Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43088.262ON52952927470.0
AGR086C8.262ON53453516620.0
KLLA0F19140g8.262ON52743811551e-153
SAKL0H17028g8.262ON55053810641e-139
Kwal_56.237998.262ON4884079041e-116
KLTH0G13684g8.262ON5083838871e-113
TDEL0F038908.262ON4763548101e-102
KAFR0B055408.262ON5194327877e-98
ZYRO0C01650g8.262ON5863947255e-88
Kpol_543.388.262ON4423977005e-86
Smik_4.3568.262ON5763557107e-86
Suva_2.2708.262ON6323637147e-86
YDR110W (FOB1)8.262ON5663617002e-84
NCAS0B038508.262ON5883776985e-84
Skud_4.3718.262ON5803556863e-82
NDAI0J013808.262ON6243546883e-82
CAGL0B01771g8.262ON5364196292e-74
Kpol_392.68.262ON4573706205e-74
TPHA0J007408.262ON4083725041e-57
TBLA0E044308.262ON4813674681e-51
KNAG0H032408.262ON5194594594e-50
TPHA0A018108.262ON4574034188e-45
TBLA0F030708.262ON4453784171e-44
NDAI0D03060singletonON1303133840.15
SAKL0B11583g2singletonON1755133790.54
SAKL0F06809g2singletonON1755130790.54
SAKL0C11913g1singletonON1755133790.59
NDAI0D03010na 1ON778142761.2
NDAI0B06160singletonON1403128751.8
Kpol_1035.1singletonON259110732.0
SAKL0D04444g3.234ON20995703.5
Kpol_2000.35singletonON704198714.5
NDAI0G00550singletonON412101697.2
Smik_49.2singletonON550126689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4308
         (529 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...  1062   0.0  
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   644   0.0  
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   449   e-153
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   414   e-139
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   352   e-116
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   346   e-113
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   316   e-102
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   307   7e-98
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   283   5e-88
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   274   5e-86
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   278   7e-86
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   279   7e-86
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   274   2e-84
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   273   5e-84
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   268   3e-82
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   269   3e-82
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   246   2e-74
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   243   5e-74
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   198   1e-57
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   184   1e-51
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   181   4e-50
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   165   8e-45
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   165   1e-44
NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON}              37   0.15 
SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 17...    35   0.54 
SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 175...    35   0.54 
SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)...    35   0.59 
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    34   1.2  
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            33   1.8  
Kpol_1035.1 s1035 complement(2508..3287) [780 bp, 259 aa] {ON} c...    33   2.0  
SAKL0D04444g Chr4 (354890..355519) [630 bp, 209 aa] {ON} highly ...    32   3.5  
Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {O...    32   4.5  
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    31   7.2  
Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B (RE...    31   9.8  

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score = 1062 bits (2747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/529 (96%), Positives = 512/529 (96%)

Query: 1   MSKSDEMLLNPYDAQVGSDGSESFFVFQKITEEGFKVPRFDLNVYQLAPELDHDWLDTGR 60
           MSKSDEMLLNPYDAQVGSDGSESFFVFQKITEEGFKVPRFDLNVYQLAPELDHDWLDTGR
Sbjct: 1   MSKSDEMLLNPYDAQVGSDGSESFFVFQKITEEGFKVPRFDLNVYQLAPELDHDWLDTGR 60

Query: 61  NELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSILQG 120
           NELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSILQG
Sbjct: 61  NELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSILQG 120

Query: 121 NVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYC 180
           NVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYC
Sbjct: 121 NVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYC 180

Query: 181 SHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYH 240
           SHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYH
Sbjct: 181 SHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYH 240

Query: 241 SRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKI 300
           SRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKI
Sbjct: 241 SRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKI 300

Query: 301 GLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLL 360
           GLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLL
Sbjct: 301 GLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLL 360

Query: 361 CNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVVDEDEHGPENDNV 420
           CNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVVDEDEHGPENDNV
Sbjct: 361 CNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVVDEDEHGPENDNV 420

Query: 421 PVTESPSKESMKSSNNIADNLLEPNNNSSIPSKRVLPSEXXXXXXXXXXXXXXXXXVTDK 480
           PVTESPSKESMKSSNNIADNLLEPNNNSSIPSKRVLPSE                 VTDK
Sbjct: 421 PVTESPSKESMKSSNNIADNLLEPNNNSSIPSKRVLPSEKSSIRKNGSKKKINKEKVTDK 480

Query: 481 GKMELSSPLSQAGNQDFQDLSEIPEPSSPYFRNTSISQRSKYADVSIEL 529
           GKMELSSPLSQAGNQDFQDLSEIPEPSSPYFRNTSISQRSKYADVSIEL
Sbjct: 481 GKMELSSPLSQAGNQDFQDLSEIPEPSSPYFRNTSISQRSKYADVSIEL 529

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/535 (60%), Positives = 404/535 (75%), Gaps = 33/535 (6%)

Query: 17  GSDGSESFFVFQKITEEGFKVPRFDLNVYQLAPELDHDWLDTGRNELIKLINTVKGQLTQ 76
           G + S+  FV+Q IT+EGFKVP+ DLN+YQL   L+H+W+D GR EL K++ TVKGQLTQ
Sbjct: 11  GVNDSQPMFVYQYITDEGFKVPQTDLNLYQLDGSLEHEWIDRGRGELRKIMKTVKGQLTQ 70

Query: 77  DIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSILQGNVVDHKREDLPVIEPD 136
           +IY+LI+S+TLSTQ LLECCDKVT  TVENK+VLLKRRY    G V+D KR+D PVIEPD
Sbjct: 71  EIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRYVAKGGIVIDRKRKDAPVIEPD 130

Query: 137 LVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMKRFLRYK 196
            +FD+IM+AHLIN H+PWRK++QH+K LYANVTR+ TN+VT YCSHCN DR+++RF RYK
Sbjct: 131 SLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYK 190

Query: 197 HYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRD 256
           HYNV++K+MPLERCHVE+FAPFDD+G EKI+ KYSH LYCRDYHSRF+W+LPLEGI FR 
Sbjct: 191 HYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRY 250

Query: 257 LVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVT 316
           L+PAL QLLC+MIR+PIFLETATLDRQDMFD+CE IAR+YK KIGLGLNSGT+FQ+NG+ 
Sbjct: 251 LLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIK 310

Query: 317 RIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAHKFKLKQR 376
           R+K L +E+KE+C  +WNMCLRLVL+RVNQ Y+DRVRGIPSDLLCNEI NI+ KFK KQ+
Sbjct: 311 RVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPNISMKFKQKQK 370

Query: 377 KIIDELYAHHVVQFREAGGMIYLEDDNSAFVVDEDEHGPENDNVPVTESP--SKESMK-- 432
           KIID+LYAHHVV F+EAGGMIYLED+ SAFV+D+    P++D  PV E P  + +S++  
Sbjct: 371 KIIDQLYAHHVVHFKEAGGMIYLEDEESAFVMDD----PDDDCTPVPEEPPVASDSIQNS 426

