Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43078.263ON53453428460.0
SAKL0H17006g8.263ON53151118470.0
TDEL0F039008.263ON55950117600.0
KLLA0F19162g8.263ON52849417510.0
ZYRO0C01628g8.263ON53450217040.0
KNAG0G020408.263ON59151317070.0
AGR085W8.263ON52152116890.0
KLTH0G13662g8.263ON51950916770.0
YLR089C (ALT1)8.263ON59252116840.0
NCAS0B050208.263ON56848816750.0
Skud_12.1578.263ON59252116740.0
Suva_10.1738.263ON59252116720.0
NDAI0B019908.263ON58850316680.0
Smik_12.1488.263ON59252116640.0
Kwal_56.237918.263ON51851316510.0
TPHA0J007508.263ON52250616340.0
Skud_4.3728.263ON50749116300.0
Smik_4.3578.263ON50750016290.0
KNAG0M012108.263ON52149516290.0
NCAS0B038408.263ON49748816190.0
CAGL0L12254g8.263ON57448616180.0
YDR111C (ALT2)8.263ON50749115920.0
Suva_2.2718.263ON50750115880.0
Kpol_392.58.263ON51250415800.0
KAFR0B027308.263ON53948915820.0
KAFR0B05520singletonON51048815770.0
TBLA0E044408.263ON56249515780.0
KAFR0B055308.263ON51448915570.0
NDAI0J013608.263ON50148815500.0
TPHA0A018008.263ON49848915320.0
Kpol_543.398.263ON49249115300.0
TBLA0F030608.263ON50049314290.0
TBLA0G01630singletonON50049314160.0
Kwal_34.160181.472ON3791531552e-10
KNAG0B053201.321ON4333541473e-09
Kwal_14.25741.321ON4434381439e-09
AEL170C1.321ON4583281421e-08
KLLA0F03509g2.252ON3871961411e-08
TPHA0O014501.321ON4433581383e-08
CAGL0J05126g1.321ON4333511357e-08
SAKL0D11528g1.472ON3831601349e-08
Suva_6.1361.321ON4444091341e-07
KLTH0G09614g2.252ON3891731321e-07
KLLA0F01617g1.321ON4443541322e-07
NDAI0G057601.321ON4484091294e-07
TDEL0D019001.321ON4433561277e-07
NCAS0A092001.321ON4453721278e-07
Smik_10.1801.321ON4443511261e-06
YJL060W (BNA3)1.321ON4444091261e-06
Skud_10.1561.321ON4603281251e-06
Kpol_1035.231.321ON4443811251e-06
KLTH0H10648g1.321ON4433751251e-06
KLLA0F10021g3.511ON4972641251e-06
KAFR0A017101.321ON4353751242e-06
ADL249W2.252ON3872021242e-06
SAKL0F02156g3.511ON4982551223e-06
Ecym_32902.252ON3862171213e-06
KLTH0G19646g1.472ON3791511205e-06
Kpol_1039.222.252ON3861741196e-06
Kwal_23.48882.252ON3891731152e-05
KNAG0B006603.511ON4961921152e-05
TPHA0F012602.252ON3921471143e-05
ZYRO0G20636g1.321ON4534061124e-05
TPHA0D033703.511ON4972131125e-05
NDAI0B045502.102ON5651821117e-05
ZYRO0A01672g2.252ON3861541108e-05
CAGL0G01254g3.511ON5042281101e-04
TBLA0B009902.102ON5461801101e-04
Kpol_278.23.511ON4981501091e-04
Smik_7.693.511ON5002271072e-04
KLTH0G02002g3.511ON4961591072e-04
Ecym_6319singletonON3542901062e-04
NDAI0I028303.511ON5001851062e-04
YGL202W (ARO8)3.511ON5002271063e-04
Skud_7.693.511ON5002271053e-04
Kwal_47.189823.511ON4962901045e-04
SAKL0E02948g2.475ON4232921045e-04
KAFR0J015802.252ON3831471035e-04
Suva_7.613.511ON5002271037e-04
SAKL0D06886g1.321ON4473301027e-04
SAKL0E08492g2.252ON3841281027e-04
KLTH0B06270g2.102ON5251371029e-04
YIL116W (HIS5)2.252ON3851411010.001
Kwal_26.77682.475ON4222821000.001
CAGL0G06028g2.102ON537151990.002
NCAS0G040501.472ON384161990.002
TDEL0C040902.252ON383148980.002
KNAG0E018502.252ON384152980.002
Skud_8.1982.102ON517270980.002
Smik_9.532.252ON388144970.003
NCAS0B064402.252ON385143960.003
KLTH0E07678gna 1ON492226970.003
Smik_8.2182.102ON513267970.003
ZYRO0C06028g3.511ON496230960.004
Kwal_47.17462na 1ON492258950.005
NCAS0B072202.102ON510164950.006
KAFR0D014203.511ON492252940.007
Suva_15.3342.102ON560235920.012
NCAS0E006703.511ON497145920.012
KNAG0G005501.472ON387130910.015
Skud_9.552.252ON385143910.017
ZYRO0G05346g2.102ON504177910.020
Suva_9.782.252ON386152890.025
SAKL0H21824gna 1ON499264900.025
Ecym_7228na 1ON488228890.028
ZYRO0B11088g8.204ON450188870.051
TDEL0D057903.511ON497164860.065
NDAI0B037302.252ON386151860.068
Kpol_480.11.472ON380329840.11
KLLA0F13640g2.475ON418284820.20
YHR137W (ARO9)2.102ON513267820.21
Skud_4.5535.301ON1076181790.51
CAGL0C01243g2.252ON383149780.53
TDEL0A016008.204ON475183780.62
KLTH0G19624gsingletonON46832780.64
TBLA0B093302.420ON408179780.64
Ecym_62921.321ON430331780.68
KLTH0B00176g8.204ON44832770.74
AFR548C3.511ON497220770.84
Smik_5.3198.204ON44333761.0
Suva_5.2818.204ON45033761.2
KLLA0A04906gna 1ON480155761.2
TPHA0E014205.301ON1118185761.2
Ecym_31785.301ON1101181761.3
Kpol_1032.398.204ON453189751.3
KAFR0B023808.204ON443182751.4
SAKL0E08646g2.246ON472143751.5
YER152C8.204ON44333741.8
KNAG0G016808.204ON45234742.1
KAFR0E014205.301ON1062173742.2
AAL080W5.301ON1060171733.2
Skud_5.2908.204ON44333723.6
TPHA0G031602.475ON443322713.7
Kwal_8.5858.204ON44639705.3
KNAG0H037302.102ON52344705.5
ZYRO0C01826g8.255ON69963698.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4307
         (534 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...  1100   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   716   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   682   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   679   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   660   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   662   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   655   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   650   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   653   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   649   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   649   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   648   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   647   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   645   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   640   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   634   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   632   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   632   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   632   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   628   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   627   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   617   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   616   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   613   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   613   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   612   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   612   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            604   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   601   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   594   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   593   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   555   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              550   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    64   2e-10
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    61   3e-09
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    60   9e-09
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    59   1e-08
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    59   1e-08
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    58   3e-08
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    57   7e-08
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    56   9e-08
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    56   1e-07
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    55   1e-07
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    55   2e-07
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    54   4e-07
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    54   7e-07
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    54   8e-07
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    53   1e-06
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    53   1e-06
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    53   1e-06
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    53   1e-06
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    53   1e-06
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    53   1e-06
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    52   2e-06
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    52   2e-06
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    52   3e-06
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    51   3e-06
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    51   5e-06
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    50   6e-06
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    49   2e-05
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    49   2e-05
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    49   3e-05
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    48   4e-05
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    48   5e-05
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    47   7e-05
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    47   8e-05
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    47   1e-04
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    47   1e-04
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    47   1e-04
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    46   2e-04
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    46   2e-04
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    45   2e-04
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    45   2e-04
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    45   3e-04
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    45   3e-04
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    45   5e-04
SAKL0E02948g Chr5 complement(241418..242689) [1272 bp, 423 aa] {...    45   5e-04
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    44   5e-04
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    44   7e-04
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    44   7e-04
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    44   7e-04
KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} simila...    44   9e-04
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    44   0.001
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    43   0.001
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    43   0.002
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    43   0.002
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    42   0.002
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    42   0.002
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    42   0.002
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    42   0.003
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    42   0.003
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    42   0.003
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    42   0.003
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    42   0.004
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    41   0.005
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    41   0.006
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    41   0.007
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    40   0.012
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     40   0.012
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       40   0.015
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    40   0.017
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    40   0.020
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    39   0.025
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    39   0.025
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    39   0.028
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    38   0.051
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    38   0.065
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    38   0.068
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    37   0.11 
KLLA0F13640g Chr6 complement(1264781..1266037) [1257 bp, 418 aa]...    36   0.20 
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    36   0.21 
Skud_4.553 Chr4 (982230..985460) [3231 bp, 1076 aa] {ON} YDR291W...    35   0.51 
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    35   0.53 
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    35   0.62 
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    35   0.64 
TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON} Anc_2...    35   0.64 
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    35   0.68 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    34   0.74 
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    34   0.84 
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    34   1.0  
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    34   1.2  
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    34   1.2  
TPHA0E01420 Chr5 complement(287481..290837) [3357 bp, 1118 aa] {...    34   1.2  
Ecym_3178 Chr3 (339229..342534) [3306 bp, 1101 aa] {ON} similar ...    34   1.3  
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    33   1.3  
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    33   1.4  
SAKL0E08646g Chr5 (706740..708158) [1419 bp, 472 aa] {ON} simila...    33   1.5  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    33   1.8  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    33   2.1  
KAFR0E01420 Chr5 complement(284395..287583) [3189 bp, 1062 aa] {...    33   2.2  
AAL080W Chr1 (204017..207199) [3183 bp, 1060 aa] {ON} Syntenic h...    33   3.2  
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    32   3.6  
TPHA0G03160 Chr7 (672920..674251) [1332 bp, 443 aa] {ON} Anc_2.4...    32   3.7  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    32   5.3  
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    32   5.5  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...    31   8.1  

