Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43098.261ON57757727510.0
AGR087C8.261ON57757620330.0
SAKL0H17050g8.261ON58457518470.0
KLLA0F19118g8.261ON57857717780.0
KLTH0G13706g8.261ON58456416590.0
TDEL0F038808.261ON57957716430.0
YLR088W (GAA1)8.261ON61461315880.0
Smik_12.1478.261ON61361215710.0
Kwal_56.238048.261ON57856415630.0
Skud_12.1568.261ON61261115410.0
Suva_10.1728.261ON61461315170.0
Kpol_543.378.261ON57857814960.0
ZYRO0C01672g8.261ON56957914850.0
NCAS0B038608.261ON58357914690.0
TBLA0F030808.261ON58357014370.0
KNAG0H032508.261ON58558714340.0
CAGL0L12232g8.261ON59158014150.0
NDAI0J013908.261ON58357213940.0
TPHA0A018208.261ON58157013381e-179
KAFR0B055508.261ON55555213071e-175
KLLA0C19228gsingletonON59161820.26
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4309
         (577 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...  1064   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   787   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   716   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   689   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   643   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   637   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   616   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   609   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   606   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   598   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   588   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   580   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   576   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   570   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   558   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   556   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   549   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   541   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   520   e-179
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   508   e-175
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    36   0.26 

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score = 1064 bits (2751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/577 (90%), Positives = 525/577 (90%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEI                
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
           TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSY 
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXXX 480
           SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTS                
Sbjct: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVLA 480

Query: 481 FPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQL 540
           FPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQL
Sbjct: 481 FPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQL 540

Query: 541 GCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKKSY 577
           GCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKKSY
Sbjct: 541 GCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKKSY 577

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/576 (65%), Positives = 455/576 (78%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MAVLEKLHR++VDMGLVP+II SL KIS    LLS++WLTLFLP+EGQYRRTYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRESEWNILRGYR E++ ++ L   ERN IVASWMEEYGAK ++  ++++GET
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LY ++H +RGDGTEAMVLAAPW T +G YN GG ALA+++ RYF+RWPVWSKNII+VLS 
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           DP ASLR+WV+AYHTKLDLTGGSIE+A+VLDYPGTNDYF+++EI                
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            AVHI+EHEGMKV+LHG P+ EL  DTY  R++ LL GIKDM L+GIK T+G+EAF+GWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQSVTLKA G +G FD+TTFGRVPEA+FRSVNNLLEKFHQSFFFYLLL+PR FVSIGSY 
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NNE++ LPL+SIYNIWAL AF+VAL++S +TAE F Y+P P
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXXX 480
           +LLLAFNV +SF+ F ++KYKIQKPFS+RFKA A+LYFS VL+S                
Sbjct: 421 ALLLAFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480

Query: 481 FPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQL 540
           FPM+  +TT +A+++QK++NSLLL+ SNPFI+  +   LFE +L G S+F+SLIDAW  L
Sbjct: 481 FPMTFVRTTVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDAWNDL 540

Query: 541 GCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKKS 576
           GCWTWYVLC+GWYP+WI+VAYSSIDS+PI   +KKS
Sbjct: 541 GCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKKS 576

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/575 (58%), Positives = 428/575 (74%), Gaps = 1/575 (0%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MA++EKLHRR +DMGL+P+ IA LP +SIFCA++ +SWL LF+P +GQ+RRTYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRE+EWN+LRGYR ++E  K    HERN  V+SW++++GAKT+I TN +YGET
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYGI+H  RGDGTEAMVLAAPW  ++  YN GG ALA+SL+R+F+RWPVWSKNII+VLS 
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           DPQA+LR+WV+AYHT LDLTGGSIE+AVV+D+PG+ND+FKY+EI                
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            AVHI+EHEGMKVSLHG+   EL ++ +  R+KT++ G+K+M L+GIK + G+E F+GWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           I SVTLKA G DGPFD+TTFGR+PEAIFRSVNNLLEKFHQSFFFYLLL+PR FVSIGSY 
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NNEY+ LPLLS YN++AL  FAVAL +SF+TA+AF Y P P
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXXX 480
            LLL+ NV L  +     + KI+ PFSYR K+FA+LYFS+VLTS                
Sbjct: 421 ELLLSLNVLLLLMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480

Query: 481 FPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQL 540
           FPM+L +TT+   ++ +L+N +LL+ SNPFIA W+     + +L G  +F+ L  AW  L
Sbjct: 481 FPMTLVRTTS-GNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDL 539

Query: 541 GCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKK 575
           GCWTW+V+CIGW PSW+LVAYS IDS+ IV    +
Sbjct: 540 GCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDE 574