Query: 433 -------SSNNIADN-----------LLEPNNNSSIPSKRVLPSEXXXXXXXXXXXXXXX 474
                  +S  I +N           +  P+ N+   S RV   E               
Sbjct: 427 ATILTPITSTQITENEVARQDPDQLEIRPPSQNNESLSDRVSSEEPPVSKERKKRK---- 482

Query: 475 XXVTDKGKMELSSPLSQAGNQDFQDLSEIPEPSSPYFRNTSISQRSKYADVSIEL 529
             ++ +     SSP S   N+++ + SE+  P S +F+N S SQ  +Y DVS+EL
Sbjct: 483 --ISKRALKTASSP-SPNVNEEYYNNSELAGPGSSFFKNISTSQEPRYGDVSLEL 534

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  449 bits (1155), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 227/438 (51%), Positives = 297/438 (67%), Gaps = 30/438 (6%)

Query: 12  YDAQVGSDGSESFFVFQKITEEGFKVPRFDLNVYQLAPELDHDWLDTGRNELIKLINTVK 71
           Y A   ++ +E  F F         V  FDL  +    ELD D L  GR +L K INTVK
Sbjct: 42  YPASASTESTEPDFKFV------LPVKGFDLGSF--CGELDQDMLIEGRLQLEKEINTVK 93

Query: 72  GQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSILQGNVVDHKREDLP 131
           GQLTQ IY+L+ S+ L+ + LL   DKVT  TVENKFVLLKRRY + +  + D KR+DL 
Sbjct: 94  GQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQENLLHDVKRKDLV 153

Query: 132 VIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMKR 191
           V EP+ +FD+IM+ H++N H+  + I+  L   YANVT+ F  LVT +CS CN   N   
Sbjct: 154 VYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKIS 213

Query: 192 FLRYKHYNVYDKVMPLERCHVEIFAPFDD--DGNE-----KIEDKYSHVLYCRDYHSRFV 244
           + ++KH N++  ++PL RCHVEIFAPFD    GN+     KIE KY  VLYCRDY+SR+V
Sbjct: 214 YKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYV 273

Query: 245 WMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGL 304
           W+ PL+ +T  DL+P +T+LL SMIR+PIF++T TLDRQDMFDVCE IAR YK+KIGLG+
Sbjct: 274 WLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGM 333

Query: 305 NSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEI 364
           NS T FQ+ G+ R+K+LF +HKE+C+ +WNMCL+LV++R+NQNYSDRVRG+PSDLLC+  
Sbjct: 334 NSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQ 393

Query: 365 SNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVV-------DEDEHGPE- 416
            ++  KF+  QR +I  L  HHVVQF EAGGMIYLED+NS  ++       +E EH  E 
Sbjct: 394 QDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLEDENSPNLLLSGDDNSEESEHDSEI 453

Query: 417 -------NDNVPVTESPS 427
                   D  P++E PS
Sbjct: 454 FDELASSRDGTPISEQPS 471

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  414 bits (1064), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 230/538 (42%), Positives = 326/538 (60%), Gaps = 38/538 (7%)

Query: 26  VFQKITEEGFKVPRFDLNVYQLAPELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSN 85
           V  K T   +  P+   +    + +L+ + L+ G  + IK + +VKGQLTQ  YELI ++
Sbjct: 17  VCSKPTNNDYVTPKLGESQVTYSTDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTD 76

Query: 86  TLSTQTLLECCDKVTAGTVENKFVLLKRRYSILQGNVV-DHKREDLPVIEPDLVFDVIMA 144
           TL+ +TLL   D +     E K++ LKRRY +    +V DHKR+D  V EP+L++++I++
Sbjct: 77  TLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVS 136

Query: 145 AHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKV 204
            HL+N HL WRK+H+ LK+ Y+N+TRDF  +   YCS CN    +K F ++KH N Y  +
Sbjct: 137 GHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGL 196

Query: 205 MPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQL 264
           +PLER HVEIF PF  D  E IE+KYSHVLYCRDYHSRFVW+ PL GITF++LVP LT+ 
Sbjct: 197 LPLERIHVEIFKPFGTD--ELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEF 254

Query: 265 LCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAE 324
           L S+ RLPIFLET TLDRQDMFD+CEYIARKY+L IGLGLN+ + F +NG+ R+K L   
Sbjct: 255 LLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQT 314

Query: 325 HKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYA 384
           +K++C K+W MCL+      N  Y+ R+ G  +DLLCNE+S+   KFKLK+ KII EL+A
Sbjct: 315 NKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFA 374

Query: 385 HHVVQFREAGGMIYLEDDNSAFVVDEDEHGPENDNVPVTESPSKES-------------- 430
           H+VV  ++ GGM+Y+E++NS F++++++    N +   + +P   S              
Sbjct: 375 HNVVTLKDTGGMVYVENENSVFIMEDEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPS 434

Query: 431 -----MKSSNN-----IADNLLEPNNNSSI---PSKRVLPSEXXXXXXXXXXXXXXXXXV 477
                +K SN       AD+  +    SS+    SKR    E                  
Sbjct: 435 MGLTPLKGSNGDMLHKTADSTPKVKRTSSLSRASSKRT--GERASLSDTITPTKKVKKVG 492

Query: 478 TDKGKMELSSPLSQA---GNQDFQDLS-EIPEPSSPYFR--NTSISQRSKYADVSIEL 529
            ++ ++  S  + Q     N+D  DLS EIP PS+ +F   N S + R+   D+SIEL
Sbjct: 493 ENRSRLSGSESVEQGNSEANRDEYDLSEEIPGPSTSFFATVNHSRTARADENDISIEL 550

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  352 bits (904), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 176/407 (43%), Positives = 263/407 (64%), Gaps = 17/407 (4%)

Query: 13  DAQVGS--DGSESFFVFQKITEEGFKVPRFDLNVYQLAPELDHDWLDTGRNELIKLINTV 70
           D QVGS  DG     V        F++P+    + +    L+ + L  GR + IK   +V
Sbjct: 2   DKQVGSKVDGRRKDGV-------KFRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESV 54

Query: 71  KGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSI-LQGNVVDHKRED 129
           KGQLTQ+ ++L+ S+ L+ + L+   DK+ +G +E KF+LLKRR+ +   G V D K +D
Sbjct: 55  KGQLTQEQFDLVRSSALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDD 114

Query: 130 LPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNM 189
             V EP+ +FD+IM  HL NGH+ WR++H +L+  YAN TR F  +   YCS CN +  +
Sbjct: 115 TVVCEPESLFDLIMCGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVL 174

