFDNITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEF 911
            L F  +  D+R  +YY DL  S+  T ++RY + S   +F     +   +S   G+LS+ 
Sbjct: 893  LKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDL 952

Query: 912  NIHIHRMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHY 971
            +IH HRMFGLPP E TY  K D  +G L+  S+ + LKGF+   ++  FGF + E++L Y
Sbjct: 953  SIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLY 1012

Query: 972  EMARSFDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPN 1031
                  D++ L+  A +IS+ L N  +   ++L   +V+   +DF ++ YS R ++ IP+
Sbjct: 1013 SKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPS 1072

Query: 1032 FDFLVSSM--DDHNIVLGXXXXXXXXXXXXRNPDFKTTNNLQTQHILLSDAPFCRCSFLH 1089
                +  +  D     L             +  +FK   ++Q  +I L+DA F R SFL 
Sbjct: 1073 LKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLL 1132

Query: 1090 PQEYQTSDLYKXXXXXXXXXXXXXXXXXXXXXNNFDTIFENLLGDIYQDYISEGTFDI-- 1147
            PQ +Q  +LY                         D I E+ LG+          F +  
Sbjct: 1133 PQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPF 1192

Query: 1148 -SNDTKLQLNIDEFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVL 1206
             S +T  Q +      H E      +  N T+   ++ ++  + V ++ +I+++I+  + 
Sbjct: 1193 GSTNTPNQAST-----HHEEDMDPLEFSNSTVS-TEKNYQCDNLVIDIEYISVEINPSIS 1246

Query: 1207 EVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYY 1266
                 L   +    I   ID + ++ +   S    G SS+T  K+     D      + Y
Sbjct: 1247 TYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRY 1306

Query: 1267 ALEDVKHYFVSDINKLDLNLRLRQ-EYDKESANSEMNSKNKLSVYYKTALINGKMLSKEN 1325
             +E         ++KLD  +  R  E D+E                   L+   ML+K  
Sbjct: 1307 GIELY-------LDKLDFEMSQRNIEKDREK-----------------GLLEITMLAKTR 1342

Query: 1326 FIYPSESSEFSYKSTFEE-------LEGYAFYD----------DDLVTD-----ANLQRG 1363
             I  S S E S K+  E        +EG   +           D + TD     + L+  
Sbjct: 1343 SIRASISEEGSTKNEKERPPALSLVVEGCELWSATAEKQVNSIDTISTDITIDESQLEWL 1402

Query: 1364 CVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHD 1423
             +F+N E + ++   I TL    N+     T+S       +R+L+ ++  A   Y I HD
Sbjct: 1403 FLFVN-EQNQNLQNIITTL----NSVQAEHTVS-------RRKLISKLTAANDFYQISHD 1450

Query: 1424 PPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDA 1483
            P VITKPA ITRLS+ HVRE+RSW+I+TRLRH+L Y+P  W       L++     +++A
Sbjct: 1451 PYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEA 1510

Query: 1484 KLQFLDIFTRWRSWEFADVERCFLYKKTYI 1513
            K  F+ +F+ WR+WEF+DV R ++Y + ++
Sbjct: 1511 KKVFMSVFSNWRNWEFSDVARSYIYGRLFL 1540

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1185 (34%), Positives = 656/1185 (55%), Gaps = 56/1185 (4%)

Query: 1786 PFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGN 1845
            PF +R+  K+F++           + + DT   L S   ++ Y + S    ++    +  
Sbjct: 1820 PFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEG 1879

Query: 1846 TDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRST---MLETKSSTVQNE 1902
               +   ++ +S  KL+  EP + +  FL D   A ++ ++L++    +L      +Q  
Sbjct: 1880 EFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASESFKLLKALKPFLLPQTEGRLQP- 1938

Query: 1903 FPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSS 1962
               ++ +   L+ +++Y G+L+   TT +V E + L  S S   T          S  S 
Sbjct: 1939 -ATTKEMRWLLDTDIKYFGILVPISTTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSI 1997

Query: 1963 ESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLS 2022
            E++ FLIKDR +   LS++LDFS+    I+  +    S Q+ES++    LSP SLVRL+ 
Sbjct: 1998 ENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVW 2057

Query: 2023 FVNEFSIMKSIYHDIKP---------RSTSSNSTLSILPISIKSAHILSYNLCIGWLFDL 2073
               +F  + + Y + +          +        S + +++ S H+LSYN CIGW+F  
Sbjct: 2058 GGQQFLGLANYYKEQRGTDLWDIKASKLKKEKKGSSSIGMNMSSFHVLSYNFCIGWMFPE 2117

Query: 2074 GYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLP 2133
               +  G++ G+ RLF+ Y+  YGKLTL+DA+FSVA G +S+T+YP  +E  ++NRSYLP
Sbjct: 2118 ANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLP 2177

Query: 2134 SMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLK 2193
            +MQI YW+++    KD+FIR +GE LDVS L  + T+++   QS   F++LK +++ P  
Sbjct: 2178 NMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPNT 2237

Query: 2194 VTSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQ-HGTCSFEIRSPAHT 2252
             T+ +    +   L  P  S+++S+NC   Y G   K++S +DI+ H   SFE+++P   
Sbjct: 2238 STTENNTEPKIKSL-APFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVI 2296

Query: 2253 VTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLK--NSCSQFSN 2310
            +  +YK+     K HWIR L  + +THNTLF VC PL+ E     + M+K  +S ++  +
Sbjct: 2297 IDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHES 2356

Query: 2311 GAPNLASAKAE-INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFT 2369
             A NL+ A ++ I+Y+ LL+ FDIA  +   +Q++SL+CEP AK+QA +GF+ F I I T
Sbjct: 2357 IATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVT 2416

Query: 2370 NSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTYGSTLIS 2429
            N++   EPL  S+ +    AS +H+FS+E           + F  TH + I+ YG+ LIS
Sbjct: 2417 NNLDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLIS 2476

Query: 2430 KPLFYFNVKQIEDLNLFLEIWSIE------------KQKSVNDIILAPVTASSFESVPSM 2477
            +   YFNVKQ+++L LF++IW +               K  N  +  P  ++ +  +P  
Sbjct: 2477 EVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIP-- 2534

Query: 2478 PKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLIS 2537
                         W + LI + I    DLGPSLG++ +K    W  S H  D  Q +   
Sbjct: 2535 -------------WSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAF 2581

Query: 2538 MKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHM 2597
               +   S GRL G   +    W S+++WP     H  PLV +S+ +   + K +FDYHM
Sbjct: 2582 TDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHM 2641

Query: 2598 FFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRN 2657
            F I TI  A   L +++D  G + DLL V+ + + I +  T+L  AN+ D+Y+T+ RMR 
Sbjct: 2642 FLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMRQ 2701

Query: 2658 DSGRTNLDLL-ESNELKKISSFDNSK-MLASLLSLRTELSVNAQLLNLHIFSTTLIGTEV 2715
            D+    L+ L ES+ L+   + DN + +L SL  L+T++S N  +L L +    L   EV
Sbjct: 2702 DNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEV 2761

Query: 2716 VVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVID 2775
            +V+    +       A + T +  K++T L  ++ D  ++LS+ K ++DE+ +  I V D
Sbjct: 2762 LVINIENI------SARAGTFAGEKLKTILELEVYDGYVALSTSKREIDEDTVSAISVAD 2815

Query: 2776 YVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKD 2835
            Y++ AS I GG I+E P + + M +WQ + S+++E LY  +F + +++ WNL P+NFIK+
Sbjct: 2816 YMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKE 2875

Query: 2836 MWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKD 2895
            MW+ H+ A+ +R  Q  N  +  +  DE+++ ++ + +  +K  Y P+EEP I+MP+I+D
Sbjct: 2876 MWTTHVKALAVRRSQ--NVLDTDMQTDEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRD 2933

Query: 2896 LGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940
            LGDATPP+EWFG+NR R P  THQ VVVP+QKL   AEK+Y  +L
Sbjct: 2934 LGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLL 2978

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1586 (31%), Positives = 786/1586 (49%), Gaps = 100/1586 (6%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            M+ Q++FE + +  ER F WVFLV+W  L ++ +   FYL R   Y +T +L W +WK +
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIN- 119
            KV I+++SL  + + G + F+N+ I  +DQTISILKG+  WRY LL  R +Q + ++   
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 120  --------DENS------KCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFAT 165
                    D NS       CRF L C+G E+FIYN+   YE+I+   ++ ++    KF +
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 166  DDESIFGRVKTDSSVMFDPLDESSEQS---------------KVGQTILNSVSNQSAVPL 210
                     K + S +F    E S+                  +   + + V NQ    +
Sbjct: 181  ---------KQEMSELFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKK-SI 230

Query: 211  YLDFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSS 270
            ++ FLP E+ LS G++V+GNK TPS+ I       G++D+  P   LD YK+  + +   
Sbjct: 231  FMRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFID 290

Query: 271  TRVSVKPNISFGNGSSSKKHKIDGKPFNLWQKLKDCL---LFTISHILAFTGNKKGLTGQ 327
              +S++ NI +    ++ K   +GK   +W      L    +  SH      N KG T  
Sbjct: 291  IDISIRQNIEYNRKKATFK---NGKLSRMWATFVKVLHIPFYNKSH------NNKG-TES 340

Query: 328  EEFLTSWKGLAMYDVATSDTFS---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGV 384
            E F+T WKGL +Y   T D      DE+ FD  NHEYAK + I+ + R  L YSYD PGV
Sbjct: 341  EPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGV 400

Query: 385  I---TETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFS 441
            +       ++G E G+    PE+ ID+Q Y     YGPWA R++Q+ ++M SP V+R   
Sbjct: 401  VPHGAHPTLEGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSV 460

Query: 442  AHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDI 501
              +    G  R +  F+    +++ S WRIPT+E SKD  FL K+K+T++E R FGW+D+
Sbjct: 461  PIKTLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDL 520

Query: 502  KLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQ 561
            K   D+  S+   L   E GF N  + +       +SVNHDV+       +     YP  
Sbjct: 521  KFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLG 580

Query: 562  WNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNY 621
            WNS+ TW ++  S+ LE F+LR+H  L+ D+FTDF+SG+  PYELFRP +YQ +W I  Y
Sbjct: 581  WNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGY 640

Query: 622  SLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDI 681
            S+YLN ND NIVNNPLDFNENCY+S+HG    I V  P                 P F +
Sbjct: 641  SIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRL 700

Query: 682  QLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYG 741
             L TPPW+TL+EFM  + VGRS+ F+  G Y  Y            +EC +   T   YG
Sbjct: 701  LLNTPPWNTLNEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYG 760

Query: 742  FLLRYVMNLKLNYFGEFAQFRTTEEYSEEL--AQRNDVATDIFNNNDDDQTTELVEPNSY 799
            F++RY+MN+K+NYFG+F  F T+EEY+  +   ++  V      +  D+ T    +    
Sbjct: 761  FVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGL 820

Query: 800  GESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITF 859
             +    +     + ++ +KRT NE DIW TF   +G  VLPE+ Y+   C  LHF  +  
Sbjct: 821  SDPYVRLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIV 880

Query: 860  DMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMF 919
            D+R  +YY DL  +M+ST IKRY    S+ +F+    +   T    G L+   IH HRM+
Sbjct: 881  DLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMY 940

Query: 920  GLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDI 979
            GLPP E TY  +  + L  L+  SD E  KGF        FG+ N E+ L Y++    D+
Sbjct: 941  GLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDM 1000

Query: 980  SCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLV--S 1037
            + ++    D+++ + N D+++ + + +PN++   +DF   +YS R ++ +P+   L+  S
Sbjct: 1001 TSVTVRVRDMNVVVEN-DSSRAV-VDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTS 1058

Query: 1038 SMDDHNIVLGXXXXXXXXXXXXRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSD 1097
              D   I L             +  DF    + Q  +I L+D+PF RCSFL P   Q S 
Sbjct: 1059 EDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESP 1118

Query: 1098 LYKXXXXXXXXXXXXXXXXXXXXXNNFDTIFENLLGD----IYQDYISEGTFDISNDTKL 1153
            LYK                        D I E+LLG+    +  DY ++ T D  +    
Sbjct: 1119 LYKSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSE 1178