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/577 (56%), Positives = 419/577 (72%), Gaps = 2/577 (0%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MA++EKLHRRI+ +GL+P+ I+ L ++S+ C ++ + WL   LP +GQ+RRTYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDI-HERNTIVASWMEEYGAKTSINTNNQYGE 119
           PSQAYSYFRESEWNILRGYR +L+  + +   H+ N  V+ W++E+G KT+I  + QYGE
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 120 TLYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLS 179
           TLYGI H  RGDGTEAMV+AAPW   +  YN GGAALAISL R+F+RWPVWSKNII+VLS
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 180 ADPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXX 239
            DP+ASLR+WV AYHT LDLTGGSIESA+VLDYPGT+D F Y+EI               
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 240 XTAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGW 299
             AVHI+EHEG+KVSLHG+PF EL ++ Y  RLKT+L GIKD  L+GIKN  G+EAF+GW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 300 RIQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSY 359
           RIQS+TLKA G DGP D+TTFGRVPEA+ RSVNNLLEKFHQSFFFYLLL+PR F+SIG+Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 360 XXXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPL 419
                               NN+Y +LPLLSIYNIW++  F ++L+ +F T++ F Y PL
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 420 PSLLLAFNVALSFIS-FTVIKYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXX 478
           P +LL  +   S +   +  + +IQ+PFSYRFKAFA++Y +IVLTS              
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 479 XXFPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWT 538
             FPM+ T T   + ++  ++N +LL+ SNPFIA+W +    E +L+G  +F++LI+A  
Sbjct: 481 LAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQ 540

Query: 539 QLGCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKK 575
           QLGCWTWY++C+GWYPSW+LV Y+SID+I + T  KK
Sbjct: 541 QLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTPIKK 577

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/564 (54%), Positives = 398/564 (70%), Gaps = 2/564 (0%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MA++EKL RRI+D+GL+PRI+  LPK+SI C +L I WLTL LPLEGQYR TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRE+EWNILRGYR +++ L++    ERN +VASW +E+GAKT+   ++ +G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           +YG++H  RGDGTEAMVLAAPW   DG YN GGAALA +L+R+F+RWPVWSKNII+V S 
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           DP+ASLR+WV AYHT LDLTGGSIESAVVLDYPG+ND+FKY+EI                
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            AVHI+EHEGMKVSL+G+   E+ +  Y  ++KT++ G+K M L+G+++  G+EAF+GWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQ++ L+A G DGPFD+TTFGR+PEA FRSVNNLLEKFHQSFFFYLLL+PR FVSI SY 
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                               +  S  P  S++N+ A+  F VAL++SF  +  F++    
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXXX 480
           SLL++ N  ++ +     +  I+   SY+FK+ A LY S+VLTS                
Sbjct: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLLA 480

Query: 481 FPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQL 540
           FP+ L K     T +Q+++N++LL+ SNPFI++ +    FE QL+G  LFH L+ AW +L
Sbjct: 481 FPLILVKAPM--TSRQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKL 538

Query: 541 GCWTWYVLCIGWYPSWILVAYSSI 564
           GCWTW V+CIGW PSW+LVA S I
Sbjct: 539 GCWTWSVVCIGWLPSWLLVACSGI 562

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/577 (51%), Positives = 411/577 (71%), Gaps = 4/577 (0%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           M+++ KLHRR++D+GLVP+I+A+LP +S+  A++S+ WL L LPLEG+YRRTYISENAL+
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLAL-LPLEGRYRRTYISENALL 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRE+EWN LRGYR ++E L +    ERN  VA W+ E+G KT+I  + ++G+T
Sbjct: 60  PSQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDT 119

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYG++H  RGDGTEA++LAAPWT  DG+ N  G ++ I+L R+F+RWPVWSKNIIVVLS 
Sbjct: 120 LYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSE 179

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           +P+ S+R+WV+AYHT LDLTGGSIE+AVVLDYPG NDYF ++EI                
Sbjct: 180 NPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVN 239

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            A+ I+EHEGMKVSLHG+   ++S + +  RL  +L+GIK+  L+G++   G+EAF+GWR
Sbjct: 240 IAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWR 299

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQ+VTLKAHG +G  DVTTFGR+PEA+FRS+NNLLEKFHQSFFFY+LL+PR FVSI SY 
Sbjct: 300 IQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NN Y KLPL S YN+ +L  + ++L+  F  A+ F     P
Sbjct: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419