Query: 190 KRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPL 249
           + + +++H N+Y  ++PLER HVEI APF     + IE  YSHVLY RDY+SRFVWM PL
Sbjct: 175 RPYRKFRHTNIYSGLLPLERVHVEIIAPFP----KLIEGLYSHVLYLRDYYSRFVWMQPL 230

Query: 250 EGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTD 309
                 ++  A    L S+ R+PIF+ET+TL RQD+F+VCE IA +Y L IGLG++  T 
Sbjct: 231 ASERVSEITKAFLTFLLSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTT 290

Query: 310 FQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAH 369
           FQRNGV R++ L  +++E C+K W+MCL+  +T  N  Y+ RV G+P +LL + +S+   
Sbjct: 291 FQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGR 350

Query: 370 KFKLKQRKIIDELYAHHVVQFREAG---GMIYLEDDNSAFVVDEDEH 413
           +F+LK+ ++I++L+A +VV+ R  G   GMIYLED++SAF + ++E+
Sbjct: 351 QFELKREELIEKLFASNVVELRNEGRRRGMIYLEDESSAFKMPDEEY 397

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  346 bits (887), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 168/383 (43%), Positives = 255/383 (66%), Gaps = 8/383 (2%)

Query: 35  FKVPRFDLNVYQLAPELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLE 94
           F +P     + +    L+ + L+ GR + IK   +VKGQLTQD ++L+ S +L+   L+ 
Sbjct: 19  FDMPAVGEPIEKYHNGLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMT 78

Query: 95  CCDKVTAGTVENKFVLLKRRYSI-LQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLP 153
             DK+ AG VE KF+LLKRRY +   G V D+K  D  V EP+L+FD+IM  HL NGHL 
Sbjct: 79  TSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLH 138

Query: 154 WRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVE 213
           WR++H +L++ YAN TR F  +   YCS CN +  ++ + +++H N+Y  ++PLER HVE
Sbjct: 139 WRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLERVHVE 198

Query: 214 IFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPI 273
           I +PF    +E IE  YSHVL+ RDY+SRFVWM PL+G   RD+   L   L  + R+PI
Sbjct: 199 IISPF----SEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLPRIPI 254

Query: 274 FLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEW 333
           F+ET+T+DRQD+F+ CE +A +Y L IGLG++  + FQ+NGV R++ L   ++EQC++ W
Sbjct: 255 FIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSW 314

Query: 334 NMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREA 393
            MCL+   T  N NY+ R+ G+P +LL + + +   +F+LK+  +I++L+A +VV+ + +
Sbjct: 315 YMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIKVS 374

Query: 394 G---GMIYLEDDNSAFVVDEDEH 413
           G   G+IYLED+ SAF + ++E+
Sbjct: 375 GRRRGIIYLEDETSAFKMPDEEY 397

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  316 bits (810), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 153/354 (43%), Positives = 226/354 (63%), Gaps = 5/354 (1%)

Query: 51  LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVL 110
           ++ + L+ G  +L+K   ++ GQ+   IYELI +N+L+ +TL    DK    + E+K++ 
Sbjct: 56  MNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMF 115

Query: 111 LKRRYSILQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTR 170
           L RRY    G V D ++ D  V EP  +FD+IM AHL+N H+ +R I+  L  +Y+N+TR
Sbjct: 116 LMRRYYAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITR 175

Query: 171 DFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKY 230
           DF  +   YCS CN D + +   +Y+H N++  ++PLER H+EIF  FD   NE I +K+
Sbjct: 176 DFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFD---NESISNKF 232

Query: 231 SHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCE 290
           ++VLYCRDYH+RFVW+ PL+   F+ LV A+  LL  M  +PIF+E++TLD+QD+FD+CE
Sbjct: 233 TNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICE 292

Query: 291 YIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSD 350
            +  KY +K+GLG NS + F  NG+ R+K L    K  CI +WNMCLR     +N+ ++ 
Sbjct: 293 QLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNT 352

Query: 351 RVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNS 404
              GIP+DLL +        F+ KQ  IIDEL A +VV   +  G++YLED+NS
Sbjct: 353 LAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNK--GLLYLEDENS 404

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  307 bits (787), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 168/432 (38%), Positives = 250/432 (57%), Gaps = 22/432 (5%)

Query: 30  ITEEGFKVPRFDLNVYQLAPE-LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLS 88
           + +E + VPR   +        ++ + L  G  E+ K   ++ G LT++ Y+LI +++L+
Sbjct: 42  VIKESYIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLT 101

Query: 89  TQTLLECCDKVTAGTVENKFVLLKRRY-SILQGNVVDHKREDLPVIEPDLVFDVIMAAHL 147
            +TL     K T  T E +++ LKRRY     G + DH R+D  V EP  VFD+IM  HL
Sbjct: 102 PETLASTNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHL 161

Query: 148 INGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPL 207
           +N H   +KIH  L   Y+N+TRD       +CS CN ++ + +  ++KH N+Y+++MPL
Sbjct: 162 MNNHGFVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPL 221

Query: 208 ERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCS 267
           ER H+EIF PF    NEKIE KYSH+LYCRDYHSR++WMLPL+   F+ LVP +  L  S
Sbjct: 222 ERVHIEIFEPF---PNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLS 278

Query: 268 MIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKE 327
            IR PIF+ETA+LD QDMFD+CE IA +Y L+IGLG +    F   G+ ++K     H+E
Sbjct: 279 FIRQPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHRE 338

Query: 328 QCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHV 387
           +C+  WN+CL+      N  ++DR  G+P DLL ++I   + KFK K  +I++   +  V
Sbjct: 339 ECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESV 398

Query: 388 VQFREAGGMIYLEDDN----------SAFVVDEDEHGPEND----NVPVTESPSKESMK- 432
           +  R   G+I+LE D             F  + D+   E D      P TE+ +++SM  
Sbjct: 399 L--RVDNGLIFLEVDEPHDEPHDEPYDEFQFEGDQSIDEEDMGAVMPPATEADAQDSMSL 456

Query: 433 SSNNIADNLLEP 444
           +   + D L +P
Sbjct: 457 TEAYMTDGLPKP 468

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  283 bits (725), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 155/394 (39%), Positives = 226/394 (57%), Gaps = 27/394 (6%)

Query: 56  LDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRY 115
           L+ G  E ++   TV GQLTQ IYELI S+TLS   L E C K    + E ++  L+ RY
Sbjct: 60  LEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANL-ERCHKWKGESSEIEYYYLRSRY 118

Query: 116 SILQ--GNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFT 173
            + +  G V D KR+D  V EP  +F ++M +HL N H+    IH++L   YAN+TRD+ 
Sbjct: 119 FVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYI 178

Query: 174 NLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHV 233
                YCS CN D   K F + +H NVY +++PLER H+E+F PFD    EKI+ ++SH+
Sbjct: 179 VTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFD---GEKIQGRFSHL 235

Query: 234 LYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIA 293
           LY RDY SR+VW+LPL+    + ++ A++  L  + R+PIFLE+ T+DR+ +FD+C  IA
Sbjct: 236 LYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIA 295