Query: 1154 QLNIDEFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLY 1213
              +  +  +  ++       +   I   + L +  + + ++  + +D+   +      L 
Sbjct: 1179 SFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLL 1238

Query: 1214 RQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKH 1273
             +       D ID + + IV    +  +  + V   K+    I+F      ++  ++ K 
Sbjct: 1239 GEFWKVNTVDIIDEIEMSIVKRLGQ-LWNNTCVLNLKLYVVDINF------FWGDKNAK- 1290

Query: 1274 YFVSDI--NKLDLNLRLR-QEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPS 1330
              V D+  +KLD +L  R ++ D E+  SE  + +KL     T           +     
Sbjct: 1291 --VVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVF-------DRSITEGV 1341

Query: 1331 ESSEFSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFI 1390
            E    +     E  E Y++  + +V   +L    + +++   + +S +I          +
Sbjct: 1342 EERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNML 1401

Query: 1391 KSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIV 1450
             S T    + +  +R+LL  I  A + Y I H+P VITKPA I RLS  HVRE+ SWRI+
Sbjct: 1402 TSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRII 1461

Query: 1451 TRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKK 1510
            TRLRH+L YLP  W   +++++         DA      + + WR WE +D+ R ++Y+ 
Sbjct: 1462 TRLRHILTYLPNEWRNNSAIQVSPTV--DSTDAS-----VASHWRRWEISDITRSYIYRT 1514

Query: 1511 TYIPAEVTFAKTICFS-SDLLTISFN 1535
             ++  +   +KT C S   +L + F+
Sbjct: 1515 IFLSDQ---SKTQCQSLKKMLKVDFH 1537

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/1178 (35%), Positives = 652/1178 (55%), Gaps = 55/1178 (4%)

Query: 1786 PFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGN 1845
            PF++R+  K+  + ++  +  +  +S+ D ++ L S +  E Y  ++   L++       
Sbjct: 1797 PFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTE 1856

Query: 1846 TDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKSSTVQNEFPF 1905
            +  +  + L +S  KL++ EP++ +  FL D +   +++  ++  +L+  S   +N+   
Sbjct: 1857 SSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESLGYIKG-LLQLFSPLARNKTQS 1915

Query: 1906 SRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSSESI 1965
            S L    L+ N+ Y G+L+   +T +V E + L  + +      +      +   S E+ 
Sbjct: 1916 SAL-RWSLDANLNYFGILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENC 1974

Query: 1966 CFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLL---- 2021
              LIK+  +   LSK+LDFS+R+   +    + QS QIESS+    LSP SLV++L    
Sbjct: 1975 LLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTH 2034

Query: 2022 ---SFVNEFSIMKSIYHDIKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNAN 2078
               S +  F   +     I P S    S  +   I  +S HILSYNLCIGW+F LG +  
Sbjct: 2035 QLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQIDFRSIHILSYNLCIGWMFQLGDDVK 2094

Query: 2079 EGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQIN 2138
             GLI G++RLF+ Y+K YGKLTL+D YFSVA+G S+ T+Y  G+EK   NRS+L ++QI 
Sbjct: 2095 TGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQIT 2154

Query: 2139 YWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKVTSND 2198
            YWL+E +  KDLFIRVNGE L+VSLL+  F I++    S+ KF+ LK+  +        +
Sbjct: 2155 YWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHKRDSGPRN 2214

Query: 2199 PILGEWNYLDN--PLASSVRSINCIINYAGSSMKLYSRDDIQHGTC-SFEIRSPAHTVTI 2255
             +  E N  +N  P  S +R+I+C   Y G  +K+YS DD+      S EI+SP   + +
Sbjct: 2215 KLNLE-NTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIAL 2273

Query: 2256 DYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNL 2315
             Y +  ++++ H IR L +++ THN L+  CVP+LN++      M++    + S     L
Sbjct: 2274 KYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQ----KHSPDETPL 2329

Query: 2316 ASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPD 2375
             S+++ I+Y+ LL++FDIA  +  G+Q++SL+CEP AK+QA +GF+ F   + TN +V  
Sbjct: 2330 ESSQS-IDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDG 2388

Query: 2376 EPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTYGSTLISKPLFYF 2435
             P  +S+ +  + +S RH+FSRE                TH +    +G  L+S    +F
Sbjct: 2389 NPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPD---VFGVALVSDINVFF 2445

Query: 2436 NVKQIEDLNLFLEIWSI-----EKQKSVNDIILAPVTASSFESVPSMPKLQRVPINATFS 2490
            N+KQ+++LNLFL+IW +      K ++ +D           +   SM   +R     +  
Sbjct: 2446 NMKQLQNLNLFLDIWQLNGKLNNKGRAKDD--------DRKKQTKSMTLSKRTSTPTSIC 2497

Query: 2491 WDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLG 2550
            W + LI + +  ++DLGPSLG++ ++    W  + H     + L     E+ + S GRL 
Sbjct: 2498 WSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLS 2557

Query: 2551 GYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIEL 2610
            G   +K+  W S++ +P   +  G   + LSL++G    K +FDYHMF I TI      L
Sbjct: 2558 GVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHL 2617

Query: 2611 FNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLL-ES 2669
             ++ D  G L DLL V++S   +    T+L  AN+ DIY+TI RMR D+  + ++ L ES
Sbjct: 2618 RSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQDNRISYIETLRES 2677

Query: 2670 NELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKN 2729
            N  +   +     +L SL  LRT+LS +       I   +L   EV+VL    V      
Sbjct: 2678 NSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVLVLNIDNV------ 2731

Query: 2730 EASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGIIL 2789
             A S+T S  K++TEL  Q+ +  +SLS+ K +LDE ++ KI + DY+  AS I GG I+
Sbjct: 2732 SARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASKISGGTIV 2791

Query: 2790 EAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHM 2849
            + P + V+M TWQ   S++IE L++  F + V++ WNL PINFIK+MWS HI ++ +R  
Sbjct: 2792 KVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKSLAVRQT 2851

Query: 2850 QKGNS-----SEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVE 2904
            Q   +      +  +  +E+I+AKL          Y PL+EP IEMP+IKDLGDATPP+E
Sbjct: 2852 QSNKTMSEKDKQADLDPEEEIKAKLQ---------YVPLDEPYIEMPQIKDLGDATPPME 2902

Query: 2905 WFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILGK 2942
            WFG++R R P  THQ+ +V +QKL   AEKEY ++ G+
Sbjct: 2903 WFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1562 (32%), Positives = 797/1562 (51%), Gaps = 88/1562 (5%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            MD  ++F+ I +  ++ F WVFLV+W  ++++ +F  FYL R + Y ++ IL W +WKR 
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLKNSNIND 120
             V INI+S+  S +GG+V+FKN+ I  +D TIS L+   TWRYWLLN R +      + D
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120

Query: 121  ENSK------CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRV 174
            + S       CRF LE +G+E+F+YN+   Y++I+ + +K +++   KF   +E +F   
Sbjct: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFL--NEQVFTDS 178

Query: 175  KTDSSVMFDPLDESSEQSKVGQTILNSVSNQ-------SAVPLYLDFLPAEVILSSGAVV 227
            K + S      +E + +S       +S +N        S  P +LDFLP +  +S G+++
Sbjct: 179  KAEVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGSLI 238

Query: 228  VGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSS 287
            +GNK TPS+ I   +   G+IDV  P+  LD YKLR   +  +  + +K NI F N   S
Sbjct: 239  IGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGF-NEEFS 297

Query: 288  KKHKID-GKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYD---VA 343
             K KID  +   +WQ+    LL   SH+         ++ ++ F   W+GL++Y      
Sbjct: 298  MKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIFG 357

Query: 344  TSDTFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVI------TETLIKGYENGD 397
             S+   ++I FD  NHEYAK+++I+   +    +  D PG++      T T   G + G+
Sbjct: 358  KSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGN 417

Query: 398  IPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANF 457
                PE+S+++Q+   +  +GPWA RQL   I++ SP  SR+    ++   G +R +  F
Sbjct: 418  SGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQF 477

Query: 458  RCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQA 517
            +  I   E++ WRIPT+E SKD  FL  Y+ TN+E R FGWID+K +KDT I   +    
Sbjct: 478  KTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQCP 537

Query: 518  SECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDL 577
            ++ GF+NT   +L +  I +SVNHD+L   K+   +    +P  WN   TW +   S+ L
Sbjct: 538  TKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQL 597

Query: 578  ELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPL 637
            E FILR+H  L+ D  TDF+SG+  PYELFRP +Y+ +W I+ YSLYLN ND NIVNNPL
Sbjct: 598  EAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNPL 657

Query: 638  DFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEFMAQ 697
            DFNENCY+S HG+  +I + +P                 P F + L TPPW+TL+EFM  
Sbjct: 658  DFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMKN 717

Query: 698  RFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNYFGE 757
            + VGRSH+F  +GSYL Y            +EC +       YGF++RY+ N+K+NYFG+
Sbjct: 718  KEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFGD 777

Query: 758  FAQFRTTEEYSEEL----AQRNDVATDIFNNNDDDQTTELVEPNSYGESGFDILHGKKID 813
            F  F T+EEY+ E+     Q       ++ +     + E +E +S  +   +     KI 
Sbjct: 778  FFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIETSSVRK---EQTGDSKIK 834

Query: 814  KASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFS 873
            ++ LKR  NE D+W TF   +G  +LPE+ Y+   C GLHF  +  D R  +YY DL  S
Sbjct: 835  RSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLAS 894

Query: 874  MNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKID 933
            MN   ++RY     N +++    +    +   G LS+  IH HRM+GLPP E TY  + D
Sbjct: 895  MNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWD 954

Query: 934  VSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRL 993
             SLG L    DI  L+GFI    K SFG  + E++L YE     D++ L+     ISI +
Sbjct: 955  FSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMI 1014

Query: 994  NNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHNIVLGXXXXXX 1053
               + + F+  +   +    ++F   KY  R ++ IP F+  + +M+             
Sbjct: 1015 RESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLFEFETK 1074

Query: 1054 XXXXXXRNP-DFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKXXXXXXXXXXXX 1112
                    P D  T  + Q ++I L DAP+ RC+F+ P   Q S++Y+            
Sbjct: 1075 VNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGSIAPSSSL 1134

Query: 1113 XXXXXXXXXNNFDTIFENLLGDIYQDYISEGTFDI---------------SNDTKLQLNI 1157
                        D I ++LLG   +   SE  F I                +DT+    +
Sbjct: 1135 PPLPIPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTESDEEL 1194

Query: 1158 D--EFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQ 1215
            D  EFK  +        + N  IDI               + ++ I+  +     +    
Sbjct: 1195 DPLEFKTETSGDSETFASDNFVIDI--------------SYCSLSINPRLWSYLDNCREH 1240

Query: 1216 LTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYF 1275
              +  I   +D + + IVN+ S    G  +    K+    +D       ++   D ++  
Sbjct: 1241 FCSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDL------FWG--DRQNAG 1292

Query: 1276 VS-DINKLDLNLRLRQ-EYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESS 1333
            +S  ++++DL +  +  E + E+  +E+   NK+     T       +++ + +  ++  
Sbjct: 1293 ISLYLDRIDLEMCQKMLEENNETKITEVTFLNKIRSVRAT-------INEASSVGKADER 1345

Query: 1334 EFSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIK---TLYLKFNTFI 1390
              +     E  E ++   +  V   N+    + I++   D + ++I    TL  +  + +
Sbjct: 1346 PPALSLVIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASAL 1405

Query: 1391 KSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIV 1450
            +S+  S++   + +++L+ ++A A + Y I HDP VITKPA ITRLSR HVRE+RSW+I+
Sbjct: 1406 QSIQESRS---TTRKQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKII 1462

Query: 1451 TRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKK 1510
            TRLRH+L YLP  W         +    +  D    F+ +F+ WR+WEF+D+ R ++Y+ 
Sbjct: 1463 TRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRN 1522

Query: 1511 TY 1512
             +
Sbjct: 1523 MF 1524

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1184 (36%), Positives = 677/1184 (57%), Gaps = 59/1184 (4%)