Query: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXXX 480
           ++L++F+  +SF+   ++K KI +P +YR K+ A L+FS+VLTS                
Sbjct: 420 TILISFSALISFLPL-LLKKKIAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 481 FPMSLTKTTT--NATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWT 538
           FPM+L +T++  N +++ KL+NS+LL+ SNPFIAS+I CQ FE  L G ++F     AW 
Sbjct: 479 FPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538

Query: 539 QLGCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKK 575
           +LGCWTW+V+CIGW PSW++VA S++++ P     +K
Sbjct: 539 ELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRK 575

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/613 (51%), Positives = 400/613 (65%), Gaps = 40/613 (6%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MA+LEKLHRRIVDMGLVPRIIA LP IS+ CAL     + + LP++GQYRRTYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRESEWNILRGYR +++ + ++   ERN ++ SW++E+G KT+I  N QYGET
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYG++H  RGDGTEAMVLA PW  +D  +N GGAAL +SLAR+F+RWPVWSKNIIVV S 
Sbjct: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           +P+A+LR+WV+AYHT LDLTGGSIE+AVVLDY  T D+F+Y+EI                
Sbjct: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            A+ I+EHEGMKVSLHG+P  +L+ + +  RLK L  GI+D  L+G+K   G+EAF+GWR
Sbjct: 240 IAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWR 299

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQSVTLKAHG  G  D+TTFGR+PEA+FRS+NNLLEKFHQSFFFYLLL+PR FVSI SY 
Sbjct: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NN Y+ + L S YN+ AL  + V+L+ISFV ++AF  +P  
Sbjct: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418

Query: 421 SLLLAFNVALSFISFTVI-KYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXX 479
            LL+  ++A  F+   +  K  I +P SYR K  A LYFS+V TS               
Sbjct: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 480 XFPMSLTKT----------------------------------TTNATMQ---QKLRNSL 502
            FPM+  KT                                  TT AT Q   QKL+N +
Sbjct: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLV 538

Query: 503 LLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQLGCWTWYVLCIGWYPSWILVAYS 562
           LL+ +NPFI+  +    F+ +  G  + + L+ AW  L CW+W+VLCIGW P W+L+  S
Sbjct: 539 LLILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598

Query: 563 SIDSIPIVTTSKK 575
           S +S  +V  SK+
Sbjct: 599 SFESKSVVVRSKE 611

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/612 (50%), Positives = 399/612 (65%), Gaps = 39/612 (6%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MA+LEKLHRRIVDMGLVPRIIASLP +S+ CAL     + + LP++GQYRRTYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRESEWNILRGYR ++E + ++   ERN I+ SW++E+G KT+I  N QYGET
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYG++H  RGDGTEAMVLA PW  +D  +N GGAAL +SLAR+F+RWPVWSKNII+V S 
Sbjct: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSE 179

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           +P A+LR+WV+AYHT LDLTGGSIE+AVV+DY    D+F+Y+EI                
Sbjct: 180 NPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            A+ I+EHEGMKVSLHG+P  +L+ + Y  RLK L  GI+D  LAG+KN  G+EAF+GWR
Sbjct: 240 VAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWR 299

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQSVTLKAHG  G  D+TTFGR+PEA+FRS+NNLLEKFHQSFFFYLLL+PR FVSI SY 
Sbjct: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NN Y+ + + S YN+ AL  + ++L+ISFV ++ F  +P  
Sbjct: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418

Query: 421 SLLLAFNVALSFISFTV-IKYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXX 479
            LL+A ++   F+   +  K  I +P SYR K  A LYFS+VLTS               
Sbjct: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478

Query: 480 XFPMSLTKTTTNAT------------------------------------MQQKLRNSLL 503
            FPM+L KT   ++                                     +Q+L+N LL
Sbjct: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLL 538

Query: 504 LMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQLGCWTWYVLCIGWYPSWILVAYSS 563
           L+ +NPFI+  I    F+ +  G  + + L+ AW  L CW+W+VLCIGW P W+LV  SS
Sbjct: 539 LVLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASS 598

Query: 564 IDSIPIVTTSKK 575
            +S  ++  SK+
Sbjct: 599 FESKRVMLKSKE 610

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/564 (52%), Positives = 387/564 (68%), Gaps = 2/564 (0%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MA++E+L R+++D+GL+PRI+  LPK+S+ C ++ I W+TL LPLEGQYR TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRE+EWNILRGYR +++ L++    ERN I+ SW++E+G KT++  +   G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYG++H  RGDGTEAMVL+APW   DG +N GG AL ++LARYF+RWPVWSKNIIVV S 
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           DP+ASLR+WV+AYHT LDLTGGSIESAVVLDYPG ND+FKY+EI                
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            A+H++EHEGMKVSL+G+P  E+    Y  R+KT++ GIK M L+G++   G+EAF+GWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQ+V L+A G  GPFD+TTFGRVPEA+FRSVNNLLEKFHQSFFFYLLL+PR FVSI SY 
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                                  S      + NI A+  F VAL+ SF  +  FA    P
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXXX 480
            +L++++V  +     + + +IQ  +++R KA A+LY S+VLTS                
Sbjct: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLLA 480