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score = 1100 bits (2846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/534 (100%), Positives = 534/534 (100%)

Query: 1   MMAILRSAATVENMLIKNSGLQATMDVLHGLPHATMGLRSISSGTSRIRFEPGDPLKLED 60
           MMAILRSAATVENMLIKNSGLQATMDVLHGLPHATMGLRSISSGTSRIRFEPGDPLKLED
Sbjct: 1   MMAILRSAATVENMLIKNSGLQATMDVLHGLPHATMGLRSISSGTSRIRFEPGDPLKLED 60

Query: 61  LNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSRE 120
           LNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSRE
Sbjct: 61  LNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSRE 120

Query: 121 VLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEY 180
           VLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEY
Sbjct: 121 VLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEY 180

Query: 181 LSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVA 240
           LSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVA
Sbjct: 181 LSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVA 240

Query: 241 LPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIA 300
           LPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIA
Sbjct: 241 LPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIA 300

Query: 301 AKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGEC 360
           AKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGEC
Sbjct: 301 AKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGEC 360

Query: 361 GQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERS 420
           GQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERS
Sbjct: 361 GQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERS 420

Query: 421 SIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYC 480
           SIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYC
Sbjct: 421 SIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYC 480

Query: 481 TELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534
           TELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD
Sbjct: 481 TELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/511 (65%), Positives = 413/511 (80%), Gaps = 2/511 (0%)

Query: 26  DVLHGLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELER 85
           ++   +PH+T+ LRS SS     +F+P D L LEDLN NVL AKYAVRGKIP +A EL+ 
Sbjct: 21  NIAKNMPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKN 80

Query: 86  QLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQ-MPMEVLNLIYKP 144
           QL+RDP SLPF +II ANIGNPQQL QKPL+F R+VLSLL++P++L+ +P E L+ IYKP
Sbjct: 81  QLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKP 140

Query: 145 DAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNG 203
           DA+ RA R++ ++  S+GAYSHSQGV GFRKTVA++++ RDG E A AEDIFLT GAS  
Sbjct: 141 DAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAA 200

Query: 204 ASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIII 263
            S ++ +LC+G ++GVLIPIPQYPLYTA++ LNN+ ALPYYLDEES WS N +++E+++ 
Sbjct: 201 VSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVT 260

Query: 264 ESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKF 323
            SI KGV+P CLVVINPGNPTGAIL  ES+E+IF +AAKY IVVIADEVYQENVF G +F
Sbjct: 261 NSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEF 320

Query: 324 YSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKM 383
           +SM+KVL+ LQR++   F N+QL SLHSTSKG+SGECGQRGGYMEL+GFS D+R+V LK+
Sbjct: 321 HSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKL 380

Query: 384 ASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGV 443
           ASI LC  V GQALVDLM+  PKPGD SYE+D  ERS I +AL  R+  L+ETFN LEG+
Sbjct: 381 ASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYETFNRLEGI 440

Query: 444 ECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDT 503
           EC+KPQG+MYLFPRL L  KA++ AE L + PDEFYC ELL +TGICTVPGSGFGQ P T
Sbjct: 441 ECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGT 500