Query: 1786 PFILRYSCKEFEINVDFGRILQSSL--SLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDL 1843
            PF  R++ K+ +I   F R+  + L  S+ DT + L+S   +E Y ++S   ++L G  L
Sbjct: 1799 PFSFRHNAKQLDIY--FNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFGNIQLKGNIL 1856

Query: 1844 GNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKSSTVQNEF 1903
             N +    I + +S  KL++ + ++ +  FL D +  ++++E   S  L  +     +  
Sbjct: 1857 ENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLFQRKKPAPSTE 1916

Query: 1904 PFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSSE 1963
               R +   L  N+ Y GLL+   +T ++LE + L  S +K +  S+      S  +S +
Sbjct: 1917 KSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSLNKIQGISSKY-NGLSGQFSID 1975

Query: 1964 SICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSF 2023
            ++CFL+K++ +   LSK+LDFS+++  ++   +  +S QIES +    LSP SL  +L  
Sbjct: 1976 NVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCLSPGSLAHMLWR 2035

Query: 2024 VNEFSIMKSIYHD---------IKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLFDLG 2074
             N+       Y +         I  ++T++++ +        S H+LSYN C+GWLF   
Sbjct: 2036 GNQALTNIRYYKEHTSVAWEKVINFKNTNNSAEVQA---DFPSFHVLSYNFCVGWLFSPE 2092

Query: 2075 YNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPS 2134
            ++   GLI GY RLF+ Y+K +GKLTL+DAYFSVA+G +S T++  G+EK   NRSYLP+
Sbjct: 2093 FDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPN 2152

Query: 2135 MQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKE-------T 2187
            MQI+YWL+ E   +D+++R +GE LDV+ LA +  +++ + +S+ KF++LK         
Sbjct: 2153 MQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELKRDLVGTASN 2212

Query: 2188 ILDPLKVTSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDI-QHGTCSFEI 2246
            I +  + T+ +PI G+     +P  + +RSINC   Y G   K++S  +   H   SFEI
Sbjct: 2213 IKEQTQSTTQEPI-GDI----SPFFTGIRSINCQFQYDGGVFKVFSSAEASNHLKPSFEI 2267

Query: 2247 RSPAHTVTIDYKYYPSKKKS-HWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSC 2305
            +SP   + ++YKY   K ++  WIRTL T+N+THNTLF  C PL+ E       M+K   
Sbjct: 2268 KSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEGIQKMVKRHS 2327

Query: 2306 SQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDI 2365
            S       N+  +K  I+Y+ +L++FD+AV +   KQ +SL CEP AK+QA IGF+ F  
Sbjct: 2328 SDREPSGTNI--SKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADIGFQSFTF 2385

Query: 2366 KIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTYGS 2425
             + TN   P+EPL  ++ +    AS +H+FSRE           +    TH   I+  G+
Sbjct: 2386 TVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPNSINILGT 2445

Query: 2426 TLISKPLFYFNVKQIEDLNLFLEIWSIE---KQKSVNDIILAPVTASSFESVPSMPKLQR 2482
             LIS    +FNVKQ+++L LFL+IW +      K +N+++ +     S  SV      Q 
Sbjct: 2446 GLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSV------QS 2499

Query: 2483 VPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEIC 2542
               ++T  W + LI S I  ++DLGP+LG++ +     W  + H     + L    K I 
Sbjct: 2500 KDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGIT 2559

Query: 2543 MSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFIST 2602
            ++S GRL G + +    W S++ WPI  N +  PLV +SL +    TK++FDYHMF +  
Sbjct: 2560 LTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVGA 2619

Query: 2603 IQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRT 2662
            I N  + + +++D  G   DLL V+V  + I++  T+L  AN+ DIY+T+ R+R D+  +
Sbjct: 2620 INNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKIS 2679

Query: 2663 NLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTR 2721
             ++ L ESN  +   + D   +L SL  ++T++SV+   LN+ I   +L   E++V+   
Sbjct: 2680 YIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNIE 2739

Query: 2722 KVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLAS 2781
             +       A S+T +  K++TEL  Q+ D S++LS+ K +LDE+ +  I V DY+  A 
Sbjct: 2740 NI------SARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAG 2793

Query: 2782 IIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHI 2841
             I GG+I+EAP + + M T+Q + S+++E LY+ SFG+ +S+ WNL P+NFIK+MW+ H+
Sbjct: 2794 RISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHV 2853

Query: 2842 NAMKLRHMQK----GNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLG 2897
             AM +R  Q     G  SE      ED+  ++ K +  +++ Y PLEEP I+MP+I+DLG
Sbjct: 2854 RAMAVRRSQIDVTFGPVSE------EDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLG 2907

Query: 2898 DATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILG 2941
            DATPP+EWFGLNR RFP  THQ  V+ +QKL   AEKEY  ILG
Sbjct: 2908 DATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILG 2951

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1578 (31%), Positives = 786/1578 (49%), Gaps = 112/1578 (7%)

Query: 2    DFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYK 61
            D  ++F +I +   + F WVFLV+W   +++++   FY+ RAI + ++ I  W++WKRY+
Sbjct: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62

Query: 62   VVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPR-PTQLKNSNIND 120
            + +NI+SL  S++GG+++FKN++I D+D TIS L G  +WRYWL  PR P  L   N  D
Sbjct: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122

Query: 121  ENSK---------CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKF-------- 163
            ++           CR  LEC+GVELF+YN+   Y++ +   +K ++    +F        
Sbjct: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182

Query: 164  ----------------ATDDESIFGRVKTDSSVMFDPLDESSEQSKVGQTILNSVSNQSA 207
                            A D+  I  +  T+SS      DES+E       I +    ++ 
Sbjct: 183  RASTESSNGSSSEESKAQDEVEI--KSYTESS-----FDESNESQMANDRIFHD--EETG 233

Query: 208  VPLYLDFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFE 267
              L+L++LP ++ +S  + VVGNK TPS+ I+     EG++D   P   LD YK +   +
Sbjct: 234  KNLFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMD 293

Query: 268  LSSTRVSVKPNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTG- 326
              +  VS+K NI +      K     GK   LW        F +   L  +  KK     
Sbjct: 294  AKNVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAF-VRKPLGLSRKKKNRPSV 352

Query: 327  QEEFLTSWKGLAMYDVATSDTFS---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPG 383
               F   W+GL++Y     +      D+I FDL  HEYAK+T+I+   R  L Y +D PG
Sbjct: 353  TANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPG 412

Query: 384  VI------TETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVS 437
             +      T + I G + G+    P + +++QL+  +  YGPWA RQ+ +   + +P +S
Sbjct: 413  FVPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQIS 472

Query: 438  RDFSAHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFG 497
            RD    +    G+ R +  F+  IV+ ED  WRIPT+E SKDA FL  YK+TN++ R FG
Sbjct: 473  RDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFG 532

Query: 498  WIDIKLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQS 557
            W+D+K +KD+  S    L ++  G +NT   +L +  I +SVNHD+   +K+        
Sbjct: 533  WLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLG 592

Query: 558  YPHQWNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWD 617
            +P  WN    W ++  SS LE F+LR+H  L+ D  +DF++G+  PYELFRP LY  +W 
Sbjct: 593  FPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWK 652

Query: 618  ISNYSLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXP 677
            +  YS+YLN ND NIVNNPLDFNENCY+S HG+   + + +P                 P
Sbjct: 653  LDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTP 712

Query: 678  KFDIQLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATF 737
             F + L  PPW+TL+EFM  + VGR+++F  +G+YL Y            + C +     
Sbjct: 713  MFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVL 772

Query: 738  LAYGFLLRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTTEL--VE 795
              YGF++RY+MN+K+NYFG+F  F T+EEY+E+++ +      +F    DD +T +   +
Sbjct: 773  HCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFD 832

Query: 796  PNSYGESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFD 855
             N+  +    +  G     A ++R  NE D+W+TF   +G  +LPE+ Y+   C  LHF 
Sbjct: 833  KNNEEDDKVKVPRGP----ADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFG 888

Query: 856  NITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHI 915
             +  D+R  +YY DL  S++   +++Y +V  N +F+              Y+S  NIH 
Sbjct: 889  ELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHG 948

Query: 916  HRMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMAR 975
            HRM+GLPP E TY  K D  LG +  ES+++ +KG +    K  FGFD+ E+VL YE   
Sbjct: 949  HRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEV 1008

Query: 976  SFDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFL 1035
              D++ ++    D  I ++N + +    L + N+    +DF   KYS R +I IP    L
Sbjct: 1009 VDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIP---LL 1065

Query: 1036 VSSMDDHNIVLGXXXXXXXXXXXXRNPDFKTTNN------LQTQHILLSDAPFCRCSFLH 1089
              S+  +N                   +F    N      LQ  +I ++DAPF RC F+ 
Sbjct: 1066 KLSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFIL 1125

Query: 1090 PQEYQTSDLYKXXXXXXXXXXXXXXXXXXXXXNNFDTIFENLLGDIYQDYISEGTFDISN 1149
            P  YQ S +Y+                       F+ I ++ L + Y         ++  
Sbjct: 1126 PASYQNSVIYQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHE-YNTTSDCIILNLPY 1184

Query: 1150 DTKLQLNIDEFKKHSENSFSKHKTKNLTIDIVDEL----HEVRSFVFELPHINIDIHIDV 1205
                 LN D F     NS+       L+  I+ +      E  ++V +  +I+I I  ++
Sbjct: 1185 PDSTNLNSDSF-----NSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPEL 1239

Query: 1206 LEVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEY 1265
                  L         +  ID + + +V   S    G SS+   K+       R+  ++ 
Sbjct: 1240 FFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKI-------RILFFDV 1292

Query: 1266 YALEDVKHYFVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKEN 1325
            +       +   D   ++L L        ++ + EMN K+ +    + +L     L K N
Sbjct: 1293 F-------WGQRDTGGIELYL--------DTLDFEMNEKS-IEKNREKSLTEVTTLMKLN 1336

Query: 1326 FIYPSESSEFSYKSTFEE-------LEGYAFYD---DDLVTDANLQRGCVFINQEHSDSI 1375
             I  S ++++S   T  +       +EG  F+      ++    L      I++     +
Sbjct: 1337 SIRASVNAKYSRGKTEGQPPALSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWL 1396

Query: 1376 SEFIKTLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITR 1435
              F         + +K+    +      ++EL+ R+  A + Y I HDP VITKPA ITR
Sbjct: 1397 FNFFGDQKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITR 1456

Query: 1436 LSRHHVRESRSWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWR 1495
            LSR HVRE+RSW+I+TRLRH++ YLP  W ET + +L++ K+ + +DAK  F+ +F+ WR
Sbjct: 1457 LSRGHVRENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWR 1516

Query: 1496 SWEFADVERCFLYKKTYI 1513
            +WEF+DV R ++Y K ++
Sbjct: 1517 NWEFSDVARSYIYNKVFL 1534

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1204 (35%), Positives = 650/1204 (53%), Gaps = 73/1204 (6%)

Query: 1786 PFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGN 1845
            PF  R   K+ E      R      ++ D+ + L S   ++ Y + S   + ++G   G 
Sbjct: 1817 PFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNI-IVGYTNGR 1875

Query: 1846 TDN-LGRISLDSSFSKLSIFEPKKNMRLFLSD---IEQAVKNIEILRSTMLETKSSTVQN 1901
              N +  + + +S  KL+  EP + +  FL D   + ++VK +++L +      S    N
Sbjct: 1876 LVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLF---SSEPEIN 1932

Query: 1902 EFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSK-DKTSSNPVVPTFSSDY 1960
              P    I  +LN +++Y+G+L+   TT +V E + L  S +  D           S   
Sbjct: 1933 TIPAGAKIDWRLNADIKYLGILIPVSTTFFVFEMHTLLASLADVDYGEIYREADEASGQV 1992

Query: 1961 SSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRL 2020
            S ++I FLIKDR +  TLS+++D S +I  I+  + +  S QIES +L    SP SLVR+
Sbjct: 1993 SVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRI 2052