Query: 481 FPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQL 540
           FP+ L K +T  T +   +NSLLL+ SNPFI++ +    FE  L G  +   L+ AW + 
Sbjct: 481 FPLILVKNST--TPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQAWNEF 538

Query: 541 GCWTWYVLCIGWYPSWILVAYSSI 564
           GCWTW V+CIGW PSW+L+AYSS+
Sbjct: 539 GCWTWCVVCIGWLPSWLLIAYSSM 562

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/611 (49%), Positives = 396/611 (64%), Gaps = 38/611 (6%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MA+LEKLHRRIVDMGLVPRIIA LP IS  CAL     + + LP++GQYRRTYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRESEWN+LRGYR ++E ++++   ERN  + SW++E+G KT+I  + QYGET
Sbjct: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGET 119

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYG++H  RGDGTEAMVLA PW  +D  +N GGAAL +SLAR+F+RWPVWSKNIIVV S 
Sbjct: 120 LYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           +P+A+LR+WV+AYHT LDLTGGSIE+AVVLDY    D+F+Y+EI                
Sbjct: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            A+ I+EHEGMKVSLHG+P+ +L+ + +  RLK L  GI+D  L+G+KN  G+EAF+GWR
Sbjct: 240 IAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWR 299

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQSVTLKAHG  G  D+TTFGR+PEA+FRS+NNLLEKFHQSFFFYLLL+PR FVSI SY 
Sbjct: 300 IQSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NN Y+ + L S YN+ AL  + ++L++SF+ ++ F  +P  
Sbjct: 359 PSAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418

Query: 421 SLLLAFNVALSFISFTVI-KYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXX 479
            LL+  ++A  F+   +  K  I +P SYR K  A LYFS+V TS               
Sbjct: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478

Query: 480 XFPMSLTKTTT-----------------------------------NATMQQKLRNSLLL 504
            FPM+  +T                                      A  +Q+L+N LLL
Sbjct: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLL 538

Query: 505 MSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQLGCWTWYVLCIGWYPSWILVAYSSI 564
           + +NPFI+  +   +F+ +  G  + + LI AW  L CW W+VLCIGW P W+L+  SS 
Sbjct: 539 VLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598

Query: 565 DSIPIVTTSKK 575
           +S  +V  SK+
Sbjct: 599 ESRSVVVKSKE 609

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/613 (47%), Positives = 392/613 (63%), Gaps = 40/613 (6%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MA+LEKLHRR+VDMGLVPR+IA LP IS  CAL     + + LP++GQYRRTYISENALM
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRE+EWNILRGYR ++E   ++   ERN ++ SW++E+G KT+I  N QYGET
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYG++H  RGDGTEAMVLA PW  ++  +N GGA+L +SLAR+F+RWPVWSKNIIVV S 
Sbjct: 120 LYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           +P A+LR+WV+AYHT LDLTGGSIE+AVVLDY    D+F+Y+E+                
Sbjct: 180 NPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVN 239

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            A+ I EHEGMKVSLHG+P+ +L  + +  RLK L  GI+D  L+G+KN  G+EAF+GWR
Sbjct: 240 VAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWR 299

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQSVTLKAHG  G  D+TTFGR+PEA+FRS+NNLLEKFHQSFFFYLLL+PR FVSI SY 
Sbjct: 300 IQSVTLKAHGHGG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NN+Y+ + L S YN+ A+  + +A+++SFV ++ F  +   
Sbjct: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418

Query: 421 SLLLAFNVALSFISFTVI-KYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXX 479
            LL+  ++A+ F+   +  K  I +P SYR K  A LYFS+V TS               
Sbjct: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 480 XFPMSLTKTT-------------TNATMQQKLRNSLLL---------------------- 504
            FPM+  KT              +N +++ +  +   L                      
Sbjct: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLL 538

Query: 505 --MSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQLGCWTWYVLCIGWYPSWILVAYS 562
             + +NPFI+  +   LF+ +  G  + + L+ AW  L CW+W++LC+GW P W+L+  S
Sbjct: 539 LLILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILAS 598