Query: 294 RKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVR 353
             Y LK+GLG+ +   F  NG+  +K L   HKE+C+++WN+CL+     +NQN +    
Sbjct: 296 EHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSD 355

Query: 354 GIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVV----- 408
           G P DLL   + +   KF  K+  +I +  +  VV   E  G+++LE++           
Sbjct: 356 GRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGE--GVLFLENNKEEHKTVEAVK 413

Query: 409 ------DEDEHGPENDNVPVTE--------SPSK 428
                 D DE   ENDN   T+        SPSK
Sbjct: 414 ENITHSDPDEERAENDNTNDTQVRIDEGDVSPSK 447

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  274 bits (700), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 140/397 (35%), Positives = 236/397 (59%), Gaps = 9/397 (2%)

Query: 11  PYDAQVGSDGSESFFVFQKITEEG---FKVPRFDLNVYQ-LAPELDHDWLDTGRNELIKL 66
           P   QV  D       F+++   G   F  P+    +Y+ +       +L+ GR    + 
Sbjct: 16  PSSNQVIDDTLAPISEFKEVNRYGKVVFDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEY 75

Query: 67  INTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSILQ-GNVVDH 125
           ++++ G L+Q +YELI  + L   TL E   + +      K + LKRRY + + G V+D 
Sbjct: 76  LDSIIGTLSQTVYELIRDDLLDVDTLSEKT-RWSRINANAKCLYLKRRYKLTKKGTVIDL 134

Query: 126 KREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNT 185
            RE+  V EPDL +D I++ H++N HL ++ IH+ LK +Y+N++RD+  +V  +CSHCN 
Sbjct: 135 TRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNP 194

Query: 186 DRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVW 245
           D+ +    +  H N+Y+K +PLER  ++IF PF+   NEKI+++YSH++Y RDY SRFVW
Sbjct: 195 DKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFE---NEKIQNRYSHIIYIRDYRSRFVW 251

Query: 246 MLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLN 305
           + PL+   F+ L   +  LL  + R+PI+++T T++R+DM  +C+ IA KY++ +G+G  
Sbjct: 252 IYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTI 311

Query: 306 SGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEIS 365
             + F   G++R+K L  E+K++C+K+WNMCL+L     N+      RG+PS+L  +E+ 
Sbjct: 312 EPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGVPSELFLDEME 371

Query: 366 NIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDD 402
             A  F+ K+ +II+ L   +  +     G++Y +D+
Sbjct: 372 CSATTFESKRTEIINSLPIQNSYKTSTNKGLVYAQDE 408

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  278 bits (710), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 213/355 (60%), Gaps = 4/355 (1%)

Query: 51  LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVL 110
           L+ + L+ G  E    + ++  QLTQ IYELI + +L+  TL +  DK      ENK + 
Sbjct: 65  LNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLF 124

Query: 111 LKRRYSIL-QGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVT 169
           L+R+Y +  +GNV D +  D    EP+ ++D++MA HLIN HL  + +H  L + +AN++
Sbjct: 125 LQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANIS 184

Query: 170 RDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDK 229
               + V  +CS CN    +K    YK  ++YDK++P+ER H+E+F PF     E IE K
Sbjct: 185 HAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPF---SGETIEGK 241

Query: 230 YSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVC 289
           YS+VL CRDY S F+W+LPL+   F+ L+P ++ L  S  R+PIF+ ++TLD+ D++D+C
Sbjct: 242 YSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDIC 301

Query: 290 EYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYS 349
           E IA KY L+IGLGL S   F   G+  I      +KE+C+ +W  CLR    R N+  +
Sbjct: 302 EEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYRFNRRRN 361

Query: 350 DRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNS 404
            R +  P+ +L +EI     KF+ K+ ++I+  Y+ ++ +     G+IYLED N+
Sbjct: 362 KRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNT 416

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  279 bits (714), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 137/363 (37%), Positives = 217/363 (59%), Gaps = 4/363 (1%)

Query: 51  LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVL 110
           L+ + L+ G  E    + ++  QLTQ IYELI + +L+ +TL +  DK      ENK + 
Sbjct: 116 LNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAENKLLF 175

Query: 111 LKRRYSI-LQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVT 169
           L+R+Y +  +GNV D +  D    EP  ++D++MA HL+N HL  + +H  L + +AN +
Sbjct: 176 LERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTS 235

Query: 170 RDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDK 229
               + V  +CS CN    +K    YK  ++YDK++P+ER H+E+F P+   G + IE K
Sbjct: 236 HAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPY---GGKAIEGK 292

Query: 230 YSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVC 289
           Y +VL CRDY S F+W+LPL+   F+ L+P ++ L  S  R+PIF+ ++TLD+ D++D+C
Sbjct: 293 YPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYDIC 352

Query: 290 EYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYS 349
           E IA KY L+IGLGL S   F   G+  I+     +KE+C+ +W  CLR    R N+  +
Sbjct: 353 EEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRN 412

Query: 350 DRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVVD 409
            R +  P+ +L +E+     KF+ K+ ++I+  YA ++       G+IYLED N+  +V+
Sbjct: 413 KRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFALVN 472

Query: 410 EDE 412
           E E
Sbjct: 473 EGE 475

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  274 bits (700), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 135/361 (37%), Positives = 216/361 (59%), Gaps = 4/361 (1%)

Query: 51  LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVL 110
           L+ + L+ G  E    + ++  QLTQ IYELI + +L+  TL +  DK      ENK + 
Sbjct: 63  LNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLF 122

Query: 111 LKRRYSIL-QGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVT 169
           L+R+Y +  +GNV D +  D    EP  V+D++MA HL+N HL  + +H  L + +AN++
Sbjct: 123 LQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANIS 182

Query: 170 RDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDK 229
               + V  +CS CN    +K    YK  ++YDK++P+ER H+E+F PF+    E IE K
Sbjct: 183 HAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFN---GEAIEGK 239

Query: 230 YSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVC 289
           YS+VL CRDY S F+W+LPL+   F+ L+P ++ L  +  R+PIF+ ++TLD+ D++D+C
Sbjct: 240 YSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDIC 299

Query: 290 EYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYS 349
           E IA KY L+IGLGL S   F   G+  I+     +K++C+ +W  CLR    R N+  +
Sbjct: 300 EEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRRRN 359

Query: 350 DRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVVD 409
            R +  P  +L +E+     KF+ K+ ++I+  Y+ ++ +     G+IYLED N+  + +
Sbjct: 360 KRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALAN 419

Query: 410 E 410
           E
Sbjct: 420 E 420

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  273 bits (698), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 145/377 (38%), Positives = 213/377 (56%), Gaps = 11/377 (2%)

Query: 50  ELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFV 109
           ++D  ++  G  E  +   T+ GQL +  YELI +N+L+ +TL     K+      ++ V
Sbjct: 98  DMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSATALKMDKFRAASRLV 157

Query: 110 LLKRRYSI-LQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANV 168
            L RRY +  QGNV D  R++  V EP  ++D+IM  HLIN H   RK HQ L  +Y+N+
Sbjct: 158 FLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGRPRKCHQLLGPMYSNI 217

Query: 169 TRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIED 228
           TR F   +  +CS CN  +    F +YKH N +  ++PLER  VE+F PF     EK+  
Sbjct: 218 TRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVEVFEPFP---GEKLGG 274

Query: 229 KYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDV 288
           KY  +LY RDY SRF+WM+PL    F  LV  +++++ SMIR+PIF ET T++ QD FD+
Sbjct: 275 KYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFETTTIENQDFFDI 334

Query: 289 CEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNY 348
            E I  KY++ IGLG   G     NG+ +I+ L   HKE+C+ +W MCL+      N   
Sbjct: 335 FEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWIMCLKYGPHTFNNKM 394

Query: 349 SDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDN----- 403
           +DR  G+P DLL  +I ++  K   K  +I+ +L   ++V+     G IYLED N     
Sbjct: 395 NDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI--GRGCIYLEDRNPEDPE 452

Query: 404 SAFVVDEDEHGPENDNV 420
           + +  + D+     DNV
Sbjct: 453 AEYEANTDDESDTEDNV 469

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  268 bits (686), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 133/355 (37%), Positives = 209/355 (58%), Gaps = 4/355 (1%)

Query: 51  LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVL 110
           L+ + L+ G  E    + ++  QLTQ IYELI + +L+  TL +  DK      ENK + 
Sbjct: 66  LNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAENKLLF 125

Query: 111 LKRRYSI-LQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVT 169
           L+R+Y +  +GNV D +  D    EP  ++D++MA HL+N HL  + +H  L + +AN +
Sbjct: 126 LQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHFANTS 185

Query: 170 RDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDK 229
               + V  +CS CN    +K    YK  ++YDK++P+ER H+E+F PF       IE K
Sbjct: 186 HAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGA---IEGK 242

Query: 230 YSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVC 289
           Y +VL CRDY S F+W+LPL+   F+ L+P ++ L  S  R+PIF+ ++TLD+ D++D+C
Sbjct: 243 YPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDIC 302

Query: 290 EYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYS 349
           E IA KY L IGLGL S   F   G+  I+     +KE+C+ +W  CLR    R N+  +
Sbjct: 303 EEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRN 362

Query: 350 DRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNS 404
            R +  P+ +L +E+     KF+ K+ ++I+  Y+ ++ +     G+IYLED N+
Sbjct: 363 KRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNT 417

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  269 bits (688), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 137/354 (38%), Positives = 212/354 (59%), Gaps = 9/354 (2%)

Query: 49  PELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKF 108
           PE+D D L  G    +    ++ GQL + +YELI + +L+ +TL        A T   + 
Sbjct: 106 PEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLAANFPHFHAPT---RC 162

Query: 109 VLLKRRY-SILQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYAN 167
            L KRRY +  +G V D  R +  V +P L+++++M  HL+N H  +R+ H  L ++YAN
Sbjct: 163 ALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIYAN 222

Query: 168 VTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIE 227
           +TRDF      +CS CN  + +   L++KH N Y  ++PLER H+EIF PF+    +KIE
Sbjct: 223 ITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFN---GKKIE 279

Query: 228 DKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFD 287
            KYSHV+YCRDY SR++ + PL+   F++LV A+ +LL ++ R+PIF+ET +L+ QD FD
Sbjct: 280 GKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLNTQDAFD 339

Query: 288 VCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQN 347
           + E I  KY++ +GLG+ +   F   GV ++K L   H+++C+ +W MCL+      N  
Sbjct: 340 IFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMCLKYGPHNYNTK 399

Query: 348 YSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLED 401
           ++DR  G+P DLL   + ++ HK   K  +II  L   ++VQ     G IYLE+
Sbjct: 400 HNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQI--GNGSIYLEE 451

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  246 bits (629), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 136/419 (32%), Positives = 231/419 (55%), Gaps = 18/419 (4%)

Query: 51  LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFV- 109
           +D D+L  G  ++ +    + G+LTQ+ Y L+ +N L+ +T+++  +       E K+  
Sbjct: 80  IDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMNIWPPNAAETKYSN 139

Query: 110 LLKRRYSILQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVT 169
           L+KR Y   +GN+ D K ++  V+EPD +F++I+ AHL NGHL    + Q L+ +YAN T
Sbjct: 140 LIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANCT 199

Query: 170 RDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNE----- 224
           RDF      YC+ CN DR +K   + +H N+ ++++PLER H+E+FAPF+ +  +     
Sbjct: 200 RDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQED 259

Query: 225 ------KIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIR-LPIFLET 277
                 KIE KYSHV YCRD+ +R+VW  PL+ + F+ LV  +     +++   PIF+E+
Sbjct: 260 SQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVES 319

Query: 278 ATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCL 337
           +T+DR D+ ++ E +A KY LK+GLG  + T F   G+ R K      K +C  +W MCL
Sbjct: 320 STIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKRFKTHLHRAKSECADDWLMCL 379

Query: 338 RLVLTRVNQNYSDRVRGIPSDLLCNEI-SNIAHKFKLKQRKIIDELYAHHVVQFREAGGM 396
           +      N+   +R  G  S++L  E+        + K+ K I++ ++ ++  + ++GG 
Sbjct: 380 KQGTYSANR-VIERQLGKASNILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGC 438

Query: 397 IYLE--DDNSAFVVDEDEHGPENDNVPVTESPSKESMKSSNNIADNLLEPNNNSSIPSK 453
           I++E   D    +   D  G         + P++++  S   +A N    NN S+  +K
Sbjct: 439 IFIEHVQDYEKTMESIDRTGTYKSGRKADQLPAEDTPTSHEPVA-NTTAINNRSTKANK 496

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  243 bits (620), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 130/370 (35%), Positives = 216/370 (58%), Gaps = 9/370 (2%)

Query: 51  LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVEN-KFV 109
           L+ +  + G  +L K  +T+ G L+Q IY+LI ++ L+ + +    +KV      N K+ 
Sbjct: 77  LNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSR--EKVKWANKSNEKYY 134

Query: 110 LLKRRYSIL-QGNVVDHKREDLPVI-EPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYAN 167
            LK RY +  +G  V  +R D  ++  P+ V +V++  HLIN H   + +H++L   YAN
Sbjct: 135 FLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYAN 194

Query: 168 VTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIE 227
           ++R  T +  LYCS CN   ++K   + K   VY+ ++P ER H+EIF PF D+  + IE
Sbjct: 195 ISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDE--KLIE 252