Query: 2021 LSFVNEFSIMKSIYHDIKPRSTSSNSTLSILP-----------------ISIKSAHILSY 2063
            L   ++   + S Y     R   S +    LP                 ++  S HILSY
Sbjct: 2053 LWGGHQLLALHSHY-----RRHHSKNLWDFLPKKEKKVEEDKTTSFFSTLTFGSCHILSY 2107

Query: 2064 NLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNE 2123
            N C+GWLF    + + GLI GY RLF+ Y+K  GKLTL+DA+FSV++G +S T+Y DGNE
Sbjct: 2108 NFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNE 2167

Query: 2124 KGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKK 2183
            +   NRS+LP++QI YWL+     KD+FIR++GE LDV+ L+ +  I++   QS+  F++
Sbjct: 2168 EDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQE 2227

Query: 2184 LKETILDPLK---------------VTSNDPILGEWNYLD------NPLASSVRSINCII 2222
            LK+ +++PL                    + + G+    D       P  S +R +NC  
Sbjct: 2228 LKKVLVNPLTQSEARSEEEEEESEEHNRRETVPGKEKKEDAPRKDIAPFLSDIRKVNCQF 2287

Query: 2223 NYAGSSMKLYSRDDIQHG-TCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNT 2281
             Y G   K+YS +DI+     SFEIRSP  T+ +DYK      K H IRTL TVN+THN 
Sbjct: 2288 KYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNV 2347

Query: 2282 LFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAE-INYRDLLEAFDIAVIINVG 2340
            LF  C PLL  +      M+K   S+         S  ++ I+Y+ LL +FDI   I   
Sbjct: 2348 LFARCAPLLMALSQDIQHMVKKHSSKKKPEPKQRVSRPSQNIDYKRLLNSFDILFKIISS 2407

Query: 2341 KQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXX 2400
            +Q++SL+CEP AK+QA +GF+ F   I TN +   EPL  ++ + N  ++ RH+FSRE  
Sbjct: 2408 EQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPS 2467

Query: 2401 XXXXXXXXXMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVND 2460
                     + F  TH   I+ +G+ LIS    YFNVKQ+++L LFL+IW +        
Sbjct: 2468 ASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLSNLLRPKP 2527

Query: 2461 IILAPVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNL 2520
            +        + ++ PS P    + +     W + LI + I  ++DLGPSLGL+ +     
Sbjct: 2528 MKKPEDHHVAIDAPPSSP----MDVGNIIPWCFTLIFANINGKVDLGPSLGLLSLSMRKA 2583

Query: 2521 WGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVEL 2580
            W  S H     Q L   + +I +++ GRL G V +   +W +++ WP  ++ +  PLV L
Sbjct: 2584 WFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNWPKYDDPY--PLVAL 2641

Query: 2581 SLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSL 2640
            S  +   + K++FDYHMF I T+ N    L +++D  GF+ DLL V ++ + I +  T+L
Sbjct: 2642 SFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTAL 2701

Query: 2641 AYANLFDIYSTIRRMRNDSGRTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQ 2699
              ANL D+Y+TI RMR D+  + L+ L ESN      + D   +L  L  ++T++ V+  
Sbjct: 2702 VAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDIN 2761

Query: 2700 LLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSF 2759
             LN+ I   +L   EV+V+    V AN K  A        K++T L  QL +   SLSS 
Sbjct: 2762 TLNVQISPISLFDVEVLVVNIANVCANVKTHAGE------KLETYLHLQLYNAHGSLSSS 2815

Query: 2760 KHQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGN 2819
            K ++DE+ + KI V DY+  AS I GG I + P + ++M+T+Q   S+++E  Y S+FG+
Sbjct: 2816 KGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGD 2875

Query: 2820 GVSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDE--DIEAKLAKVDLGTK 2877
             +++ WNL P+NFIK+MW+ HI A+ +R  Q    S +    DE  D+E ++   +  +K
Sbjct: 2876 KIAVRWNLGPVNFIKEMWTTHIKALAVRRSQ----SLVGTTGDEEGDVEKRMRDEETLSK 2931

Query: 2878 YIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYV 2937
              Y  +EEP I+ P+IKDLGDATP +EWFGLNR +FP  THQ V+VP+QKL   AEKEY 
Sbjct: 2932 LTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYA 2991

Query: 2938 RILG 2941
             I+G
Sbjct: 2992 NIVG 2995

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/1168 (39%), Positives = 707/1168 (60%), Gaps = 38/1168 (3%)

Query: 1798 INVDFGRILQSSLSL--QDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTDNLG-RISL 1854
            + V F +   SSL L  ++  ++LLS    + Y+K S S ++L        + +  ++ L
Sbjct: 1612 LTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQL 1671

Query: 1855 DSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKS----STVQNEFPFSRLIP 1910
            +S+ +K  + +P++ +     D+  A +N+E L+  +L   +     +   E     L P
Sbjct: 1672 ESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWP 1731

Query: 1911 IQL--NLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSSESICFL 1968
             +    L+++Y+GLL+  GTT Y+ E N L  S S D+ +     P    + S   I FL
Sbjct: 1732 REWLWQLDMKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFSF-PLVHGELSVAGISFL 1790

Query: 1969 IKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNE-- 2026
            I D+ + E LSKVL+F+ RIK+ + +  +++SLQIES++    L P SL+R+LS   E  
Sbjct: 1791 INDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLAYEAT 1850

Query: 2027 -FSIMKSIYHDIKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGY 2085
              S ++++  +   +S+        +  +  S  ILSY+ C+GW+F+    +N GL WGY
Sbjct: 1851 HLSGLQALKDNAGVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGY 1910

Query: 2086 ERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLPSMQINYWLEEEN 2145
            +RLFA ++KPYGKLTLLDAYF +A G +S+ +Y   +E    NRS LPSMQI YW E   
Sbjct: 1911 QRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNG 1970

Query: 2146 GTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKV---TSNDPILG 2202
               +LF+R+NGE LDVS L+    I     +SLH F++LK   LDP K        P   
Sbjct: 1971 SEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGS 2030

Query: 2203 EWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQHGTC-SFEIRSPAHTVTIDYKYYP 2261
             ++ L  P+ SS+  +NC + YAG   KLYS DDI+  T  SF++ SP+  V  +Y    
Sbjct: 2031 AFSKL--PILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKML 2088

Query: 2262 SKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASAKAE 2321
            + K+ H +R L +V+++HNTLFP CVP+++EM L    +LK+  ++ S   P  ++ +  
Sbjct: 2089 TGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKD-LNKSSVETPRTSNMQEG 2147

Query: 2322 INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLS 2381
            INYR LL+  DI+ ++N+ KQ+ISL+CEP AK+QA +GFEKF +K+FTN     EPL LS
Sbjct: 2148 INYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLS 2207

Query: 2382 VDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIE 2441
            +D+HN+ A+SRH+FSRE            VF LTH + IHTYG   I     YFN+KQ++
Sbjct: 2208 LDIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQ 2267

Query: 2442 DLNLFLEIWSIEKQ-----KSVNDIILAPVTASSFESVPSMPKLQRVPINATFSWDYLLI 2496
            DLN+F+ IW ++ +     +  N  ++ P         P   K ++V  N++F W++++I
Sbjct: 2268 DLNVFINIWKLDSKILSQPELDNKFVIGPTNLEK----PLTSKYKKVISNSSFPWNFVVI 2323

Query: 2497 ISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIK 2556
            +S I  EIDLG SLG++ + ++ +W ++ H  DWTQ L + + ++ +SS GRLGG   ++
Sbjct: 2324 LSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQ 2383

Query: 2557 DIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDE 2616
            +  W S+I WP+       PLV L++ L     KL+FDYH+  I++++  ++ LFN++D 
Sbjct: 2384 NFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDP 2443

Query: 2617 RGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLL-ESNELKKI 2675
            RG + +LLSVS+S D+ QVF+T+LA AN+FD+Y+TI RMR D+ ++ L+ L +SN     
Sbjct: 2444 RGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTK 2503

Query: 2676 SSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKT 2735
             S  + ++L+SL  LRTELSV  + +++ ++ +TL   EV+  + R     ++ E S K 
Sbjct: 2504 GSSSSHEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKL 2563

Query: 2736 TSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIF 2795
             +  K+      ++ ++ L+LS++K QL E    +I V +Y++ AS + GG IL  P+I 
Sbjct: 2564 KTQLKL------KVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAIL 2617

Query: 2796 VTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSS 2855
            + M TW    +N +ELLYS+SFG  + + WNL  INF+++MW+ H  AM LR    G S 
Sbjct: 2618 IGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSK 2677

Query: 2856 EIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPG 2915
                 +DE +  KL  VDLG +Y Y PLEEP+IE+P+ KDLG+ATPPVEWFG+NR +FPG
Sbjct: 2678 SFF--EDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPG 2735

Query: 2916 LTHQIVVVPLQKLSAVAEKEYVRILGKV 2943
            LTHQ V+VPLQKL+ +AE E+ RILG+ 
Sbjct: 2736 LTHQGVIVPLQKLAHLAESEWARILGRA 2763

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1345 (31%), Positives = 693/1345 (51%), Gaps = 83/1345 (6%)

Query: 207  AVPLYLDFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEF 266
            ++P +L  LP E  +  GA+++GNK T SV +  + +++G +D   P + +D YK++ + 
Sbjct: 21   SMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQS 80

Query: 267  ELSSTRVSVKPNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTG 326
            +++  ++S++PN+ + N    K      +   L  K  +  L      L+  G+K   T 
Sbjct: 81   DITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLS-RGSKTESTR 139

Query: 327  QE--EFLTSWKGLAMYDVATSDTFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGV 384
            ++    L  W+GL +Y       + D   F+L  HEYA+Y+ ++  + + + YS+DTPGV
Sbjct: 140  KDLRNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGV 199

Query: 385  I------TETLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSR 438
            +      T   + G + G+    P++S+D+Q++ AN +YGPWAH ++    K+FSP VSR
Sbjct: 200  VPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSR 259

Query: 439  DFSAHRKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGW 498
            D     +   G +R     R  I+IM DS+WRIPT+EPSKD  FL +YK T D++R FGW
Sbjct: 260  DSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGW 319

Query: 499  IDIKLNKDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSY 558
            +++ L + + + + + +  +  GF+N    + + P I TSVNHD+L +A+ H I A+  Y
Sbjct: 320  LELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGY 379

Query: 559  PHQWNSAITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDI 618
            P  WN+   W     S    +FIL+DH  LL D+ +DF +GD  PY+LFRP +Y+F+W++
Sbjct: 380  PLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWEL 439

Query: 619  SNYSLYLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPK 678
            + YS+YLN NDANIVNNP+DFNENCY+S HG+  RI  ++P                 P 
Sbjct: 440  TGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPL 499

Query: 679  FDIQLKTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFL 738
            F + + TP W+TLHEFM  + VGR+ +FS +GSYL +            +ECK+   T  
Sbjct: 500  FRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLK 559

Query: 739  AYGFLLRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTTELVEPNS 798
             YG+++R+++ +K+NYFG+F  F+TTEEY EEL    D   +   N+  +Q+    E  +
Sbjct: 560  CYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEEL---RDAYVEPKANS--EQSANSTETTT 614

Query: 799  YGESGFDILHGKK--------IDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCF 850
             GE G D  +  K          K SLKR VNEKD+W TF  EDGC +LP++ YD  +CF
Sbjct: 615  AGE-GEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACF 673

Query: 851  GLHFDNITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSE 910
               FD++  D+RY++YY DL  +++   ++   D     +F          +N+ G +S+
Sbjct: 674  AFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSRANF-GSISD 732

Query: 911  FNIHIHRMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLH 970
             +IH HRMFGLPP EETY  K D S+G L   SD+  +  F    +K +F F ++E++++
Sbjct: 733  LHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMN 792

Query: 971  YEMARSFDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIP 1030
            Y++    D++ + F A +I +++N++  + +I + + NV+ + +DF   +YS RA++DI 
Sbjct: 793  YKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIH 852

Query: 1031 NFDFLVSSMDDHNIVLGXXXXXXXXXXXXRNPDFKTTNNLQTQHILLSDAPFCRCSFLHP 1090
            +    V        ++G            +  +F   +  Q  HI  +DAPF RCSFL P
Sbjct: 853  SITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLP 912