Query: 563 SIDSIPIVTTSKK 575
           S +S  +V  SK+
Sbjct: 599 SFESKSVVVKSKE 611

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/578 (49%), Positives = 384/578 (66%), Gaps = 5/578 (0%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           M++LE L RR++D GL+P+ +A+LPK+S+    +S+  L L+LP++GQ+RRTYISENALM
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVM-LMLYLPMDGQFRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRE+EWNILRGYR+E+E L      ERN I++SW+EE+G KTS+  N +YG++
Sbjct: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDS 119

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYG+ +  RGDGTE+MVLA PW   +  +N  GAAL +SLAR+ +RWPVWSKNIIVV S 
Sbjct: 120 LYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSE 179

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           +P+ +LR+WV+AYHT LDLTGGSIE+AVVLDYPG +DYF+YIE+                
Sbjct: 180 NPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVN 239

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            A+ I+EHEG+KVSLHG+   E+    Y  RLK +  G K++ L G++   G+EAF+GWR
Sbjct: 240 IAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWR 299

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQ++TLKA G D   DVTTFGRV EA+FRS+NNLLEKFHQSFFFY LL+PR FVSIGSY 
Sbjct: 300 IQALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NN+Y  +   S YN+ +   +AV++++ F    +F Y P P
Sbjct: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418

Query: 421 SLLLAFNVALSFISFTVIK-YKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXX 479
            LLL  NV +S I     K   I +P +YR K  + +Y S+V+TS               
Sbjct: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478

Query: 480 XFPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQ 539
            +PM+L        ++ K RNS+LL  SNPFIA W+   + E++L G    + L+DAW +
Sbjct: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538

Query: 540 LGCWTWYVLCIGWYPSWILVAYSS--IDSIPIVTTSKK 575
           LG WTW++ CIGW+PSWILVA S+  ++ +     SKK
Sbjct: 539 LGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKK 576

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/579 (50%), Positives = 388/579 (67%), Gaps = 16/579 (2%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MA++E+L RR+V+MGLVP+IIA LP +S+ CA++S  WL   LP+EGQ+RRTYISENALM
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLAT-LPIEGQFRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRESEWNILRGYR ++E+  ++  +ERN  +A W++E+GAKTSI  N +YG++
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDS 119

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYGI+H  RGDGTEA++LA PW   +G  N GGA+L ISL+R+F+RWPVWSKNII+V S 
Sbjct: 120 LYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSE 179

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           +P  +LR+WV+AYHT LDLTGGSIE+A+VLDYPGTNDYF Y EI                
Sbjct: 180 NPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVN 239

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            AV I+EHEG+ VSLHGM    ++ ++Y  RLK LL GI     AG++   G+EAF+GWR
Sbjct: 240 IAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWR 299

Query: 301 IQSVTLKAHGQDGP-FDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSY 359
           IQSVT+KAHG++G   D+TTFGR+PEA+FRS+NNLLEKFHQS+FFY+L++PR FVSI SY
Sbjct: 300 IQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359

Query: 360 XXXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPL 419
                                N+YS L   S YN+ AL  + V++++SFV ++ F Y+P 
Sbjct: 360 LPATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419

Query: 420 PSLLLAFNVALSFISFTVIK-YKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXX 478
             LL+AF V +  +     + + I +P S+R + +A LY S+V+TS              
Sbjct: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479

Query: 479 XXFPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWT 538
             FPM+   T  + T ++      LL+ SNP ++ +I+            L   LI AW 
Sbjct: 480 LAFPMTAVGTQRSLTFKKY----ALLIISNPLVSFFIVK-------PHPQLLQKLISAWQ 528

Query: 539 QLGCWTWYVLCIGWYPSWILVAYSSIDSIPI--VTTSKK 575
            LGCWTW+VLC+GW PSW L+A S+  S  +  V TSKK
Sbjct: 529 DLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKK 567

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/579 (48%), Positives = 388/579 (67%), Gaps = 5/579 (0%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           M + E++ R+++  GL+P++I+ LP IS  C +L I  +   LP EGQYR TYISENALM
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIV-IIGILPFEGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRESEWNI+RGYR ++  L++    ERN I++ W++++G KT I  N++ G+T
Sbjct: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDT 119

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYG+ H  RGDGTE+MVLA PW   DG +N  GAAL ++LARYF+RWPVWSKNIIVV + 
Sbjct: 120 LYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTE 179

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           +P+A+LR+WV+AYHT LDLTGGSIE+A+VLD+ G  D F Y+EI                
Sbjct: 180 NPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVN 239

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
             V  +EHEGMKVSLHG PF ++ +DT   RLK L+S IK+  L+G+K T G+EAF+GWR
Sbjct: 240 IGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWR 299