Query: 504 CHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534
            HLRTTFL PGT+WI++WE FHK FY++YRD
Sbjct: 501 YHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/501 (64%), Positives = 394/501 (78%), Gaps = 3/501 (0%)

Query: 37  GLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPF 96
           GL  I        F P + L + DLN NVL+AKYAVRG IP RA EL+ QL RDP SLPF
Sbjct: 59  GLHHIYHKKCHQDFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPF 118

Query: 97  KKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVL--NLIYKPDAVRRAKRMM 154
            KI+ ANIGNPQQL QKPLSF R+VLS+L+ P +L+   E L    ++K DA+ RAKR++
Sbjct: 119 DKIVNANIGNPQQLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRIL 178

Query: 155 RDLQTSIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCK 213
           RD+  S+GAYS SQGV G RKTVA++++ RD GEPA  EDIFLT GAS   S ++ +LC+
Sbjct: 179 RDVGGSVGAYSSSQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCR 238

Query: 214 GQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPA 273
           GQE+GVLIPIPQYPLYTAT+ LNN+  LPYYLDEESGWS N  ++E ++ ESIE G++P+
Sbjct: 239 GQETGVLIPIPQYPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPS 298

Query: 274 CLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSL 333
            LVVINPGNPTG++L VE++E+IF +AAKY IVVIADEVYQEN+F G +F+SMKKVLR L
Sbjct: 299 VLVVINPGNPTGSVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQL 358

Query: 334 QRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG 393
           Q+ +  ++ NVQLVSLHSTSKG+SGECGQRGGYMEL GF+ +IR+V+LK+ASI LC  V 
Sbjct: 359 QKEHPGIYDNVQLVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVT 418

Query: 394 GQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMY 453
           GQALVDLM+  PKPGDESYE+D  ER  I   L  R+  L +TFN+LEG+EC+KP+G+MY
Sbjct: 419 GQALVDLMVCPPKPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMY 478

Query: 454 LFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCP 513
           LFP++ LP KAI+AA+ L+  PDEFYC +LL +TGICTVPGSGFGQ P T HLRTTFL P
Sbjct: 479 LFPQIKLPYKAIQAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAP 538

Query: 514 GTEWIESWELFHKSFYDKYRD 534
           GTEWI+ WE FHK FYD+YRD
Sbjct: 539 GTEWIKKWEDFHKKFYDQYRD 559

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/494 (64%), Positives = 398/494 (80%), Gaps = 5/494 (1%)

Query: 46  SRIRF----EPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIY 101
           +++RF    +P   L L+D+N NVL+AKYAVRG+IP RA EL  QL +DP SLPF KII 
Sbjct: 35  TQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIIS 94

Query: 102 ANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSI 161
           ANIGNPQQL QKPL+F REVLSLL+ P LL+   E L  +YK D+++RAKR++ ++  S+
Sbjct: 95  ANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSV 154

Query: 162 GAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVL 220
           GAYS SQGV G R+TVA++++ RD GE +  EDI+LT GAS   S ++ +LCKG  +GVL
Sbjct: 155 GAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVL 214

Query: 221 IPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINP 280
           IPIPQYPLYTA++ LNN+  LPYYL EE  WS + +++E++++++I+KG+KP CLVVINP
Sbjct: 215 IPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINP 274

Query: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKEL 340
           GNPTGAIL  +S+++IF +AAKY IVVIADEVYQENVF+G KFYSMKKVLR+LQ+ Y   
Sbjct: 275 GNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQ 334

Query: 341 FSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDL 400
           + N+QL SLHSTSKG+SGECGQRGGYMELVGF+ DIR+V LK+ASI LC  V GQALVDL
Sbjct: 335 YDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDL 394

Query: 401 MLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVL 460
           M+S P+PGDESYE+D  ER  I +AL ER+  L+ETF+ LEG+ECRKPQG+MYL+P+L L
Sbjct: 395 MVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDL 454

Query: 461 PQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIES 520
           P K I+ A+ L+M+PDEFYC  LL +TGICTVPGSGFGQ P T HLRTTFL PGTEW+E+
Sbjct: 455 PYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVET 514

Query: 521 WELFHKSFYDKYRD 534
           WE FHK+F+DKYRD
Sbjct: 515 WEKFHKAFFDKYRD 528

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/502 (62%), Positives = 392/502 (78%), Gaps = 5/502 (0%)

Query: 38  LRSISSGTSRI--RFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLP 95
           L  I S  S +     P + L L ++N NVL+AKYAVRG IP  A EL  +L +DP SLP
Sbjct: 33  LHHIHSKVSNVLGAVYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLP 92

Query: 96  FKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVL--NLIYKPDAVRRAKRM 153
           F  I+ ANIGNPQ L QKPL+F R+VLSLL+ P LL+   +VL  + +Y+ DA+ RA+R+
Sbjct: 93  FDNIVSANIGNPQHLKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRL 152

Query: 154 MRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLC 212
           + D+ +S+GAYS SQG+ G R+TVA++++ RDG E A AEDIFLT GAS+  S ++ +LC
Sbjct: 153 LNDIGSSVGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILC 212

Query: 213 KGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKP 272
           KGQE+GVLIPIPQYPLYTA++ LNN+  LPYYLDE+SGWS N  ++E ++  +IE+ +KP
Sbjct: 213 KGQETGVLIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKP 272

Query: 273 ACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRS 332
           + LVVINPGNPTGA+L  E + +IF IAAKY IVVIADEVYQENVF+G +F+SMKK+LR 
Sbjct: 273 SVLVVINPGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRK 332

Query: 333 LQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPV 392
           LQ+    +F NVQL SLHSTSKG+SGECGQRGGYME+ GF++DIR+VILK+ASI LC  V
Sbjct: 333 LQKSNPGVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVV 392

Query: 393 GGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSM 452
            GQALVDLM+S PKPGDESYE D  ER SI  AL ER+  L  TFN+LEG+EC+KP+G+M
Sbjct: 393 TGQALVDLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAM 452

Query: 453 YLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLC 512
           YLFPRL+LP KAI++AE   M PD FYC +LL +TGICTVPGSGFGQ P T HLRTTFL 
Sbjct: 453 YLFPRLLLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLA 512

Query: 513 PGTEWIESWELFHKSFYDKYRD 534
           PGTEWIE WE FHK+FY++YRD
Sbjct: 513 PGTEWIERWENFHKAFYEEYRD 534

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/513 (61%), Positives = 392/513 (76%), Gaps = 9/513 (1%)