Query: 1091 QEYQTSDLYKXXXXXXXXXXXXXXXXXXXXXNNFDTIFENLLGDIYQDYISEGTFDISND 1150
               Q SD Y+                              LLG I       G  +    
Sbjct: 913  LAIQRSDNYR-----------------------------KLLGSIVPGVSIPGMVEPITP 943

Query: 1151 TKLQLNIDEFKKHSENSF--------SKHKTKNLTIDIVDELH---------EVRSFVFE 1193
              + + +DEF K  +NS         SK +      +    L          E  S V +
Sbjct: 944  ENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGYAFNFASGLMSSTENDSNVESESLVVK 1003

Query: 1194 LPHINIDIHIDVLEVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVC 1253
            L      I    ++ F     Q  +  +   ID   +++V +F +T          KV  
Sbjct: 1004 LIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFS 1063

Query: 1254 PRIDFRLRMYEYYALEDVKHYFVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKT 1313
            P  +  L  +    +          I ++ +++ +R+E          NS  K +V   T
Sbjct: 1064 PTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREE-------PSPNSSEKSTVQDIT 1116

Query: 1314 ALINGKMLS------KENFIYPSESSEFSYKSTFEELEGYAFYDDDLVTDANLQRGCVFI 1367
            AL+  + L+        N    +   +    ++ ++LE +   +D   +  N      ++
Sbjct: 1117 ALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWV 1176

Query: 1368 NQEHSDSISEFIKTLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVI 1427
            + + ++    F+K      +T  + V++ K   +  +R+   RI+ A  +Y I HDPPVI
Sbjct: 1177 HSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVI 1236

Query: 1428 TKPAVITRLSRHHVRESRSWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQF 1487
            TKPA ITRL   HVRE++SW+I+TRLRH+LNYLP          L+   F +  +A   F
Sbjct: 1237 TKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIF 1296

Query: 1488 LDIFTRWRSWEFADVERCFLYKKTY 1512
            L+IF++WRSWE +DVE+C++Y+K +
Sbjct: 1297 LNIFSKWRSWESSDVEQCYMYRKAF 1321

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1579 (31%), Positives = 792/1579 (50%), Gaps = 100/1579 (6%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            M+  ++F +I +  E+ F WVFL  W    + ++   FYL R  G I T IL+W IWK+Y
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLK------ 114
            KV INI+S+  S +GG V+ KN+SI ++D T+S L+    WRYWLLN R  + K      
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 115  ----------NSNINDENSK--CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRK 162
                      NS   ++NSK  C   +EC G E+F+YN+ A YE++L    K +++    
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 163  FATDDE--SIFGRVKTDSSVMFDPLDESSEQSKVGQTILNSVS----NQSAVPLYLDFLP 216
            F  + +   I       +S+  D  +  + ++    T++N  +          +  +FLP
Sbjct: 181  FLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSILFNFLP 240

Query: 217  AEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVK 276
             ++ L  GAV +GN+ TPS+ +  Y    G++DV+     +D YK +   +     +SVK
Sbjct: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300

Query: 277  PNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFT---ISHILAFTGNKKGLTGQEEFLTS 333
            PN+++ +  +++     GK   +W    D +       + I      KK    +  F+  
Sbjct: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360

Query: 334  WKGLAMYDVATSDTFS---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVIT---- 386
            W+GL++Y     D      DE  +D  N EYAK+++IL      L Y  D+PG++     
Sbjct: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420

Query: 387  ETLIK--GYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHR 444
            +T +K  G + G+    PE+ +D+Q+  A+ YYGPW +RQ+ Y I+M SP VS++    +
Sbjct: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480

Query: 445  KPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLN 504
            K   G  R H  F+  + I+++S WRIPT+EPSKD  F+ ++  TND+ R FGW+D  LN
Sbjct: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540

Query: 505  KDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNS 564
            K T  +    L  +  G  N F  + ++  + TSVNHD+L  +K   ++A   YP  WNS
Sbjct: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600

Query: 565  AITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLY 624
               W    I+  LE F+L++H +L  D+F+DFAS D  PYELFRP  Y  +WDI  YS+Y
Sbjct: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660

Query: 625  LNANDANIVNNPLDFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLK 684
            LN ND NIVNNPLDFNENCY+S+HG+   I   +P                 P F + L 
Sbjct: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720

Query: 685  TPPWHTLHEFMAQRFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLL 744
            TPPW+TL EFM  + VGR+ +F   GSYL Y            +EC +   T   YG ++
Sbjct: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780

Query: 745  RYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTTELVEPNSYGESGF 804
            RY+MN++ NYFG+F  F T+EEYSE L + N        +ND+  +      +S   S  
Sbjct: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNK------RSNDEQGSFTYSTTSSVQNSSS 834

Query: 805  D--ILHGKKID-------KASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFD 855
            D  +L+ K+ D       +A + RT NE DIW TF   DG  +LPE  Y+   C  L F 
Sbjct: 835  DDTVLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFS 894

Query: 856  NITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHI 915
             +    R  +YY D   ++    I R+ + S + +F          +   G LS+  IH 
Sbjct: 895  ELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHA 954

Query: 916  HRMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMAR 975
            HRMFGLPP + TY  +  +  G L  +S+IE L  F    TK  FG+ N E+ L Y++  
Sbjct: 955  HRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVES 1014

Query: 976  SFDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFL 1035
            S D++ L+ + + + I +++  + K  SL I  + L  +DF   +YS R N+ IP F   
Sbjct: 1015 SDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFS-- 1072

Query: 1036 VSSMDDHN-----IVLGXXXXXXXXXXXXRNPDFKTTNNLQTQHILLSDAPFCRCSFLHP 1090
            +S  D  N     I+LG            +  DF+ + N Q  +I L D+P+ RC F+ P
Sbjct: 1073 ISIFDVRNPTIKPILLGFKTKIDFTNFVIKE-DFRNSLNGQRTYITLHDSPYHRCFFILP 1131

Query: 1091 QEYQTSDLYKXXXXXXXXXXXXXXXXXXXXXNNFDTIFENLLGDIYQDYISEGTFDISND 1150
              YQ S LY                      N  D + E+ L + Y D +     +I + 
Sbjct: 1132 TMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKE-YSDLLENPFLNIRSI 1190

Query: 1151 TKLQLN--IDEFKKH---SENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDV 1205
              L  +   +E++     SE +  K + KN T++  D  +E  +++  + +I +DI+   
Sbjct: 1191 NNLDTSSLFNEYRVDTYISEKAIFKAEEKN-TVN-YDPKYEYDNYILNVEYIRVDIN--- 1245

Query: 1206 LEVFADLYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSV----TEAKVVCPRIDFRLR 1261
              +F+D    ++T   S+ +  +  +I     +       V    T  K+    +D    
Sbjct: 1246 -PLFSDFIDSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDI--- 1301

Query: 1262 MYEYYALEDVKHYFVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKML 1321
             +     E ++ Y    ++KLD  +R R            +  N+ S+  +T L   K+ 
Sbjct: 1302 FWGSRNSEGIEIY----LDKLDFEMRQRI----------FDDFNQRSLEERTIL--SKLK 1345

Query: 1322 SKENFIYPSESSEFSYKS------TFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSI 1375
            S       ++  E  Y+       T E LE ++  +       N+    + ++   +  +
Sbjct: 1346 SLRCSFSETQYEEIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWL 1405

Query: 1376 SEFIKTLYLKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITR 1435
             +++      F     SV + +  + ++++ L+ ++  A + Y I HDP VITKPA+I R
Sbjct: 1406 IKYLNKQVEFFYNLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMR 1465

Query: 1436 LSRHHVRESRSWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWR 1495
            LS  HVRE+RSWRIVTRLRH+LNYLP+ W +++   ++     S+ D K  FL +F+ WR
Sbjct: 1466 LSNSHVRENRSWRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWR 1525

Query: 1496 SWEFADVERCFLYKKTYIP 1514
            +WE +DV R ++Y++ ++P
Sbjct: 1526 NWEVSDVARSYIYRRVFLP 1544

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1198 (33%), Positives = 635/1198 (53%), Gaps = 66/1198 (5%)

Query: 1786 PFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGN 1845
            PF +++S KE +I  +      +  S+ D  + L S +    Y + S+  + L  M   +
Sbjct: 1820 PFTVKHSMKELKIVFNREGDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDS 1879

Query: 1846 TDNLGRISLDSSFSKLSIFEPKKNMRLFLSD---IEQAVKNIEILR---STMLETKSSTV 1899
               L  I++ +S  KL++ +PKK     L D    EQ++++I+ L    S+  E ++S V
Sbjct: 1880 KSKLITINIVTSLIKLTLADPKKITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRTSAV 1939

Query: 1900 QNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSD 1959
             N + F       +N ++ Y GLL    T+ ++LE ++L  +FS    +   +    + +
Sbjct: 1940 DNPYKF------MVNFDLTYFGLLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCN 1993

Query: 1960 YSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVR 2019
             + ++  F+IK   V   +SKVLDFS+ +      L + +S ++ESS+    L+P SL++
Sbjct: 1994 LALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLK 2053

Query: 2020 LLSFVNEFSIMKSIYHD--------IKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLF 2071
            +L  V + S     Y +         K +++  +  L   P+   S H LSYN CIGW+F
Sbjct: 2054 ILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVSENLIGAPLIEYSIHFLSYNFCIGWIF 2113

Query: 2072 DLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSY 2131
            +   ++  GLI GY+RLF+ Y+  YGKLT++D +FS+A+GFSS T+Y  GNEK   NRSY
Sbjct: 2114 ENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSY 2173

Query: 2132 LPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDP 2191
            LP++QI YWL+E +  K LF+R  GE +DV  L+ + TI++   +S+  F+ +K+  +  
Sbjct: 2174 LPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVRE 2233

Query: 2192 LKVTSNDPILGEWNYLD--NPLASSVRSINCIINYAGSSMKLY----SRDDIQHGTCSFE 2245
            + V +   + GE +     +   S V+ INC   Y G    +Y    +  D +H   + E
Sbjct: 2234 MNVEAEKKV-GEDDISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEH---AIE 2289

Query: 2246 IRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSC 2305
            I +P   + +DYKY    KK HWIR+   +  T+NTL       L E   + + M+    
Sbjct: 2290 ITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFS 2349

Query: 2306 SQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDI 2365
             +    AP   S    I+Y+ +LE FD++  I+ GKQ++SL+CEP AK+ A +GFE F  
Sbjct: 2350 PKEQPPAPKTVSPP--IDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVF 2407

Query: 2366 KIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTYGS 2425
             I TN   P EPL  S+ ++++  S  H FS E           +    TH +    YG+
Sbjct: 2408 SIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPD---IYGT 2464

Query: 2426 TLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVNDIILAPVTASSFESVPSMPKLQRVPI 2485
            TLIS    YFN+KQ+++L +FL+IW++++   +      PV         S        I
Sbjct: 2465 TLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKSVPVKKPESRVSSSTKSSSNTTI 2524

Query: 2486 NATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSS 2545
                 W + +II++I  +I LGPSLG + +K    W  ++H  D  + L      + ++S
Sbjct: 2525 ---IPWSFTVIITDINGDIHLGPSLGNLSLKLKKNWISTNHFQDRRKALRFFTDSLSLTS 2581

Query: 2546 SGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQN 2605
             GRLGG + + +I W   + +         PLV+++L +     K +FDYHMF I  + N
Sbjct: 2582 VGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHN 2641

Query: 2606 AAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLD 2665
                L +++D  G L DLL + +  D I +  T+L  +N+ DI +TI R R DS  + ++
Sbjct: 2642 ILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIE 2701

Query: 2666 -LLESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVI 2724
             LLESN   + SS   + +L SL  LRT++ +    + + I   +L   EV+V     V 
Sbjct: 2702 TLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENV- 2760

Query: 2725 ANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIH 2784
                  A S T S  K+ T+L  ++   +LSLS    +LDE  + +I V DY+  A  + 
Sbjct: 2761 -----SARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLS 2815

Query: 2785 GGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAM 2844
            GG IL  P +FV M TWQ + S +IE L++  F + +S+ WNL P+NFIK++W+ H+ ++
Sbjct: 2816 GGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSL 2875