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQSVTL+A GQ+GPFDVT+FGRVPEA+FRS+NNLLEKFHQSFFFYL+L+PR FVSI SY 
Sbjct: 300 IQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NN Y  LP  S+Y + ++  + V+L+++F+ +  F Y P P
Sbjct: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419

Query: 421 SLLLAFNVALSFISFTVIKYKIQKP-FSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXX 479
           ++LLA N+ +      +      K   SYR ++ A L+ S++LTS               
Sbjct: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLL 479

Query: 480 XFPMSLTKTTTNAT---MQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDA 536
            FPM+  KT T+ T    + +++NS+LL+ SNPFIA+W+   L + + +G  +F  L+ A
Sbjct: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539

Query: 537 WTQLGCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKK 575
             +LGCWTW VLC+GW+  W+LVA S++D++ +   S+ 
Sbjct: 540 SRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSED 578

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/570 (49%), Positives = 377/570 (66%), Gaps = 5/570 (0%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MA+L  +HRR++DMGLVP+I+  LP +SIF A + I  L L LP++GQYR TYISENALM
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRESEWNILRGYR E++    +   +RN ++  W+EE+G KTS+  N++YG+T
Sbjct: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDT 119

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYGI +  RGDGTEA+VLA PW   DG +N GGAAL I+L+R+F+RWP+WSKNIIVV S 
Sbjct: 120 LYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSE 179

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           +P  +LR+WV AYH  LDLTGGSIE+A+V+DYP ++D+F Y+EI                
Sbjct: 180 NPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLN 239

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            A+ I+EHEGM+VSLHG+P   L Q+ Y  RL+TLL G KD  L+GIK   G+EAF+G+R
Sbjct: 240 IAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFR 299

Query: 301 IQSVTLKAH--GQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGS 358
           IQ++TLKA     +   D+T+FGR+ EA FRSVNNLLEKFHQSFFFYL+L+P+ FVSI S
Sbjct: 300 IQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISS 359

Query: 359 YXXXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMP 418
           Y                    NN YS LP+ S YN+ A   F +++  SF  A       
Sbjct: 360 YLPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFT 419

Query: 419 LPSLLLAFNVALSFISFTV-IKYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXX 477
            P LL+  +V LS +   +  ++ I +P SYR K+ A LY S+VLTS             
Sbjct: 420 EPRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIG 479

Query: 478 XXXFPMSLTKT-TTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDA 536
              F M+  KT T +++M+ ++RN++ L+ SNPF +  +   +F+  + G  +F+  I +
Sbjct: 480 ILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHS 539

Query: 537 WTQLGCWTWYVLCIGWYPSWILVAYSSIDS 566
           W  L CWTW+++C+GW P WILV+ SSI +
Sbjct: 540 WNTLNCWTWFIICVGWLPPWILVSISSIQT 569

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/587 (49%), Positives = 391/587 (66%), Gaps = 14/587 (2%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           M + E L R+ V +GL+P+++A+LP +S   A++S+  + L +P+ GQYR TYISENALM
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVV-MILIIPMNGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELE--NLKDLDIHERNTIVASWMEEYGAKTSINTNNQYG 118
           PSQAYSYFRE+EWNILRGYR E+E  N + +   +R  IVA W+ E+GAKT++  N + G
Sbjct: 60  PSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMG 119

Query: 119 ETLYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVL 178
           +TLYG++H  RGDGTEAMVL APW  ++G +N GG+ALAI+L+RYF+RWPVWSKNIIVV 
Sbjct: 120 DTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVF 179

Query: 179 SADPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXX 238
           S +P  +LR+WV+AYHT LDLTGGSIE+AV+LDYP  NDYF Y EI              
Sbjct: 180 SDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDL 239

Query: 239 XXTAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNG 298
              AVHI++HEGMKVSLHG+P  EL ++ Y  RLK L  G+KD TLAG+K   G+E F+G
Sbjct: 240 VNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSG 299

Query: 299 WRIQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGS 358
           WRIQ+VTLKA G+ G  D+TTFGR+PEA+FRS+NNLLEKFHQSFFFY LLSP +FVSI S
Sbjct: 300 WRIQAVTLKARGE-GQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISS 358

Query: 359 YXXXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAY-- 416
           Y                    NN Y+   L   Y + A  A  ++L++SF+ A  F Y  
Sbjct: 359 YLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTLLAALASVISLLVSFLVAHWFLYST 417

Query: 417 -MPLPSLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXX 475
             PL  +L +  +A+S +  +     +++P  YR +   ++Y+S++LTS           
Sbjct: 418 TSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFS 477