Query: 228 DKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFD 287
             YSH+LY RDY+SR+VW+ PL+   F++L   L     ++ + PI++E++T++R D+  
Sbjct: 253 GTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIA 312

Query: 288 VCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQN 347
           + + IA KY L+IG+G+ + + F  NG+  +K L   H+++C+ +W MCL+      N  
Sbjct: 313 MVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNL 372

Query: 348 YSDRVRGIPSDLLCNE-ISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDD-NSA 405
            + +V G+P +LL N  IS  + K+K K+  +IDE + H+++        IYLED+  S 
Sbjct: 373 KNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLEDNLTST 432

Query: 406 FVVDEDEHGP 415
            V+DE    P
Sbjct: 433 PVIDEKNIEP 442

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  198 bits (504), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/372 (29%), Positives = 193/372 (51%), Gaps = 11/372 (2%)

Query: 37  VPRFD-LNVYQLAPELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLEC 95
           +P  D L   +L  ++D + ++ GRN+ ++L +     LTQ +Y LI     + +T  E 
Sbjct: 24  IPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEA 83

Query: 96  CDKVTA------GTVENKFVLLKRRYSILQ-GNVVDHKREDLPVIEPDLVFDVIMAAHLI 148
                       GT   KF+L++ RY + + G + D + +   ++ P+ ++D+IM  H +
Sbjct: 84  MKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFL 143

Query: 149 NGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLE 208
           N HL   KIH  L+  Y+N++R    L    CSHCN     K     +H++  DK    E
Sbjct: 144 NDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSC-DKNFAFE 202

Query: 209 RCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSM 268
           + HVEIF PF+D   +   +K+SHV+Y RDY +R+VW+ PLE I+ ++L   L   L   
Sbjct: 203 KIHVEIFQPFEDV--DTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLS 260

Query: 269 IRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQ 328
           +R+PI++E+ TLD  ++  + + I++   L +G+G     +FQ +G+  +K LF +++E 
Sbjct: 261 LRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREY 320

Query: 329 CIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVV 388
           C   WN  +       N  Y+  + GIP +L+  E       +K K+++ I    + + +
Sbjct: 321 CGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSKNTI 380

Query: 389 QFREAGGMIYLE 400
             +     +Y E
Sbjct: 381 LLKNGKSALYKE 392

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  184 bits (468), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 204/367 (55%), Gaps = 18/367 (4%)

Query: 54  DWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGT-VENKFVLLK 112
           + L+ G  ++ +  +     LTQ+  +++++ TLS + +++   K+T  +    K+    
Sbjct: 53  ELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTS 112

Query: 113 RRYSILQ-GNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRD 171
           RRY + +  N++D ++    + EP  ++D+++A HL   H  +  + + LK  ++NV R 
Sbjct: 113 RRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL-KLHSSY-AVSERLKKFFSNVGRQ 170

Query: 172 FTNLVTLYCSHCNTDR--NMKRF---LRYKHY--NVYDK-VMPLERCHVEIFAPFDDDGN 223
           + +    YCS C  D   +MK F   + +K+   N+ D+ + P+ER H+EIF PFDD   
Sbjct: 171 YIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDD--- 227

Query: 224 EKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSM-IRLPIFLETATLDR 282
            KIE+KY  +LY RDY +R++W   L+ +  + +   LT+   S+   +PIFL+++T+D 
Sbjct: 228 LKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDN 287

Query: 283 QDMFDVCEYIARKYKLKIGLGLNSGTD-FQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVL 341
            D+FD+CE I+R+Y + +GLG N+  D F  +G+   K L   +K +C+K W+  L    
Sbjct: 288 TDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGS 347

Query: 342 TRVNQNYSDRVRGIPSDLL-CNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLE 400
              N  ++ R+   P D++ CN ++    KF+ ++ +II +    + V+      +I++E
Sbjct: 348 VLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIE 407

Query: 401 DDNSAFV 407
           D+ ++  
Sbjct: 408 DEATSIA 414

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  181 bits (459), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 131/459 (28%), Positives = 223/459 (48%), Gaps = 26/459 (5%)

Query: 4   SDEMLLNPYDAQVGSDGSESFFVFQKITEEGFK-VPRFDLNVYQLAPE-LDHDWLDTGRN 61
           ++E   NPYD     D  ES F     TE   K VP         A E LD ++   G  
Sbjct: 10  TEEFERNPYDV----DRIESSFS----TETNPKLVPVIGDKWSNYADEKLDIEFCKRGER 61

Query: 62  ELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRY-SILQG 120
           ++     T  G+++Q++Y L  ++ ++ + +        +G    K + + RRY     G
Sbjct: 62  DITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDANG 121

Query: 121 NVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYC 180
            + D    +  V +P   FD+IM+ HL+N HL   ++++ L+  YAN           YC
Sbjct: 122 MIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYC 181

Query: 181 SHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYH 240
           S CN    +   ++ K Y +++K +PLER  +EI  PF    NEK+E KYS+++  +D+ 
Sbjct: 182 SVCNPSLKLTPKVQPKPY-LFEKALPLERITIEIIEPFP---NEKVEGKYSNMVVMKDFI 237

Query: 241 SRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKI 300
            RF W+ PL+   F+++VP + +++ S  R+PI++E+ TLD  D+FD+ E I  KY +KI
Sbjct: 238 GRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKI 297

Query: 301 GLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLL 360
           GLG  + +   +    RI     +H ++C+ ++N CL+   T+ NQ         P D++
Sbjct: 298 GLGCTTRSSAAQ-ATARINRDLNDHHDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDII 356

Query: 361 CNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVVDEDEHGPENDNV 420
            +  + +  KF+ K+  I+    +  V+      G +YLE  N    + ED      D +
Sbjct: 357 SHSETQLKAKFRAKRAFILKHSPSSCVMN--RGMGTLYLESPNG---IQEDAAASSADEL 411

Query: 421 PVTESPSKE-----SMKSSNNIADNLLEPNNNSSIPSKR 454
              +    E     + + S N  ++  EP  + S  SK+
Sbjct: 412 SSAKDAEDEERDNSTREGSGNGEESDTEPAVDHSRRSKK 450

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  165 bits (418), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 110/403 (27%), Positives = 204/403 (50%), Gaps = 25/403 (6%)

Query: 47  LAPELDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVEN 106
           + P LD   L  G    I + N+    L++++Y+L+ ++ L+ + +    +      +  
Sbjct: 44  ITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEKNAITR 100

Query: 107 KFVLLKRRYSILQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYA 166
              L  R Y   +  V D  +++  VI+P   F ++M  HL+N HL    I++ L   +A
Sbjct: 101 LIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFA 160

Query: 167 NVTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKI 226
           N++  F      YCS CN+++   R  +    +    ++  ER  +++ APF   G +KI
Sbjct: 161 NLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLILDVVAPF---GAKKI 217