Query: 2845 KLRHMQ-KGNSSEIHIP----------KDEDIEAKLAKVDLG----------TKYIYKPL 2883
             +R  Q KG+     +P            E++E   ++               K+IY PL
Sbjct: 2876 AVRRAQLKGDKEPQLVPGIIGEPSPLVSSEELEMLRSESSNADNDNNEYSEEDKFIYVPL 2935

Query: 2884 EEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILG 2941
            +EP IEMPKIKDL DATPP+EWFG+NR +FP +THQ  ++ +QK+  VA+KEY ++LG
Sbjct: 2936 KEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLG 2993

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1555 (31%), Positives = 778/1555 (50%), Gaps = 95/1555 (6%)

Query: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60
            MD  + F  I +  E+     FLV+W   +++ +   FYL R + +++TK L++ +W++Y
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLK-NSNIN 119
            K+ IN+QS+  S +GG+++FKN+++   D TIS L+G+FTWRYWLL+ R   +   S   
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120

Query: 120  D--ENSK--CRFKLECDGVELFIYNKIAVYEDILNE-LAKSDKDSSRKFATDDESIFGRV 174
            D  EN+K  CRF L+CDG+E+F+YNKI VYE +L +      KD     + DD +I    
Sbjct: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVLRDHFTNVTKDGQETESNDDITINTEK 180

Query: 175  KTDSSVMFDPLDESSEQSKVGQTILNSVSNQSAVPLYLDFLPAEVILSSGAVVVGNKHTP 234
               +S +       S  S+   +  +  ++   +       P ++  +  A+V+GN++T 
Sbjct: 181  AAANSKL-------SNSSRYSYSGRSKSTDAPKLSAKTKLFPIQLEANRAAIVLGNRNTR 233

Query: 235  SVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKIDG 294
             V + ++ + +G+ D+    S+LD Y+ +   +L      ++ N+ + N +  K   ++ 
Sbjct: 234  HVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVVEK 293

Query: 295  KPFNLWQKLK-DCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTFSDEIP 353
                +WQ +K  C+  +IS +L      K +  Q+ ++ SWKGL +Y    +    +   
Sbjct: 294  TMDKIWQTVKKQCI--SISKLL-LPNQGKTINNQQAYIDSWKGLDLYHHTKAVQEENVDT 350

Query: 354  FDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETLIKGYENGDIPPS---------PEY 404
              L   EYA+Y+ ++ A+R+ L Y +D PG++           D   S         P +
Sbjct: 351  TVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPAF 410

Query: 405  SIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCEIVIM 464
              D+ +Y A  YYGPWAH+ +Q  I++FSP VSRD     KP  G  R + NF+  +   
Sbjct: 411  GTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFR 470

Query: 465  EDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASECGFEN 524
            + SV  IPT+E SKD  F+ +YK+T D  RAFGW+++ LN+   I   L L +      N
Sbjct: 471  DKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPN 530

Query: 525  TFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELFILRD 584
              +  L+NP I +SVNH+VLF      I A   YP  WN    W     S   ELF+LRD
Sbjct: 531  ELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRD 590

Query: 585  HFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFNENCY 644
            H +L+ DLFTDF++ DA+ YELFRP  Y+  W  + Y L+LN NDANI+NN LD NENC+
Sbjct: 591  HISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFLNVNDANIINNLLDLNENCF 650

Query: 645  ISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEFMAQRFVGRSH 704
            +S+ G+     + LP                 P   + +  P W+TLHEF+++   G   
Sbjct: 651  LSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECP 710

Query: 705  EFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQFRTT 764
            +FS +G+Y+S+            ++ +++   FL++GF+LRY+MN+KLNYFG+F  F+TT
Sbjct: 711  DFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTT 770

Query: 765  EEYSEELAQRNDVATDIFN-----NNDDDQTTELVEPNSYGESGFDILHGKKIDKASLKR 819
            EEYS +L+   D  T   N      ND +  T      SY  +  D ++   I K+SL R
Sbjct: 771  EEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVA--DTINENTIHKSSLLR 828

Query: 820  TVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYI 879
            T NE D+W+TFF  DGC ++PE+ YD +  F L F  + FDMRY +Y+ DL    +  Y+
Sbjct: 829  TKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSRIYL 888

Query: 880  KRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYL 939
                + S N V  +  S+    S   GYL + N+H HRMFG+PP EETYL K D+S+G L
Sbjct: 889  NHSNEFSFNRVVAIEESH----SENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSL 944

Query: 940  SFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDIS--IRLNNID 997
            S +SD + L  F++ I K  F + + E++L Y + +  D++ L+     +S  +R N+  
Sbjct: 945  STDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIVRTNHGG 1004

Query: 998  TNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHNIVLGXXXXXXXXXX 1057
            +    +LS+ ++++   D   S+YS R ++ +      V ++D+   VL           
Sbjct: 1005 S---ATLSLNDITINSWDLSNSRYSKRVDLLVAAIS--VCAIDEKKTVLFTCDTAVELTK 1059

Query: 1058 XXRNPDFKTTNNLQTQHILLSDAPFCRCSFLHP-QEYQTSDLYKXXXXXXXXXXXXXXXX 1116
                 + K     Q   +LL+D+PF RC FL    +   S LY                 
Sbjct: 1060 FVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLS 1119

Query: 1117 XXXXXNNFDTIFENLLGDIYQDYISEGTFDIS-NDTKLQLNIDEFKKHSENSFSKHKTKN 1175
                   FD I+E LLG     YI+   FD    DTK   N+ + +   +       T  
Sbjct: 1120 EPLTFQTFDNIYERLLG----SYINLINFDTDIIDTK---NLTDDRPDDKRLLPLSNT-- 1170

Query: 1176 LTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFA---------DLYRQLTTFTISDTID 1226
            ++ D+  +L E      E    N  ++I  L VF          +    + T +    +D
Sbjct: 1171 VSNDLSGQLAE------EFESENTTVNISTLSVFVTPKAFTFAENAAHFMLTMSTESIMD 1224

Query: 1227 GLGVDIVNNFS------KTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDIN 1280
               ++IVN FS        FF +S + +   V    +  L   +  AL+ ++   VS+I+
Sbjct: 1225 YFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETALDKTQLEALDRLE-LSVSNIS 1283

Query: 1281 KLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSEFSYKST 1340
             +   L+  Q  ++ + ++ +   + +S  + +   N         I+ S  +  +    
Sbjct: 1284 VISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFN---------IFKSSKNRLTKVLP 1334

Query: 1341 FEELEGYAFYDDDLVTDANLQRGCVF--INQEHSDSISEFIKTLYLKF-NTFIK----SV 1393
                E   F +  L +D       +F  I     D+  E+     LK    F K     +
Sbjct: 1335 IAWFEILMF-NTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKAFCKEGKSCI 1393

Query: 1394 TISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRL 1453
             + K  +  MK E +IR+A+ G+  GI   P +ITKPA ITRLS+ HVR++ SW+I+TRL
Sbjct: 1394 ELGKLRSIDMK-ETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWKIITRL 1452

Query: 1454 RHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLY 1508
            RHV  +       T+  +    + R+    K QFLDIF  W++W+  +VE+  L+
Sbjct: 1453 RHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYEVEQSSLF 1507

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1182 (37%), Positives = 671/1182 (56%), Gaps = 69/1182 (5%)

Query: 1786 PFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEF---QEPYMKYSHSYLKLIGMD 1842
            PFI+R         +DF     S +S+     ELL L+F   Q   ++ S+S  K   +D
Sbjct: 1779 PFIIRILIS----GLDFNFKNLSGISIIVNYTELL-LDFYFNQLKLLRISNSVTK---VD 1830

Query: 1843 LGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLET-KSSTVQN 1901
              +   L  I LD+   KL++     + R++   IE+   ++    S +++  K+    N
Sbjct: 1831 YRSNTLLTDIGLDTDIVKLTL----SDNRVY---IEELTDSLNGTVSELIKIFKNKNADN 1883

Query: 1902 EFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYS 1961
            E    +  P    +N  YIGLL D  TT YVLEFN   FS +   + +  +  T ++D  
Sbjct: 1884 EPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCA---SRAEALEETHANDNL 1940

Query: 1962 SE------SICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPM 2015
             E      ++C L+ +  V  TLSK+ D    +K+I   +   ++LQIE+ +   +L+P 
Sbjct: 1941 REMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIEDDIK--KTLQIETPHSRVMLAPS 1998

Query: 2016 SLVRLLSFVNEFSI-MKSIYHDIKPRSTSSNSTLSILP-ISIKSAHILSYNLCIGWLFDL 2073
            +L+ ++ F+ E  + ++ +    K +  SS++ + I P     S +ILS  LC+GW+F+ 
Sbjct: 1999 TLIAVIFFIQEAKVSLQKVKQ--KGKFNSSSNAIEIPPYFETLSVNILSNKLCLGWIFEE 2056

Query: 2074 GYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLP 2133
              + N G++ GYE LFA Y+KPYGKLT++D Y + A G  S+ ++   N    +NRS+L 
Sbjct: 2057 DTDEN-GIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFF-ANGVPELNRSHLS 2114

Query: 2134 SMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLK 2193
            SMQIN+W   +   KDLF+R+N ++LDV +L     IV+    S+  F+K    I +  K
Sbjct: 2115 SMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQKKLAKISNIKK 2174

Query: 2194 VTSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQHGT--CSFEIRSPAH 2251
             + +   + E N  D     S+RSINCI  Y G  + LY+ DDI   +   S E+ SP+ 
Sbjct: 2175 SSISTHNVAE-NLSDKVSILSIRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSI 2233

Query: 2252 TVTIDYKY-YPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSN 2310
             V++DY + +PS+K+ HWIR+L  V +THN LF  CVP+L    +   T ++    +F++
Sbjct: 2234 EVSLDYMHNFPSQKQ-HWIRSLVNVESTHNILFSSCVPVL----VNLTTEIQKQMERFNS 2288

Query: 2311 GAPNLASAKAE---------INYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFE 2361
                L     E          +Y++L +  D A++INVG Q I+LTCEP AKIQA +GF 
Sbjct: 2289 EKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFS 2348

Query: 2362 KFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIH 2421
             F I +FT+S    EPL LS+    +  S+RH+FSRE           + F LTH   I 
Sbjct: 2349 NFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIK 2408

Query: 2422 TYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVNDIILAPVTASSFESVPSMPKLQ 2481
            TYG+TLIS   FY N+KQ++++ LFL+IWS  K K    +   P +    +     P+  
Sbjct: 2409 TYGNTLISDMKFYVNMKQLQEITLFLDIWS-PKTKKAQKLGSGPHSGQKCQ-----PQAL 2462

Query: 2482 RVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEI 2541
                     W Y +I     A ID+ PSLG +  K    W  S H +DW+  +   + E+
Sbjct: 2463 TEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDEL 2522

Query: 2542 CMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFIS 2601
               S GRLGG   IK+I + S I+WP+ +N    PL+ L+  +   ++K+ FDYH F I+
Sbjct: 2523 NSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIA 2582

Query: 2602 TIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGR 2661
             + +  + + N++DE G L DLL VS+S  ++ +F+T+LA ANL+DIY+T  RMR ++ +
Sbjct: 2583 RVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKK 2642

Query: 2662 TNLDLL-ESN-ELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLR 2719
            + +  L ESN E      F N+++LA L  LRT L+       L++F +TL  +EV+VL+
Sbjct: 2643 SYVQTLKESNPESSGKIHFSNNELLAPL-RLRTNLTAEIGSFRLYVFPSTLFDSEVLVLK 2701

Query: 2720 TRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKL 2779
              K+         + T ++ K +T+LTWQ++D+++SL+ FK++L E Q  ++ V +Y + 
Sbjct: 2702 ANKM------NVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQ 2755

Query: 2780 ASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSI 2839
            A+++ G IIL APS+FV + TWQ      IE LYSSSFG+ V I WNL PINFI++MW+ 
Sbjct: 2756 AALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWAT 2815

Query: 2840 HINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDA 2899
            H+ A+ +R      S      +DE+I  K+  V+LGTKY Y PLEEP+IEMP ++DLG+A
Sbjct: 2816 HVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNA 2875