Query: 476 XXXXXFPMSLTKTT---TNATMQQKLRNSLLLMSSNPFIASWILCQLFE-AQLAGTSLFH 531
                +PM+L K     + + M  KLRNS+LL+ SNPF+A+W++C + E ++     +F 
Sbjct: 478 IGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFA 537

Query: 532 SLIDAWTQLGCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTS--KKS 576
           +L  AW  L CWTW+VLC+GW P+W+LV +SS  SIP   T+  KKS
Sbjct: 538 ALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKS 584

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/580 (46%), Positives = 379/580 (65%), Gaps = 11/580 (1%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           M++L+K++RR+ + G + +++  LP++S    +++I  L   LPL+GQYRRTYISENALM
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIV-LLAILPLDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRE+EWNILRGYR ++E L+   + +RN +VA W++E G KT++  + ++G+T
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKT 119

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYG++H SRGDGTEAMVLA PW   D  +N GGAAL +SL+++F RWPVWSKNIIVV S 
Sbjct: 120 LYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSE 179

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           D  A+LRAWV AYHT LDLT GSIE+AVVLDYP  +D+F+Y+EI                
Sbjct: 180 DSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            AV I+EHEGMKVSLHG+P  E+    Y  RLK +  GIK+  L+G+K   G+EAF+GWR
Sbjct: 240 IAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWR 299

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQSVTL+AHG +G  D+T FGR+PEA+FRSVNNLLEKFHQS+FFYLLL+PR+FVSI +Y 
Sbjct: 300 IQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NN+Y  +P  S+  +      + ++ +SF+ +     +P+ 
Sbjct: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419

Query: 421 SLLLAFNVALSFISFTVIK---YKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXX 477
             LL  +VAL+F+   + K   + I +  +YR K+   +Y+S++LTS             
Sbjct: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIG 479

Query: 478 XXXFPMSL-----TKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAG--TSLF 530
              FP++      TKT  + + +  L+N+ +L  +NPFI+ W+     +    G  + ++
Sbjct: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539

Query: 531 HSLIDAWTQLGCWTWYVLCIGWYPSWILVAYSSIDSIPIV 570
           + +I +W  LGCWTW+++C+GW P W++   SSI S PIV
Sbjct: 540 NRMITSWDTLGCWTWFIICLGWLPYWLISVISSIPSQPIV 579

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/572 (49%), Positives = 371/572 (64%), Gaps = 8/572 (1%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           M +LE++ R IV  GL+P+I+A LPKISI    +SI  + + LP++GQYR TYISENALM
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAI-LPMDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRE+EWNI+RGYR EL ++++    ERN I+ SW+ E+G KT I   N+  E 
Sbjct: 60  PSQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQI-YENRDNEV 118

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYG+ H  RGDGTEA+VLA PW   DG +N  GAA+ ++LARYF+RWPVWSKNIIVV S 
Sbjct: 119 LYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSE 178

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           +P ++LR+WV+AY+T LDLTGGSIE+A+VLD PG NDYF Y+E+                
Sbjct: 179 NPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVN 238

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
             ++I+EHEGM+VSLHG PF ++ ++ Y  RLK L++ I+    +G+  T G+EAF+GWR
Sbjct: 239 IGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWR 298

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQS+TLK  G  GP D+T FGRVPEA+FRS+NNLLEKFHQSFFFYLLL+PR FVSI SY 
Sbjct: 299 IQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NN    LP  S Y +     + V L+  F+ A+ F  +P+P
Sbjct: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIP 418

Query: 421 SLLLAFNVALSFISFTVIKYKIQKP-FSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXXXX 479
           SLLL  N+ +S  S  +   K+ KP  S R ++FA L+ S++LTS               
Sbjct: 419 SLLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLM 478

Query: 480 XFPMSLTKT-TTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQ----LAGTSLFHSLI 534
            FPM+  ++ T N   Q KL N +LLM SNPFIA  I   +        L G  + + LI
Sbjct: 479 AFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538

Query: 535 DAWTQLGCWTWYVLCIGWYPSWILVAYSSIDS 566
            AW  + CWTW+VLC+GW PSWI+VA S I++
Sbjct: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIEN 570

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  520 bits (1338), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 265/570 (46%), Positives = 364/570 (63%), Gaps = 6/570 (1%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           MA++E LHRR   +GL+P++I  L  +S    L+SI  L L LPL+GQYRRTYISENAL+
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIG-LILCLPLDGQYRRTYISENALL 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRESEWNILRGYR  +E L D     RN +++SW+ ++G K ++  N   G+T
Sbjct: 60  PSQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDT 119