Query: 227 EDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMF 286
           + +Y+H+L   D+H++F+W  PL+ +  R ++  +T+ + ++   P+F+ + TL   D+F
Sbjct: 218 QKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVFISSFTLSLNDIF 277

Query: 287 DVCEYIARKYKLKIGLGL-NSGTDFQRNG-VTRIKNLFAEHKEQCIKEWNMCLRLVLTRV 344
           ++C Y+AR+Y + IGLG  N    + +N  VTRI N    HK +C+K W MCL+ +  R 
Sbjct: 278 ELCCYLAREYNISIGLGTRNMQKAYSKNPYVTRILN---SHKTECLKSWFMCLKWLADRQ 334

Query: 345 NQNYSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNS 404
           + +  D      +  L + +++   K++ + + II  L + + +   E    IY ED+ S
Sbjct: 335 SNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINIDEGSHFIYSEDEFS 394

Query: 405 AFVVDEDEHGPENDNVPVTESPSK--ESMKSSNNIADNLLEPN 445
                        DN+   E+P K  ES+ +S+  +D+  E N
Sbjct: 395 F------------DNLVEKETPKKLSESVVNSSEDSDDNYEDN 425

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  165 bits (417), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 113/378 (29%), Positives = 197/378 (52%), Gaps = 16/378 (4%)

Query: 51  LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAG--TVENKF 108
           +D D L  G  E ++  NT+K  +T D+Y       +  ++LLE    + A      +K 
Sbjct: 45  IDSDMLKRGEKETMEFRNTLKKHITSDLYY-----AMRDESLLEDDAPIPASLKIKTSKK 99

Query: 109 VLLKRRYSI-LQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYAN 167
           + L+ RYS    G++++ K   L + EP  ++ + M AH +N H+   K++++L   Y N
Sbjct: 100 MYLQIRYSKNSDGDLIETKTNKL-LCEPKYIYKLTMKAHFMNNHMRSNKLYRNLSMKYCN 158

Query: 168 VTRDFTNLVTLYCSHCNTDRNMKRFL-RYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKI 226
           +      LV  YCSHCNT   ++     Y   N Y   +PLER  ++I  PF+D  + KI
Sbjct: 159 IPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDITKPFND-SDIKI 217

Query: 227 EDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMF 286
            +KYSH+L  RDYHSR+ W+ PL+    +++   L + L ++ R PIFL +  +    + 
Sbjct: 218 ANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFLHSIGIPESQLI 277

Query: 287 DVCEYIARKYKLKIGLGLNSGTD--FQRNGVTRIKNL--FAEHKEQCIKEWNMCLRLVLT 342
            +   I  +YK+KI +G+       F R G++R+  L    E+KE+C  +W  C+R    
Sbjct: 278 KILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENKEKCKSDWYQCIRNTTF 337

Query: 343 RVNQNYSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDD 402
           + N+ +        + L+  + + +   F+ K+  ++ +L   +V++  E G +IY +++
Sbjct: 338 KENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIGECGSIIYFDNN 397

Query: 403 NSAFVVDE-DEHGPENDN 419
           NS   +DE D +G  N+N
Sbjct: 398 NSGKELDEKDVNGGVNEN 415

>NDAI0D03060 Chr4 (723016..726927) [3912 bp, 1303 aa] {ON} 
          Length = 1303

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 59/133 (44%), Gaps = 16/133 (12%)

Query: 146 HLINGHLPWRKIHQHLKN-LYANVTR---DFTNLVTLYCSHCNTDRNMKR----FLRYKH 197
           H + GH+  + + Q +KN  + + T    D+T + T  C  C   ++ K       R K+
Sbjct: 346 HRLLGHVNVKSLQQSIKNKTFDHFTIEDIDWTGISTFQCITCLQGKSRKHNHTVGSRLKY 405

Query: 198 YNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDL 257
              Y+   P +  H ++F P   D     +   S  +   D  +RF W+ PLE  T   +
Sbjct: 406 QKNYE---PFQYIHTDVFGPVSVD-----KPYPSWFVAFTDEATRFRWVFPLENKTADLM 457

Query: 258 VPALTQLLCSMIR 270
           +  +T L+ ++ R
Sbjct: 458 LHVITALVNTIKR 470

>SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 54/133 (40%), Gaps = 15/133 (11%)

Query: 146 HLINGHLPWRKIHQHLKNLYANVTR----DFTNLVTLYCSHCNTDRNMK----RFLRYKH 197
           H + GH   + I   LKN      +    D++   T  C  C   ++ K    +  R K+
Sbjct: 599 HRMLGHANAQTIRNSLKNNSITYLKESDVDWSKATTYQCPDCLIGKSTKHRHVKGSRVKY 658

Query: 198 YNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDL 257
            N Y+   P +  H +IF P  +      +   S+ +   D  +RF W+ PL     + +
Sbjct: 659 QNSYE---PFQYLHTDIFGPVHN----LPKSAPSYFITFTDEKTRFQWVYPLHDRREQSI 711

Query: 258 VPALTQLLCSMIR 270
           +   T +L  + R
Sbjct: 712 LEVFTTILAFIER 724

>SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 51/130 (39%), Gaps = 9/130 (6%)

Query: 146 HLINGHLPWRKIHQHLKNLYANVTR----DFTNLVTLYCSHCNTDRNMK-RFLRYKHYNV 200
           H + GH   + I   LKN      +    D++   T  C  C   ++ K R ++      
Sbjct: 599 HRMLGHANAQTIRNSLKNNSITYLKESDVDWSKATTYQCPDCLIGKSTKHRHVKGSRVKY 658

Query: 201 YDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPA 260
            D   P +  H +IF P  +      +   S+ +   D  +RF W+ PL     + ++  
Sbjct: 659 QDSYEPFQYLHTDIFGPVHN----LPKSAPSYFITFTDEKTRFQWVYPLHDRREQSILEV 714

Query: 261 LTQLLCSMIR 270
            T +L  + R
Sbjct: 715 FTTILAFIER 724

>SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)
           [5268 bp, 1755 aa] {ON} Retrotransposon Gag and Pol
           genes
          Length = 1755

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 54/133 (40%), Gaps = 15/133 (11%)

Query: 146 HLINGHLPWRKIHQHLKNLYANVTR----DFTNLVTLYCSHCNTDRNMK----RFLRYKH 197
           H + GH   + I   LKN      +    D++   T  C  C   ++ K    +  R K+
Sbjct: 599 HRMLGHANAQTIRNSLKNNSITYLKESDVDWSKATTYQCPDCLIGKSTKHRHVKGSRVKY 658

Query: 198 YNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDL 257
            N Y+   P +  H +IF P  +      +   S+ +   D  +RF W+ PL     + +
Sbjct: 659 QNSYE---PFQYLHTDIFGPVHN----LPKSAPSYFITFTDEKTRFQWVYPLHDRREQSI 711

Query: 258 VPALTQLLCSMIR 270
           +   T +L  + R
Sbjct: 712 LEVFTTILAFIER 724