Query: 31  LPHATMGLRSISS----GTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQ 86
           +PHA    R  +       S  +F P   +K+ DLN NVL+AKYAVRG IP RA +L+ Q
Sbjct: 79  MPHAVKRQRKPAKDQLHSKSHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQ 138

Query: 87  LSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPME---VLNLIYK 143
           L  DP SLPF KII ANIGNPQQL QKPLSF R+VLSLL+ P LL    E       +YK
Sbjct: 139 LQEDPRSLPFDKIINANIGNPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYK 198

Query: 144 PDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASN 202
            DAVRRA++++ D+  S+GAYS SQGV+G RKTVA++++ RD  EPA  EDIFLT GAS 
Sbjct: 199 ADAVRRAEKLLEDIGGSVGAYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASA 258

Query: 203 GASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERII 262
             S ++ + CKG+++GVLIPIPQYPLYTAT+ LNN+  LPYYLDE+SGWS N  +++ ++
Sbjct: 259 AVSYLLSIFCKGEKTGVLIPIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVV 318

Query: 263 IESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVF-EGL 321
           +++I++ +KP+ LVVINPGNPTGA+L  +++  IF IAAKY IVVIADEVYQEN+F E +
Sbjct: 319 LDAIDRNIKPSVLVVINPGNPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDV 378

Query: 322 KFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVIL 381
           KF+SMKKVLR LQ+ +   F  VQL SLHSTSKG+SGECGQRGG+MEL GFS +IR+VIL
Sbjct: 379 KFHSMKKVLRKLQQEHPGKFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVIL 438

Query: 382 KMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLE 441
           K+ASI LC  V GQALVDLM+  P+ G+ESYE D +ERS I + L +R+  LWETFN LE
Sbjct: 439 KLASISLCPVVTGQALVDLMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLE 498

Query: 442 GVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAP 501
           G++C+KPQG+MYLFPRL LP KA++ A+ ++M  DEFYC ELL +TGICTVPGSGFGQ P
Sbjct: 499 GIQCQKPQGAMYLFPRLNLPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVP 558

Query: 502 DTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534
            T HLRTTFL PGTEWI+ WE FHK FY+KYRD
Sbjct: 559 GTYHLRTTFLAPGTEWIDLWEKFHKEFYNKYRD 591

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/521 (61%), Positives = 401/521 (76%), Gaps = 4/521 (0%)

Query: 14  MLIKNSGLQATMDVLHGLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVR 73
           ML +NS   A + VL G    T  L S+  G+   RF P +P+ L D+N NV++AKYAVR
Sbjct: 5   MLRRNSSGTA-VSVLQGRVLRTRRLSSVKDGS---RFVPAEPMTLADVNENVVKAKYAVR 60

Query: 74  GKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQM 133
           GKIP RA ELER+L   P SLPF KII ANIGNPQQLGQKPL+F R+V+SL+++P LL+M
Sbjct: 61  GKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLEM 120

Query: 134 PMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAED 193
           P E L   +K D V RA+RM++D   S+GAYS SQGV G+R+TVA+++  RDG PA+ ++
Sbjct: 121 PAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRDGIPANPDN 180

Query: 194 IFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSL 253
           ++LT GAS+  S ++   CKG E+GVLIPIPQYPLYTATIT NN VALPYYL+E  GWS 
Sbjct: 181 VYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWST 240

Query: 254 NIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           N D++ER+I++S ++ + P CLVVINPGNPTG++L V+ ME I  +AAKY IVVIADEVY
Sbjct: 241 NPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVY 300

Query: 314 QENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFS 373
           Q+NVF   KF+SM+KVL++LQ R   L+ NVQL SLHS SKGLSGECGQRGGYMEL+GF 
Sbjct: 301 QDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFR 360

Query: 374 DDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSL 433
           +++R+V +K+ASI LC  V GQALVDLM+  P  GD SYE+   E  SI + L+ERS+ L
Sbjct: 361 EELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLL 420

Query: 434 WETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVP 493
           W+TF +LEG+EC  PQG++YLFP+L LPQKAI+AA+ L +  DE YC+ELL+ TGICTVP
Sbjct: 421 WKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVP 480

Query: 494 GSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534
           G+GFGQ P T H+RTTFL PGT+WIESW+ FHK FYDKYRD
Sbjct: 481 GTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/509 (60%), Positives = 392/509 (77%), Gaps = 5/509 (0%)

Query: 31  LPHATMGLRSISSGTS----RIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQ 86
           +PH+ + LR +S+  +      +   G    L D+N  VL AKYAVRG IP RA EL  +
Sbjct: 11  MPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHK 70

Query: 87  LSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQ-MPMEVLNLIYKPD 145
           L  +P SLPF KII ANIGNPQQL QKPL+F R+VLSLL++P L++ +P   L+ ++KPD
Sbjct: 71  LVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELHKLFKPD 130

Query: 146 AVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGAS 205
           AV RAK+M++ +  S+GAYS SQGV GFR++VAE++  RDGEPASA DIFLT GAS+  S
Sbjct: 131 AVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIFLTAGASSAVS 190

Query: 206 LMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIES 265
            ++ + C G E+G LIPIPQYPLYTAT+ LN+  ALPYYLDE SGWS++ + +E+++ ++
Sbjct: 191 AILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDA 250

Query: 266 IEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYS 325
           I KGV+P CLVVINPGNPTGAIL  E++E+I  +AAKYS+VVIADEVYQEN F+   F S
Sbjct: 251 IRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVS 310

Query: 326 MKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMAS 385
           MKKVLR LQ+     + NVQL SLHSTSKG+SGECGQRGGYMELVGFS+++++V LK+AS
Sbjct: 311 MKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLAS 370

Query: 386 IQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVEC 445
           I LC  V GQALVDLM+  PK GD SYE D  ER++I N+L ++S  L+ETF +LEGV C
Sbjct: 371 ISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSC 430

Query: 446 RKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCH 505
           +KPQG+MYLFP+L L +KAI+ AESL M PDE+YC ELL +TGICTVPGSGF Q P T H
Sbjct: 431 QKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYH 490

Query: 506 LRTTFLCPGTEWIESWELFHKSFYDKYRD 534
           LRTTFL PGTEW++SW+ FH+ F D++RD
Sbjct: 491 LRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/521 (60%), Positives = 394/521 (75%), Gaps = 12/521 (2%)

Query: 19  SGLQATMDVLH--GLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKI 76
           SG  +  D+ H    PH T+        TS   F P + L LED+N NVL+AKYAVRG I
Sbjct: 79  SGQSSLNDLRHLNRFPHHTLK-------TSNNEFYPAEQLTLEDVNENVLKAKYAVRGAI 131