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           LYG+ ++ RGDGTEA+VLA PW  TD   N GGAAL ISL+RYF+RWP+WSKNII+V+S 
Sbjct: 120 LYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISE 179

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           +P  ++++WV AYH  LDLTGGS+E+A+VLD+P  ++YF+++E+                
Sbjct: 180 NPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVN 239

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            A+ + EHEG+KVSL G+   E+   +Y  RLKTLL G+K+  L+G +   G+EAF+G R
Sbjct: 240 VAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRR 299

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQ++TLKA G +G  D+TTFGR+PEAIFRSVNNLLEKFHQSFFFY L++PR FVSIGSY 
Sbjct: 300 IQALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              NN+Y  +PL    +I AL  F  ++ ISF+  +       P
Sbjct: 359 PSAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQP 418

Query: 421 SLLLAFNVALSFISFTVIK---YKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXXXX 477
            L++   + +SF+  T I      IQ   SYR K+FA +Y S+VLTS             
Sbjct: 419 HLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMG 478

Query: 478 XXXFPMSLTKTTTNA-TMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDA 536
              FP++ TK+ +   T + K+ N   L  SNPFIA +I   +FE  +    +F  LI +
Sbjct: 479 LLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISS 538

Query: 537 WTQLGCWTWYVLCIGWYPSWILVAYSSIDS 566
           +  +G WTW + CIGW+ +W +V  +++D+
Sbjct: 539 FKYMGNWTWAITCIGWFTTWQMVYIANLDT 568

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  508 bits (1307), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 268/552 (48%), Positives = 356/552 (64%), Gaps = 14/552 (2%)

Query: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60
           M ++E++ R++  MGLVP++   LP  S   AL+S+      LP++GQYR TYISENALM
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLI-SIAILPIDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120
           PSQAYSYFRE+EWNILRGYR ++EN+ DL + ERN I+ +W+ + GAKT  + N+    T
Sbjct: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----T 115

Query: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180
           +YGI H+ RGDGTEA+VLA PW  ++G +N GGAAL +SLAR+F RWP+WSKNIIVV S 
Sbjct: 116 IYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSE 175

Query: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIXXXXXXXXXXXXXXXX 240
           D  ASLR+WV+AYHT LDLTGGSIE+AV+LDY   +D+F Y+EI                
Sbjct: 176 DTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVN 235

Query: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300
            AV I+EHEGMKVSLHG+P  EL + +   R K LL  IKD +LAGIK   G+EAF+GWR
Sbjct: 236 IAVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWR 295

Query: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYX 360
           IQ++TLKA G+ G  D+TTFGR+PEA+FRS+NNLLEKFHQSFF+YLLL+PR+FVSI SY 
Sbjct: 296 IQALTLKACGEGG-IDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYL 354

Query: 361 XXXXXXXXXXXXXXXXXXXNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420
                              N+    +P +S Y + A+  + +++  SF  A  +     P
Sbjct: 355 PAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFP 414

Query: 421 SLLLAFNVALSFI-----SFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSXXXXXXXXXXX 475
            +L+   +  SFI        + + KI    ++R KAFA  YFS+VLTS           
Sbjct: 415 VMLMFICILFSFIPLISRGLPLAETKIT--VAHRMKAFAFGYFSLVLTSLLMINFPLALT 472

Query: 476 XXXXXFPMSLTK-TTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLI 534
                FPM+L K + T  T  Q L+NS+LL+ SNP+I+      +F+++L G +    LI
Sbjct: 473 IGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLI 532

Query: 535 DAWTQLGCWTWY 546
            AW  + CWTW+
Sbjct: 533 PAWNDMNCWTWF 544

>KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} similar
           to uniprot|P53749 Saccharomyces cerevisiae YNR063W
           Hypothetical ORF
          Length = 591

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 5/61 (8%)

Query: 15  GLVPRIIASLPKISIFCAL-LSISWLTLFLPLEGQYRRTYISENALMPSQAYSYFRESEW 73
            L+P + A+ P I  FC L L  +++T+ +PLEGQ    Y+S NAL  + A ++ +   +
Sbjct: 260 DLIPAVHAA-PNIDGFCGLVLMANFMTIMIPLEGQL---YLSNNALEVAVALNFHKRESY 315

Query: 74  N 74
           +
Sbjct: 316 D 316

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,563,368
Number of extensions: 2055232
Number of successful extensions: 5136
Number of sequences better than 10.0: 24
Number of HSP's gapped: 5135
Number of HSP's successfully gapped: 28
Length of query: 577
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 462
Effective length of database: 40,294,809
Effective search space: 18616201758
Effective search space used: 18616201758
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 68 (30.8 bits)