Query: 2900 TPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILG 2941
            TPP+EWFG+NR RFPG+ HQ++VVPLQKL  VAE +Y R LG
Sbjct: 2876 TPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/1183 (33%), Positives = 632/1183 (53%), Gaps = 48/1183 (4%)

Query: 1786 PFILRYSCKEFEI----NVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGM 1841
            PF LRY  K+ ++    N D G IL   LSL DT + + S   +E Y ++S+  +++   
Sbjct: 1983 PFYLRYETKQLDLYFNQNGD-GEIL---LSLWDTDIFVTSHHTKEQYFRFSYDDIQINCN 2038

Query: 1842 DLGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLETKSSTVQN 1901
             +   + +  +SL +S  KL+  EP++    FL D    +++ + L+  + +   S  +N
Sbjct: 2039 PMSEKNKVLVVSLSASLVKLTFSEPRRIFASFLQDERITIESFQELKK-LKKIFFSNAKN 2097

Query: 1902 EFPFSRLIPIQ-------LNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVP 1954
                +  +P +       L LN+ Y G+LL   +T +VLE + L  S +        V  
Sbjct: 2098 VKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVLELHMLLGSLTNTTEEIQEVNN 2157

Query: 1955 TFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSP 2014
              S   S E+I FLI DR +   LSK++DFS+RI  ++ +  + +SLQIESS+     SP
Sbjct: 2158 QISGQISLENILFLINDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIESSHFRMCFSP 2217

Query: 2015 MSLVRLLSFVNEFSIMKSIYHDIKPR--------STSSNSTLSILPIS-IKSAHILSYNL 2065
             SLV +L  V +       Y D K +         T + S+ S  P++  +S HILSYN 
Sbjct: 2218 ESLVFVLWGVKQLQNELEYYKDHKTKRQWNLSSHKTGTKSSTSESPLNYFRSIHILSYNF 2277

Query: 2066 CIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKG 2125
            CIGW+         G ++GY+RLF+ Y+K YGKLTL++ Y SV +  SS+ ++  G EK 
Sbjct: 2278 CIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKN 2337

Query: 2126 AMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLK 2185
              NRS+LPSMQI YWL+E N  KDLFIR++G+ LDV +L+ +  I++   +S   F+  +
Sbjct: 2338 RHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFR 2397

Query: 2186 ET-ILDPLKVTSNDPILGEWNYLD--NPLASSVRSINCIINYAGSSMKLYSRDDIQ-HGT 2241
            ++ I+  ++   +   +   N  +      S + SINC   Y G +++++S DD++   T
Sbjct: 2398 KSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDST 2457

Query: 2242 CSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTML 2301
             S E+ +P  ++ ++YK++    K HW+R +  ++++HN L+  C P + E   +   +L
Sbjct: 2458 PSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCAPFVIEFVESIQEIL 2517

Query: 2302 KNSCSQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFE 2361
            +N   +       +A+      Y+ +L  FDIA  I   KQ +S +CEP+AK+QA +G +
Sbjct: 2518 ENRPVEPKQSVSKIATPNR--TYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLD 2575

Query: 2362 KFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIH 2421
             F   I T     ++PL L++ ++ +  S +H+FS+E           + F  T      
Sbjct: 2576 SFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPTL-- 2633

Query: 2422 TYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSV--NDIILAPVTASSFESVPSMPK 2479
             Y   LIS    +FN+KQ ++L LFL+IW + +   +  N              +P  P+
Sbjct: 2634 -YCVGLISDIDIFFNMKQQQNLLLFLDIWHLSESIGIRPNRKKRKHKKHKGHTQIPETPQ 2692

Query: 2480 LQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMK 2539
              ++       W++ +I + + A+I LGP+LG+V  K +  W +S   +D  Q L +   
Sbjct: 2693 PGKI-----IPWNFNIIFTNVNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTD 2747

Query: 2540 EICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFF 2599
             + + S GRL G + I +  W+ ++ +      +  P+V + + +G    K +FDYHMF 
Sbjct: 2748 GMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFM 2807

Query: 2600 ISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDS 2659
            IS + N    L +++D  G L DLL  ++  + I +  T+L  +N+ DIY+TI R R D+
Sbjct: 2808 ISKVNNIHFRLHSERDPEGKLPDLLLTTLLCEEISICSTTLVASNILDIYNTIIRTRQDT 2867

Query: 2660 GRTNLD-LLESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVL 2718
              +  + L+ESN     ++   S +L SL  LRT++ ++   L L I   +L   EV+V+
Sbjct: 2868 KNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVI 2927

Query: 2719 RTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVK 2778
                +       A S+TTS  K++T L  Q+ + S++LS+ K +LDE  ++KI V DY+ 
Sbjct: 2928 NIDNM------SARSETTSTDKLKTRLELQVCNASVALSTAKEELDEESVNKISVADYMT 2981

Query: 2779 LASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWS 2838
             AS I GG IL  P + V M TWQ   SN IE  ++  F   VS+ WNL P+NFIK+MW+
Sbjct: 2982 YASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWA 3041

Query: 2839 IHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGD 2898
             H+ ++ +R  +     E    + E     +       K+ Y  L EP+IEMP+IKDL D
Sbjct: 3042 THVKSLAVRQARIEEPVEYSSEELESSPESIYLEPAQPKFTYVALVEPSIEMPQIKDLED 3101

Query: 2899 ATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILG 2941
            ATPP+EWFGLNR +FP  THQ  V+ +QKL    EKEY +I+G
Sbjct: 3102 ATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIG 3144

 Score =  581 bits (1497), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 356/1148 (31%), Positives = 565/1148 (49%), Gaps = 56/1148 (4%)

Query: 397  DIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHAN 456
            +I   PE +++ QL+DA+  YGPWAHR +    ++FSP VSR       P  G  R +  
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 457  FRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQ 516
             +  + IMEDS WR+PT+EPSKD  FL +Y  TND SR+FGW D+  ++++  +  +   
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 517  ASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSD 576
                G+ N  + +  +  + +SVNHD+ F +K++++ +   YP  WN  +TW+  F S  
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 577  LELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNP 636
            LE F LR+H  L+ D F+DF+SG+  PYE FRP +Y+  W+   YS YLN ND NI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 637  LDFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQLKTPPWHTLHEFMA 696
            LDFNENCYIS+HG+ A IGV++P                 P F + L TPPW+TL+EFM 
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 697  QRFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFLLRYVMNLKLNYFG 756
             + +GR ++F+A GSY+ Y            +EC T   T L YGF++ Y++N+++NYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 757  EFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTTELVE--------------------P 796
            EF+ F T EEY           TDI   ND+D  + L +                     
Sbjct: 950  EFSHFITAEEY-----------TDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPD 998

Query: 797  NSYGESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDN 856
            NS   +  D L+   + K  +KR VNE DIW TF   +G  +LPE  Y+   C  L F  
Sbjct: 999  NSSKSNIIDPLYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKE 1058

Query: 857  ITFDMRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIH 916
            +  D R   YY DL  ++N T  KR    + N +F++  +N        G +S  +IH H
Sbjct: 1059 LIIDFRNCDYYLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGH 1118

Query: 917  RMFGLPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARS 976
            RM+G PP   +Y     V +  LS  SDI  ++GFI +ITK  F F N +++L Y+ +  
Sbjct: 1119 RMYGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVL 1178

Query: 977  FDISCLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLV 1036
             +++ ++     I I + +  T+  + L++  ++   ++F   +YS R ++ +P   F  
Sbjct: 1179 DNMTSVTVHGTGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAF 1238

Query: 1037 ----SSMDDHNIVLGXXXXXXXXXXXXRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQE 1092
                SSMD     L             +  D +  +  Q + I L+D+ F RCSFL    
Sbjct: 1239 FDNGSSMD--KTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPH 1296

Query: 1093 YQTSDLYKXXXXXXXXXXXXXXXXXXXXXNNFDTIFENLLGDIYQDYISEGTFDISNDTK 1152
             Q S LY                           I ++ LG  +    +E    IS  T 
Sbjct: 1297 IQESLLYHELYGGITPSSSVPPLPIPVQAETIAFIIDDFLGP-FGINSTELLGSISTSTP 1355

Query: 1153 LQLNIDEFKKHSENSFSKHKTKNLTIDIVDELHEVR-SFVFELPHINIDIHIDVLEVFAD 1211
            +  +    K  S +    H  +++   +V        +++ ++ +I +DI+       ++
Sbjct: 1356 IHSSNKPLKPPSSSVI--HPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASN 1413

Query: 1212 LYRQLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDV 1271
               +  +  I +TIDG+ + IVN          SVT  K+    +DF         LE  
Sbjct: 1414 FLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLE-- 1471

Query: 1272 KHYFVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYK-TALINGKMLSKENFIYPS 1330
               +V  I     +L + Q+  ++ +   ++    LS +    A IN K + ++    P 
Sbjct: 1472 --LYVDQI-----DLEVSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPP 1524

Query: 1331 ESSEFSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFI 1390
              S        E  EG++      V   N+    + +++   + + +++  L +  +  +
Sbjct: 1525 ALS-----LALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELV 1579

Query: 1391 KSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIV 1450
             S+   +  +  ++++L+  +  A + Y I HDP VITKPA + R+S+ HVR++RSWRIV
Sbjct: 1580 NSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIV 1639

Query: 1451 TRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKK 1510
            TRLRH+  YLP  W      E++        D+   FL +F+ WR+WE +DV R ++YKK
Sbjct: 1640 TRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKK 1699

Query: 1511 TYIPAEVT 1518
             ++  + T
Sbjct: 1700 IFLSNDET 1707

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 98/173 (56%), Gaps = 13/173 (7%)

Query: 4   QTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYKVV 63
           + +F ++ +  E+ F WVFLV W    ++ +   FY+ R   Y +T IL+W++W+ YKV 
Sbjct: 4   EPKFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVK 63

Query: 64  INIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLK--------- 114
           I+ +S+  S++  ++ FKN+ I   + TISIL+G   W+YWLLN R +  +         
Sbjct: 64  IHCESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHG 123

Query: 115 ----NSNINDENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKF 163
                S   +    C+F  +C+G E+F+YNK + YE+I++  +  +K   ++F
Sbjct: 124 YITPGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEF 176

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/187 (34%), Positives = 99/187 (52%), Gaps = 13/187 (6%)

Query: 212 LDFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTS-NLDQYKLRSEFELSS 270
           L+F P  + L+ G+++ GNK TPS+ II Y   EGI+DV   T+  +D YK++ + +  +
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 271 TRVSVKPNISFGNGSSSKKHKIDGKPFNLWQK---LKDCLLFTISHILAFTGNKK----- 322
             + VKPNIS+ + S  K    D     LW K   L D +   +S  + F+   K     
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417

Query: 323 --GLTGQEEFLTSWKGLAMYDVATSDTFSDE--IPFDLQNHEYAKYTTILNADRIKLLYS 378
              +   E+F   WKGL++Y  A  +  + E  I FD  NHEYA+Y +I+ A R+     
Sbjct: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTNE 477

Query: 379 YDTPGVI 385
           YD PG++
Sbjct: 478 YDIPGIV 484

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1439 (29%), Positives = 699/1439 (48%), Gaps = 78/1439 (5%)

Query: 127  FKLECDGVELFIYNKIAVYEDILNELAKSDK----DSSRKFATDD--ESIFGRVK----- 175
            F + C G E+F+YN+   YE I+   +K +K    D  R+   DD  E +   +K     
Sbjct: 188  FAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCNEY 247

Query: 176  -----------------------TDSSVMFDPLDESSEQSKVGQTILNSVSNQSAVPLYL 212
                                   ++ S+  D  +  S++S +     N +S      L+L
Sbjct: 248  CNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNR--NKISAHIMRKLHL 305

Query: 213  DFLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTR 272
            D LP ++ ++ GA+ +GNK T S+ +I +    G++D A P S LD +K +  FE++   
Sbjct: 306  DILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDID 365

Query: 273  VSVKPNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLT 332
            +S+K NI +    +S+ +   G    +W  L+  L    +  L              F+ 
Sbjct: 366  MSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFVK 425