Query: 77  PARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPME 136
           P RA EL+ QL +DP SLPF +II ANIGNPQQL QKPL++ R+VLSLL+ P LL    +
Sbjct: 132 PMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQ 191

Query: 137 VL--NLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAED 193
            L  + ++K DA++RAK +M D+  S+GAYS SQGV G RK+VAE+++ RD GE +  ED
Sbjct: 192 QLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPED 251

Query: 194 IFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSL 253
           IFLT GAS   + ++ + C+G E+GVLIPIPQYPLYTAT+ LNN+ ALPYYLDE SGWS 
Sbjct: 252 IFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWST 311

Query: 254 NIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           N +++E ++ E+I+  +KP  LVVINPGNPTGA+L  ES+ +IF +AAKY  VVIADEVY
Sbjct: 312 NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371

Query: 314 QENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFS 373
           QEN+F G KF+SMKK+LR LQR +   F NVQL SLHSTSKG+SGECGQRGGYMEL GFS
Sbjct: 372 QENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFS 431

Query: 374 DDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSL 433
            ++R+VILK+ASI LC  V GQALVDLM+  P  G+ES+E D +ER+SI   L  R+ +L
Sbjct: 432 HEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTL 491

Query: 434 WETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVP 493
           +ETFN+LEG+EC+KPQG+MYLFP++ LP KA++ A  L++ PDEFYC +LL STGICTVP
Sbjct: 492 YETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVP 551

Query: 494 GSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534
           GSGFGQ P T HLRTTFL PG EWI+ WE FHK F+D+YRD
Sbjct: 552 GSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/488 (62%), Positives = 382/488 (78%), Gaps = 3/488 (0%)

Query: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109
           F P D L L +LN NVL+AKYAVRG IP RA EL+ QL  DP SLPF  I+ ANIGNPQQ
Sbjct: 81  FLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQ 140

Query: 110 LGQKPLSFSREVLSLLESPNLLQMPME--VLNLIYKPDAVRRAKRMMRDLQTSIGAYSHS 167
           L QKPLSF R+VLSLL+ P +L+      V + ++K DA+ RAK ++ ++  ++GAYS S
Sbjct: 141 LNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSAS 200

Query: 168 QGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQY 226
           QGV G RKTVA +++ RD GEPA  EDIFLT GAS     ++ +LCKG E+GVLIPIPQY
Sbjct: 201 QGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQY 260

Query: 227 PLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGA 286
           PLYTA++ LNN+ ALPYYLDE+SGWS N  ++E +++ + +K ++P+ LVVINPGNPTGA
Sbjct: 261 PLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGA 320

Query: 287 ILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQL 346
           +L  +S+E IF IAAKY IVVIADEVYQENVF  +KF+SMKKVLR+LQ+++  ++  VQL
Sbjct: 321 VLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQL 380

Query: 347 VSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPK 406
            SLHSTSKG+SGECGQRGGYMEL GF+ ++R VILK+ASI LC  V GQALVDLM+S PK
Sbjct: 381 ASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPK 440

Query: 407 PGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIK 466
            GDES+E+D +ER  I++ L  R+  L++ FN LEG+EC+KPQG+MYLFPRL LP KA++
Sbjct: 441 KGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQ 500

Query: 467 AAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHK 526
            A+ L+M PDEFYC  LL +TGICTVPGSGFGQ P T HLRTTFL PGTEWIE W++FH+
Sbjct: 501 KAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQ 560

Query: 527 SFYDKYRD 534
            FY+ YRD
Sbjct: 561 DFYNTYRD 568

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/521 (60%), Positives = 394/521 (75%), Gaps = 12/521 (2%)

Query: 19  SGLQATMDVLH--GLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKI 76
           SG  +  D+ H    PH T+        T    F P + L LED+N NVL+AKYAVRG I
Sbjct: 79  SGQSSLNDLRHLNRFPHHTLK-------TGNDDFYPAEQLTLEDVNENVLKAKYAVRGAI 131

Query: 77  PARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPME 136
           P RA EL+ QL +DP SLPF KII ANIGNPQQL QKPL++ R+VLSLL+ P LL    +
Sbjct: 132 PMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQ 191

Query: 137 VL--NLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAED 193
            L  + ++K DA++RAK +M D+  S+GAYS SQGV G RK+VAE+++ RD GE +  ED
Sbjct: 192 QLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPED 251

Query: 194 IFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSL 253
           IFLT GAS   + ++ + C+G E+GVLIPIPQYPLYTAT+ LNN+ ALPYYLDE+SGWS 
Sbjct: 252 IFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWST 311

Query: 254 NIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           N +++E ++ E+I+  +KP  LVVINPGNPTGA+L  ES+ +IF +AAKY  VVIADEVY
Sbjct: 312 NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVY 371

Query: 314 QENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFS 373
           QEN+F G KF+SMKK+LR+LQR +   F NVQL SLHSTSKG+SGECGQRGGYMEL GFS
Sbjct: 372 QENIFPGTKFHSMKKILRTLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFS 431

Query: 374 DDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSL 433
            ++R+VILK+ASI LC  V GQALVDLM+  P  G+ES+E D +ER+SI   L  R+ +L
Sbjct: 432 HEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTL 491

Query: 434 WETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVP 493
           ++TFN+LEG+EC+KPQG+MYLFP++ LP KA++ A  L++ PDEFYC  LL STGICTVP
Sbjct: 492 YDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVP 551

Query: 494 GSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534
           GSGFGQ P T HLRTTFL PG EWI+ WE FHK F+D+YRD
Sbjct: 552 GSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/521 (59%), Positives = 394/521 (75%), Gaps = 12/521 (2%)

Query: 19  SGLQATMDVLH--GLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKI 76
           SG  +  D+ H    PH T+        T+   F P + L L+D+N NVL+A+YAVRG I
Sbjct: 79  SGQSSLKDLRHLNRFPHHTLK-------TANNEFYPAEQLTLDDVNENVLKARYAVRGAI 131

Query: 77  PARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPME 136
           P RA EL+ QL +DP SLPF KII ANIGNPQQL QKPL++ R+VLSLL+ P LL    +
Sbjct: 132 PMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQ 191

Query: 137 VL--NLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAED 193
            L  + ++K DA++RAK +++D+  S+GAYS SQGV G RK+VA++++ RDG E A  ED
Sbjct: 192 ELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQGVEGIRKSVADFITKRDGGETAYPED 251