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 56/142 (39%), Gaps = 22/142 (15%)

Query: 125 HKREDLPVIEPDLVFDVIMAAH--------LINGHLPWRKIHQHLKNLYANVTRDFTNLV 176
           H ++ L    P L+  VI   H         +  H    +I   L   Y N+++   + V
Sbjct: 148 HNKKKLIWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDV 207

Query: 177 TLYCSHCNTDRNMKRFLRYKHYNVYD-KVMPL-----ERCHVEIFAPFDDDG-NEKIEDK 229
              C  C       + L  K +N+    V+PL     +R  V+I +  D      K    
Sbjct: 208 VAACPDC-------KPLSSKKFNITRVNVLPLTRYSFQRLQVKILSAADYSCVCPKDNCT 260

Query: 230 YSHVLYCRDYHSRFVWMLPLEG 251
            + +LY  DYHS  VW+  L+G
Sbjct: 261 KNAILYIGDYHSGAVWLFALDG 282

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 53/128 (41%), Gaps = 15/128 (11%)

Query: 146 HLINGHLPWRKIHQHLKNLYANVTR----DFTNLVTLYCSHCNTDRNMKR----FLRYKH 197
           H + GH+  + I + +++      R    D++ +    C  C   +  K       R K+
Sbjct: 310 HRLFGHINVKDIRKSIESKLITNIRINDVDWSGIDKFQCKDCLAGKITKHKHIVGSRLKY 369

Query: 198 YNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDL 257
              Y+   P E  H ++F P    G +    KY   +   D ++RF W+ PL+      +
Sbjct: 370 QKSYE---PFEYIHTDLFGPVS--GVDITSPKY--FISFTDENTRFRWVFPLKKKDADHI 422

Query: 258 VPALTQLL 265
           +P   QL+
Sbjct: 423 LPIFQQLV 430

>Kpol_1035.1 s1035 complement(2508..3287) [780 bp, 259 aa] {ON}
           complement(2508..3287) [780 nt, 260 aa]
          Length = 259

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 49/110 (44%), Gaps = 9/110 (8%)

Query: 129 DLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLY---ANVTRDFTNLVTLYCSHCNT 185
           ++ + +PD+    ++ AHL   HLP + I + +KN +    N  +D  +   L+C  C+ 
Sbjct: 151 NIKINKPDIS---LLEAHLRLNHLPSQVIQKSVKNNFFYDVNEIKDHKSTKNLWCQTCSA 207

Query: 186 DRNMKRFLRYKHYNVYDKVM-PLERCHVEIFAPFDDDGNEKIEDKYSHVL 234
            +  + F      N Y  +  P     ++ F P       K +DKY  V+
Sbjct: 208 GKMTRHFHYTDTMNHYSSIKEPGSSWSLDTFGPVKP--TPKNDDKYMLVM 255

>SAKL0D04444g Chr4 (354890..355519) [630 bp, 209 aa] {ON} highly
           similar to uniprot|Q12488 Saccharomyces cerevisiae
           YDR013W PSF1 Subunit of the GINS complex (Sld5p Psf1p
           Psf2p Psf3p) which binds to DNA replication origins and
           facilitates assembly of the DNA replication machinery
          Length = 209

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

Query: 102 GTVENKFVLLKRRYSILQGNVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHL 161
           G + NK VL  +R   L  N+       LP+ + DL+ +V+     +  +  + K  Q +
Sbjct: 3   GDLANKLVLEAKRTQQLSSNISSGTNGHLPMYQEDLIRNVLKEISQLKKNAEFLKEQQMI 62

Query: 162 KNLYANVTRDFTNLVTLYCSHCNTDRNMKRFLRYK 196
           +     +T+     VTL C     +RN +  L Y+
Sbjct: 63  QGYDDKITK-CQYFVTLLC----MERNKRCLLAYQ 92

>Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {ON}
           complement(68315..70429) [2115 nt, 705 aa]
          Length = 704

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 81/198 (40%), Gaps = 27/198 (13%)

Query: 207 LERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLC 266
             R H++   P  D      +D Y + L   DY S  + + PL   TF   V  + + + 
Sbjct: 379 FSRWHLDFAGPLKD------KDGYKYFLLAADYTSNLILVKPLREQTFHS-VYEIMRAIY 431

Query: 267 SMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHK 326
           ++   P  L T    RQ    +   +AR  KLK          +Q +      N  AE  
Sbjct: 432 AIFGSPHMLITDN-GRQFANAIIPQVARSLKLKY---------YQSSAYHPRGNSKAERS 481

Query: 327 EQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAHKFKLKQRKIIDELYAHH 386
            + IKE       VL +++  +++ V  I   +  N ++N    +    R+I   L + +
Sbjct: 482 VKMIKE-------VLKKLDPTFTNWVTNI--FVAANIVNNTKMLYGYSPREIAFGLPSEN 532

Query: 387 V-VQFREAGGMIYLEDDN 403
           + V F++A   +  +++N
Sbjct: 533 IEVDFQQAVKSLLQKENN 550

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 43/101 (42%), Gaps = 15/101 (14%)

Query: 171 DFTNLVTLYCSHCNTDRNMKR------FLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNE 224
           D+T +    C  C   +  K        L+Y+ Y  Y+   P E  H ++F P    G +
Sbjct: 254 DWTGIDKFQCKDCLAGKLTKHKHIVGSRLKYQKY--YE---PFEYIHTDLFGPVS--GVD 306

Query: 225 KIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLL 265
               KY   +   D ++RF W+ PL+      ++P   QL+
Sbjct: 307 ITSPKY--FISFTDENTRFRWVFPLKKKDADHILPIFQQLV 345

>Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 550

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 49/126 (38%), Gaps = 9/126 (7%)

Query: 146 HLINGHLPWRKIHQHLKNLYANVTRD----FTNLVTLYCSHCNTDRNMK-RFLRYKHYNV 200
           H + GH   + I + LK       ++    ++N  T  C  C   ++ K R ++      
Sbjct: 171 HRMLGHANVQSIQKSLKKNAVTYLKESDIEWSNASTYQCPDCLIGKSTKHRHVKGSRLKY 230

Query: 201 YDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPA 260
            +   P +  H +IF P     +   +   S+ +   D  +RF W+ PL       ++  
Sbjct: 231 QESYEPFQYLHTDIFGPV----HHLPKSAPSYFISFTDEKTRFQWVYPLHDRREESILNV 286

Query: 261 LTQLLC 266
            T LL 
Sbjct: 287 FTSLLA 292

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,307,249
Number of extensions: 2898768
Number of successful extensions: 10884
Number of sequences better than 10.0: 70
Number of HSP's gapped: 11210
Number of HSP's successfully gapped: 70
Length of query: 529
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 415
Effective length of database: 40,409,475
Effective search space: 16769932125
Effective search space used: 16769932125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)