Query: 333  SWKGLAMY-DVATSDT--FSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITE-- 387
             W GL +Y D   S T   +D++ FD  NHEYAK +    A +I      D PG++    
Sbjct: 426  KWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHGS 485

Query: 388  ----TLIKGYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAH 443
                +   G + G+    P + ID+QL  A+ Y+G W +R +     +  P +S+D    
Sbjct: 486  HPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKPL 545

Query: 444  RKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKL 503
             K   G +R H+ F   + +++DS  R+PT+EPSKD+ FL +Y  T D+ RAFGWID+  
Sbjct: 546  NKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLSF 605

Query: 504  NKDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWN 563
             K +   + + +  +  GFENT  +      + TSVNH++LF + +  I A   YP  WN
Sbjct: 606  KKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGWN 665

Query: 564  SAITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSL 623
              + W  +  S  L++F+LR+H  LL D+  DF++ +  PYELFR   Y  +  I  YS 
Sbjct: 666  DPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYSF 725

Query: 624  YLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPXXXXXXXXXXXXXXXXXPKFDIQL 683
            Y N ND NI+NNPLDFNENCY+S HG+     + +P                 P F + L
Sbjct: 726  YFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLFL 785

Query: 684  KTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYXXXXXXXXXXXXLECKTNHATFLAYGFL 743
             TP W+TL EFM  + +GRSH+F  SG+YL Y            ++ ++N      +GF+
Sbjct: 786  NTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGFV 845

Query: 744  LRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATDIFNNNDDDQTT-ELVEPNSYGES 802
            ++Y+MN + NYFG F +F TTEEYSE +  RN+V  ++ + N +D T+ E ++      +
Sbjct: 846  IKYMMNFQANYFGSFIKFITTEEYSELI--RNNVNDNLGSINTNDLTSIEGLQKMDSITN 903

Query: 803  GFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMR 862
              + ++ K I ++ L RT NE DIW+ F   DG  +LPE  Y+  SC  L F  +  +MR
Sbjct: 904  DVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFINMR 963

Query: 863  YLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLP 922
              +YY D+  ++    + R+  +  + +F+   +    +S+ +G +S+  IH HRM+GLP
Sbjct: 964  TCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNR-SSSVEGNISDITIHGHRMYGLP 1022

Query: 923  PAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCL 982
            P E TY  +  +++G    +SD+  L  FIQ + K  F   N E+ L YE     D++ L
Sbjct: 1023 PKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMTLL 1082

Query: 983  SFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDH 1042
            S   + + + L++        +   ++ ++ +DF   KY+ R +++   F F   S+D  
Sbjct: 1083 SVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYF---SLDSL 1139

Query: 1043 NIVLGXXXXXXXXXXXXRNPDFKTTNNL-----QTQHILLSDAPFCRCSFLHPQEYQTSD 1097
             I  G                FKT N++     Q + I L D+P+ RC FL P+++Q S 
Sbjct: 1140 KIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESS 1199

Query: 1098 LYKXXXXXXXXXXXXXXXXXXXXXNNFDTIFENLLGDIYQDYISEGTFDISNDTKLQLNI 1157
             YK                     +  + I E +L D  +  +S+    +S + +L  ++
Sbjct: 1200 SYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELN-SV 1258

Query: 1158 DEFKKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDV---LEVFADLYR 1214
            D      ++SF    T    I   ++ +E  +FV  + ++ + ++ D+   +E F+  + 
Sbjct: 1259 D--TTPLKDSFDMQITNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTIEKFSTEFN 1316

Query: 1215 QLTTFTISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHY 1274
            +   F++++ IDG+ + IVN  S      SS     +   +ID        +   DV  +
Sbjct: 1317 K--KFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKID------AAWGHRDV-CF 1367

Query: 1275 FVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSE 1334
              + IN L   L     Y+    N  +     L   +++  I  +  S  +F   S+   
Sbjct: 1368 IGTYINMLKFELSQESTYNN---NGGLQKDLTLLGKFRSVRIIIQNHSYNSF---SDDRP 1421

Query: 1335 FSYKSTFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVT 1394
                   E  E ++      +T  NL    + +++     +  ++K+  L F     SV 
Sbjct: 1422 PGLSLMLEGFEAWSSTTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVK 1481

Query: 1395 ISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLR 1454
            +  +   S ++  +  +  AG+ Y I HDP VITKPA + RLS  H+RE+RSWRIVT+LR
Sbjct: 1482 LIYDEQASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLR 1541

Query: 1455 HVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYI 1513
            H+L YLP+ W +    E    +   E++A   FL++F+ WR+WE +D+E+ ++Y+  ++
Sbjct: 1542 HILTYLPEDWEDRLDEEDLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV 1600

 Score =  624 bits (1609), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 388/1177 (32%), Positives = 643/1177 (54%), Gaps = 45/1177 (3%)

Query: 1786 PFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGN 1845
            P  L++      I+ +   I +  + + DT + L S   +E Y + S+  L+L       
Sbjct: 1890 PIYLKHETNSVNISYNTINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDL 1949

Query: 1846 TDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRS-TMLETKSSTVQNEFP 1904
             + L  + + SS  KL+  +P++ +  FL D ++   ++  LRS   L  K+++  +E  
Sbjct: 1950 NEKLIDLEISSSILKLTTSDPRRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETL 2009

Query: 1905 FSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTFSSDYSSES 1964
            FS    I +N   +Y+G+LL    T YV E ++   + S  +  S+ V   F  D S + 
Sbjct: 2010 FSSYEWI-VNFKSKYMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDH 2068

Query: 1965 ICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLL--- 2021
            I FLIKD+ +    SK+LDFS+++   R+     +S +IESS+    L+P SL++ +   
Sbjct: 2069 IIFLIKDQSIPHKFSKILDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGY 2128

Query: 2022 --------SFVNEFSIMKSIYHDIKPRSTSSNSTLSILPISIKSAHILSYNLCIGWLFDL 2073
                    S+ ++ ++   +++D      +++   ++   S++S HILSYN  IGWL+  
Sbjct: 2129 YQLLYLLNSYYDQSTVNFFVFNDNNIDGATNSEKENVF--SVRSFHILSYNFSIGWLYQD 2186

Query: 2074 GYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMNRSYLP 2133
              N   GLI GY RLF+ Y+  +GKLTL+D +FS+A+G S  T+Y  G+E    NRSYLP
Sbjct: 2187 SDNTIPGLILGYNRLFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLP 2246

Query: 2134 SMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPL- 2192
            ++QI YW++E    K LFI+ +GE LDV+    +  I++   +S+  F+ LK   ++PL 
Sbjct: 2247 NIQILYWIKEIEKMKHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLV 2306

Query: 2193 --KVTSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYSRDDIQHG-TCSFEIRSP 2249
              K   ++        +  P+   ++ +NC   Y G   +L+S   + +    +  I+SP
Sbjct: 2307 KAKPERDEKSNSALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSP 2366

Query: 2250 AHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCS-QF 2308
               + + Y Y+  + K HWI  L  +  T N L   CVP L++    F + +K+    Q 
Sbjct: 2367 KVKIMLSYDYFEKELKKHWINCLIDIEPTQNVLKSGCVPFLSD----FISQIKDIVELQD 2422

Query: 2309 SNGAPNL-ASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKI 2367
             N   N+  + K  IN   LLE FDI   +  G Q ++L CEP AKI   +GF  F+  I
Sbjct: 2423 VNMEENMDNNVKDPINITSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSI 2482

Query: 2368 FTNSMVPDEPLCLSVDLHNLMASSRHVFSREXXXXXXXXXXXMVFSLTHSEYIHTYGSTL 2427
             T  + P +PL +S+ ++++  S +H FS E           ++   TH E    +G+ L
Sbjct: 2483 LTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASFEVSKLDVILIFTHPE---VFGTGL 2539

Query: 2428 ISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVNDIILAPVTASSFESVPSMPKLQRVPINA 2487
            +     +FN+KQ +++++FL+IW + K        L    +++     S P  Q +  ++
Sbjct: 2540 VDDVKLHFNLKQFQNISIFLDIWDVSKSTEKK---LFKKDSNTLVDAKSSPIAQTIVNSS 2596

Query: 2488 TFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSG 2547
            T  W ++ I + I  +I++G +LG + +     W  + H  +  Q L +    + +SS G
Sbjct: 2597 TLPWSFVFIATNINGDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEG 2656

Query: 2548 RLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAA 2607
            RLGG+V I DI WK  + +     F   PLV+L   +G  + K++FDYHMF IST+++  
Sbjct: 2657 RLGGFVEIDDITWKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLK 2716

Query: 2608 IELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLD-L 2666
              + +++D    L DLL+V+++ D I+V  T+L  +N+ DIY+TI R R D+  + ++ L
Sbjct: 2717 FHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETL 2776

Query: 2667 LESNE--LKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVI 2724
            LESN   LK+   +++  +L SL  L+T LS N   LNL I  ++L   EV+++R + V 
Sbjct: 2777 LESNNNVLKRKPLYED--ILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVF 2834

Query: 2725 ANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIH 2784
                  +S++T +  K++T+L  ++ + +LSL+SF  +L E  + ++    Y+  AS + 
Sbjct: 2835 ------SSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLT 2888

Query: 2785 GGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAM 2844
             G I E P + + M T+Q+  + +++  YS SF   V +TWNL PINFIK++W+ H+ ++
Sbjct: 2889 SGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSL 2948

Query: 2845 KLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVE 2904
            ++R +Q   + +I +  + D +  + KV    +YI   LEEP IEMP+IKDL DATPP+E
Sbjct: 2949 EVRTVQFMGNHDISLENEGDTDESV-KVLSNIEYI--ALEEPYIEMPQIKDLKDATPPLE 3005

Query: 2905 WFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRILG 2941
            WFGLNR  FP  THQ V+VP+QKL  VA+KEY ++LG
Sbjct: 3006 WFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLG 3042

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 68/108 (62%)

Query: 5   TEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYKVVI 64
           TEF  + +  ER F WVFLV W  +++      FY+ +  G+ +T    W++WK   + +
Sbjct: 6   TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65

Query: 65  NIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQ 112
            I+S+  S + G ++FKN+ + D+D+TISIL+ + TWRYWLLN R ++
Sbjct: 66  TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSE 113

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 37/60 (61%)

Query: 5  TEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRYKVVI 64
          +EF  + +   + F WVFL +W  ++ +++ + FY  R +GY +T IL ++ WKRY V +
Sbjct: 3  SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

>NDAI0G02680 Chr7 complement(611144..613684) [2541 bp, 846 aa] {ON}
            Anc_8.308 YLR115W
          Length = 846

 Score = 34.3 bits (77), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%)

Query: 1848 NLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILR 1888
            NLGR+S+  S++   I  P    RL L DIE++  +I IL+
Sbjct: 96   NLGRVSMIESYASKGIIGPYNTNRLDLEDIEKSFDHISILK 136

>Kpol_1039.43 s1039 complement(131645..133336) [1692 bp, 563 aa] {ON}
            complement(131645..133336) [1692 nt, 564 aa]
          Length = 563

 Score = 33.5 bits (75), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 14/119 (11%)

Query: 2790 EAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHM 2849
            E P   + ++T    Y ++I+ L++SSFG  ++  WN      I  +  +    + L H 
Sbjct: 405  EIPKSLLEIHT-DCPYEDIIKYLHTSSFG--INAMWNEH--FGIAVVEYVAAGLIPLVHA 459

Query: 2850 QKGNSSEIHIPKDE--DIEAKLAKVDLGTKYIYKPLEEPNIEM-------PKIKDLGDA 2899
              G   +I +P D   D +AK + +D  T + +K  E+P+ E        P++ DL D 
Sbjct: 460  SAGPLLDIVVPWDLKLDQQAKTSSLDTLTGFFFKDPEDPDYETFKTHNTYPRLSDLFDT 518

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 313,898,872
Number of extensions: 14440359
Number of successful extensions: 42796
Number of sequences better than 10.0: 55
Number of HSP's gapped: 43167
Number of HSP's successfully gapped: 77
Length of query: 2943
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2815
Effective length of database: 38,804,151
Effective search space: 109233685065
Effective search space used: 109233685065
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)