Query: 194 IFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSL 253
           IFLT GAS   + ++ + C+G E+GVLIPIPQYPLYTAT+ LNN+  LPYYLDE SGWS 
Sbjct: 252 IFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQPLPYYLDENSGWST 311

Query: 254 NIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           N +++E ++ E+I+  +KP  LVVINPGNPTGA+L  ES+ +IF +AAKY  VVIADEVY
Sbjct: 312 NPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371

Query: 314 QENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFS 373
           QEN+F G +F SMKKVLR LQR +   F NVQL SLHSTSKG+SGECGQRGGYMEL GFS
Sbjct: 372 QENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFS 431

Query: 374 DDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSL 433
            ++R+VILK+ASI LC  V GQALVDLM+  P  G+ES+E D SER+SI   L  R+ +L
Sbjct: 432 HEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQSERNSIHEKLNTRAMTL 491

Query: 434 WETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVP 493
           +ETFN+LEG+EC+KPQG+MYLFP++ +P KAI+ A  L++ PDEFYC +LL STGICTVP
Sbjct: 492 YETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEAHHLELTPDEFYCKKLLESTGICTVP 551

Query: 494 GSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534
           GSGFGQ P T HLRTTFL PG EW++ WE+FHK F+D+YRD
Sbjct: 552 GSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEFFDQYRD 592

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/503 (61%), Positives = 388/503 (77%), Gaps = 7/503 (1%)

Query: 39  RSISSGTSRIR----FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSL 94
           RSIS  + ++     F P + L L DLN NVL+AKYAVRG IP RA EL+ QL  +P +L
Sbjct: 86  RSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTL 145

Query: 95  PFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVL--NLIYKPDAVRRAKR 152
           PF +I+ ANIGNPQQL QKPLSF R+VLS+L+ P++L+   + L    +YK DA+ RAK 
Sbjct: 146 PFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKL 205

Query: 153 MMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELL 211
           ++ ++  S+GAYS SQGV G RKTVA +++ RDG EPA  EDIFLT         ++ +L
Sbjct: 206 LLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSIL 265

Query: 212 CKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVK 271
           C+G ++GVLIPIPQYPLYTAT+ LNN+ ALPYYLDE+SGWS N  ++E ++ +++E+ + 
Sbjct: 266 CQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAIN 325

Query: 272 PACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLR 331
           P+ LVVINPGNPTGA+L  ES+E IF IAAKY IVVIADEVYQEN+ +G+KFYSMKKVLR
Sbjct: 326 PSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLR 385

Query: 332 SLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSP 391
            LQ+ +   F NVQL SLHSTSKG+SGECGQRGGYMEL+GF+ ++R+VILK+ASI LC  
Sbjct: 386 KLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPV 445

Query: 392 VGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGS 451
           V GQALVDLM+S PK GD SYE+D +ER  I++ L  R+  L+ETF  LEG+EC+KPQG+
Sbjct: 446 VTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGA 505

Query: 452 MYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFL 511
           MYLFP+L LP KA++ A+ L+M PDEFYC  LL++TGICTVPGSGFGQ P T HLRTTFL
Sbjct: 506 MYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFL 565

Query: 512 CPGTEWIESWELFHKSFYDKYRD 534
            PGTEWI+ WE FHK FYD YRD
Sbjct: 566 APGTEWIKKWEAFHKEFYDNYRD 588

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/521 (59%), Positives = 392/521 (75%), Gaps = 12/521 (2%)

Query: 19  SGLQATMDVLH--GLPHATMGLRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKI 76
           SG  +  D+ H    PH T+        TS   F P + L L+D+N NVL+AKYAVRG I
Sbjct: 79  SGQSSLNDLRHLNRFPHHTLK-------TSNNEFYPAEQLTLDDVNENVLKAKYAVRGAI 131

Query: 77  PARAMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPME 136
           P RA EL+ QL +DP SLPF KII ANIGNPQQL QKPL++ R+VLSLL+ P LL    +
Sbjct: 132 PMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQ 191

Query: 137 VL--NLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAED 193
            L  + ++K DA++RAK +M ++  S+GAYS SQGV G R++VAE+++ RD GE +  ED
Sbjct: 192 QLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSSSQGVEGIRRSVAEFITKRDEGEISYPED 251

Query: 194 IFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSL 253
           IFLT GAS   + ++ + C+G E+GVLIPIPQYPLYTAT+ LNN+ ALPYYLDE SGWS 
Sbjct: 252 IFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDESSGWST 311

Query: 254 NIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           N +++E ++ E+IE  +K   LVVINPGNPTGA+L  ES+ +IF +AAKY  VVIADEVY
Sbjct: 312 NPEEIETVVKEAIENEIKSTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371

Query: 314 QENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFS 373
           QEN+F G KF+SMKK+LR LQR +   F NVQL SLHSTSKG+SGECGQRGGYMEL GFS
Sbjct: 372 QENIFPGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFS 431

Query: 374 DDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSL 433
            ++R+VILK+ASI LC  V GQALVDLM+  P  G+ES+E D +ER+SI   L  R+ +L
Sbjct: 432 HEMRQVILKLASISLCPVVTGQALVDLMVRPPLEGEESFESDQAERNSIHEKLITRAMTL 491

Query: 434 WETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVP 493
           ++TFN+LEG+EC+KPQG+MYLFP++ LP +A++ A  L++ PDEFYC +LL STGICTVP
Sbjct: 492 YKTFNSLEGIECQKPQGAMYLFPKIDLPFRAVQEARHLELTPDEFYCKKLLESTGICTVP 551

Query: 494 GSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534
           GSGFGQ P T HLRTTFL PG EWI+ WE FHK F+D YRD
Sbjct: 552 GSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDHYRD 592

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/513 (59%), Positives = 394/513 (76%), Gaps = 5/513 (0%)

Query: 27  VLHGLPHATMGLRSISSGTSRIRFEPGDPL----KLEDLNSNVLEAKYAVRGKIPARAME 82
           ++  +PH+ + LR +S+     +     PL     L+D+N  VL AKYAVRG IP RA E
Sbjct: 6   IIRSMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEE 65

Query: 83  LERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLL-QMPMEVLNLI 141
           L+++L  +P SLPF KII ANIGNPQQL QKPL+F R+VL+LL++P+L+  +    L+  
Sbjct: 66  LKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSGELHKF 125

Query: 142 YKPDAVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGAS 201
           +KPDAV RAK+M++ +  S+GAYS+SQGV GFR++VAE++  RDGEPASA+DIFLTTGAS
Sbjct: 126 FKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGAS 185

Query: 202 NGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERI 261
              S ++ L C G E+G LIPIPQYPLYTA++ LNN+ ALPYYLDEESGWS++ + +E++
Sbjct: 186 GAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKV 245

Query: 262 IIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGL 321
           + +SI+KG++P CLVVINPGNPTGA+L  +++E +  +AAKYS+V+IADEVYQEN F   
Sbjct: 246 VQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDA 305

Query: 322 KFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVIL 381
           +F SMKKVLR LQ+     + NVQL SLHSTSKG+SGECGQRGGYMELVGFS+++++V L
Sbjct: 306 EFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFL 365

Query: 382 KMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLE 441
           K+ASI LC  V GQAL+DLM+  PK GD SYE+D  ER  I +AL +RS  L++ F ++E
Sbjct: 366 KLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSME 425

Query: 442 GVECRKPQGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAP 501
           GV C++PQG+MYLFP+L L  KAI  AES  + PDE+YC ELL +TGICTVPGSGFGQ P
Sbjct: 426 GVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVP 485

Query: 502 DTCHLRTTFLCPGTEWIESWELFHKSFYDKYRD 534
            T HLRTTFL PGTEWI+SW+ FH+ F + +RD
Sbjct: 486 GTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/506 (62%), Positives = 387/506 (76%), Gaps = 5/506 (0%)

Query: 34  ATMGLRSISSGTSRIR---FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRD 90
           A  G R +S  T  ++   F+P D L + DLN NVL+AKYAVRGKIPARA  L++QL  +
Sbjct: 17  ALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDN 76

Query: 91  PDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPME-VLNLIYKPDAVRR 149
           P SLPFKK+I ANIGNPQQL QKPL+F R+VLSLL+ P +L          +YK DA+ R
Sbjct: 77  PSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIER 136

Query: 150 AKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMI 208
           AKR++ D+ +S+G+YS SQGV G RKTVAEY+S RDG E A AEDIFLT GAS+  S ++
Sbjct: 137 AKRILNDIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLL 196

Query: 209 ELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEK 268
            +LCKG+ESGVLIPIPQYPLYTAT+ LNNT ALPYYL+E SGWS N++++E ++  +I +
Sbjct: 197 NILCKGKESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIRE 256

Query: 269 GVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKK 328
            + P  LVVINPGNPTGAIL VES+E+IF +AA + IVVIADEVYQEN+F G +F+SMKK
Sbjct: 257 KIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKK 316

Query: 329 VLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQL 388
           VLR LQRR    + NVQL SLHSTSKG+SGECGQRGGYMEL GFS +I+  ILK+ SI L
Sbjct: 317 VLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISL 376

Query: 389 CSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKP 448
           C  V GQALVDLM   PK G+ SYE+D  ERS+I + L ER+  LW+ FN +EGV C+KP
Sbjct: 377 CPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKP 436

Query: 449 QGSMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRT 508
           QGSMYLFP++ +P KA++ A+ LD+ PDE YC ELL +TGICTVPGSGFGQ P T HLRT
Sbjct: 437 QGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRT 496

Query: 509 TFLCPGTEWIESWELFHKSFYDKYRD 534
           TFL PGT WI+ W  FH+ F +KYRD
Sbjct: 497 TFLAPGTSWIDQWREFHQIFCNKYRD 522

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/491 (60%), Positives = 385/491 (78%), Gaps = 5/491 (1%)

Query: 48  IRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNP 107
           + F+P   +  +DLN +V +A+YAVRG IP RA EL+ +L ++P  LPF  II ANIGNP
Sbjct: 18  LDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNP 77

Query: 108 QQLGQKPLSFSREVLSLLESPNLLQMPME---VLNLIYKPDAVRRAKRMMRDLQTSIGAY 164
           QQL QKPL+F+R+VLS+LE P +LQ+  E    LNL  K DA++RA+ +++D+  S+GAY
Sbjct: 78  QQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSK-DALKRAECLLKDIGGSVGAY 136

Query: 165 SHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           SHSQGV G R+TVA+++++RDG EPA+ EDI+LTTGAS+ A+ ++ LLCK   +G+LIPI
Sbjct: 137 SHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPI 196

Query: 224 PQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNP 283
           PQYPLYTA+ +L N   LPYYLDEE  WS   D++E+++ +++EKG++P+ L+VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNP 256

Query: 284 TGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSN 343
           TGA+L  E++ RI +IAAKY I VI+DEVYQENVF   KF+SMKKVLR LQ  Y   F N
Sbjct: 257 TGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDN 316

Query: 344 VQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLS 403
           VQL SLHS SKG  GECGQRGGYME+VGFS DIR+ + K+ SI +CS V GQA+VDLM++
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376

Query: 404 RPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQK 463
            P+PGDESYE+D  ERS I N ++ R+  L+ETFN LEG+EC+ PQG+MYLFPRL+LP K
Sbjct: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436

Query: 464 AIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWEL 523
           A + +E L ++PDEFYC  LL STGICTVPGSGFGQ P T H+RTTFL PGT+WI++W+ 
Sbjct: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496

Query: 524 FHKSFYDKYRD 534
           FH+SF+++YRD
Sbjct: 497 FHQSFFNEYRD 507

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/500 (59%), Positives = 393/500 (78%), Gaps = 4/500 (0%)

Query: 38  LRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFK 97
           L+S+ + T  + F+P   +  +DLN+ V +A+YAVRG IP RA EL+ +L R P  LPF 
Sbjct: 9   LKSVFT-TKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFD 67

Query: 98  KIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQM-PMEVLNL-IYKPDAVRRAKRMMR 155
            II ANIGNPQQL QKPL+F+R+VLS+LE P +L++ P ++ +L +++ DA+ RA+ ++ 
Sbjct: 68  DIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLE 127

Query: 156 DLQTSIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKG 214
           D+  SIGAYSHSQGV G R++VAE+++ RD GEPA+ E+I+LTTGAS+ A+ ++ LLCK 
Sbjct: 128 DIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKD 187

Query: 215 QESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPAC 274
            ++G+LIPIPQYPLYTA+ +L N   LPYYLDE S WS   D++E+++ +++EKG+KP+ 
Sbjct: 188 VQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSV 247

Query: 275 LVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQ 334
           L+VINPGNPTGA+L  +++ +I +IAAKY I +I+DEVYQENVF G+KF+SMKKVLR LQ
Sbjct: 248 LIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQ 307

Query: 335 RRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGG 394
           R Y   F NVQL SLHS SKG  GECGQRGGYME+VGFS DIR+ + K+ SI +CS V G
Sbjct: 308 RLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTG 367

Query: 395 QALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYL 454
           QA+VDLM+  P+PGDESY++D SER  I + +  R+  L ETFN LEG+EC+KPQG+MYL
Sbjct: 368 QAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL 427

Query: 455 FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPG 514
           FPRLVLP+KA++ +E L ++PDEFYCT LL STGICTVPGSGFGQ P T H+RTTFL PG
Sbjct: 428 FPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPG 487

Query: 515 TEWIESWELFHKSFYDKYRD 534
           T+WI+ W+ FH+ F++KYRD
Sbjct: 488 TQWIQDWKHFHQDFFNKYRD 507

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/495 (59%), Positives = 389/495 (78%), Gaps = 3/495 (0%)

Query: 43  SGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYA 102
           S  S + FEP   L  +DLN N+++A+YAVRG IP +A ELE QLS+ PD LPF  I  A
Sbjct: 27  STVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVA 86

Query: 103 NIGNPQQLGQKPLSFSREVLSLLESPNLLQMPME-VLNLIYKPDAVRRAKRMMRDLQTSI 161
           NIGNPQQL QKPL+FSR+V+S+L+ P LL    + V +  YK DA +RA  ++  +  S+
Sbjct: 87  NIGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSV 146

Query: 162 GAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVL 220
           GAYS +QGV G R++VA++++ RD GE AS +DIFLT GAS  A+ ++ +LC+   +G++
Sbjct: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206

Query: 221 IPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINP 280
           IPIPQYPLYTA+IT+ N+V LPYYLDEESGWS   +++E+ +I+SI++GV P  +VVINP
Sbjct: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266

Query: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKE- 339
           GNPTGA+L  +++ +I  IAAKY IVV+ADEVYQ N+++G+KF+SMKKVLRSLQR +   
Sbjct: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326

Query: 340 LFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVD 399
            + NVQL S+HSTSKG+SGECGQRGGYMELVGFS+++R+VILK+ASI +CS V GQALVD
Sbjct: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386

Query: 400 LMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLV 459
           LML+ P+ GD+SYE D+ ER  I N ++ R   L++TF  LEG+EC++PQG+MYLFP+L+
Sbjct: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446

Query: 460 LPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIE 519
           L +KAI+ A+SL +QPDEFYC  LL++TGICTVPGSGFGQ   T H+RTTFL PGT+WI+
Sbjct: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506

Query: 520 SWELFHKSFYDKYRD 534
            WE FHK+FYDKYRD
Sbjct: 507 DWETFHKAFYDKYRD 521

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/488 (59%), Positives = 386/488 (79%), Gaps = 4/488 (0%)

Query: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109
           F+P   L L+D+N NV++AK+A+RG I  +A +L+ QL+++P  LPF +I  ANIGNPQ+
Sbjct: 11  FQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQE 70

Query: 110 LGQKPLSFSREVLSLLESPNLLQMPMEVLNL--IYKPDAVRRAKRMMRDLQTSIGAYSHS 167
           L QKPL+F+R+V+S+L+ P LL    +VL    I+  D+  RA+R++RD+  S+GAYS S
Sbjct: 71  LNQKPLTFARQVVSILQYPELLNN-RDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSAS 129

Query: 168 QGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQY 226
           QGV G RKT AEY++ RDG EP+  EDIFLTTGA++ AS ++ +LC+G ++GVLIPIPQY
Sbjct: 130 QGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQY 189

Query: 227 PLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGA 286
           PLYTAT+ LN +  +PYYLDEES WS N  ++E+++++SI+KG+KP+ +VVINPGNPTGA
Sbjct: 190 PLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGA 249

Query: 287 ILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQL 346
           +L   ++ +IF IAAKY IVV+ADEVYQEN+F+G++F+S KKVLR LQ++Y   F N+QL
Sbjct: 250 VLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQL 309

Query: 347 VSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPK 406
            S+HSTSKG+ GECGQRGGYMELVGF+D++R+++LK+A + +CS V GQA+VDLML  PK
Sbjct: 310 ASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPK 369

Query: 407 PGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIK 466
            GD SYE D  ER  I +A+ ER++ L+  F+ L+G+EC+KPQG+MYL+P L+L +KAI 
Sbjct: 370 KGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIA 429

Query: 467 AAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHK 526
            AESL++ PDEFYC ELL++TGICTVPGSGFGQ   T HLRTTFL PG EWI  WE FHK
Sbjct: 430 KAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHK 489

Query: 527 SFYDKYRD 534
            FY+KY+D
Sbjct: 490 HFYEKYQD 497

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/486 (61%), Positives = 373/486 (76%), Gaps = 1/486 (0%)

Query: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109
           F P +   L+D+N  VL AKYAVRG IP RA EL+ QL  +P SLPF  II ANIGNPQQ
Sbjct: 89  FLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQ 148

Query: 110 LGQKPLSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQG 169
           L QKPLSF R+VLSLL+ P L+         + K DA+ RAKR++ D+  S+GAYS SQG
Sbjct: 149 LKQKPLSFYRQVLSLLQYPELIPTLENNPQTMIKQDAIDRAKRLLDDIGGSVGAYSSSQG 208

Query: 170 VLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPL 228
           VLG RKTVA+++++RD G  A  EDIFLT GAS+    ++ + C+G+E+GVLIPIPQYPL
Sbjct: 209 VLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPL 268

Query: 229 YTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAIL 288
           YTAT+ L N+ ALPYYL+EE+GWS + ++LE II++SIE  +KP+ LVVINPGNPTGA+L
Sbjct: 269 YTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGNPTGAVL 328

Query: 289 PVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVS 348
             E++E+IF +AAKY I+VIADEVYQENVFE +KF+SMKKVLR LQ +   L+ NVQL S
Sbjct: 329 SEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLAS 388

Query: 349 LHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPG 408
           LHSTSKG+SGECGQRGGYMELVGF+ DIR+V+LK+ASI LC  V GQALVDLM+  P+ G
Sbjct: 389 LHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKG 448

Query: 409 DESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAA 468
           +ESYE+D  ER +I   L +R+  L + F  L+G+ C+KPQG+MYLFP+L LP KAI+ A
Sbjct: 449 EESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQEA 508

Query: 469 ESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSF 528
              DM PDEFYC  LL  TGICTVPGSGFGQ P T HLRTTFL PGT+WIE W  FH+ F
Sbjct: 509 LHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEF 568

Query: 529 YDKYRD 534
           Y+K+++
Sbjct: 569 YNKFKN 574

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/491 (58%), Positives = 383/491 (78%), Gaps = 5/491 (1%)

Query: 48  IRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNP 107
           + F+P   +  +DLN+ V +A+YAVRG IP RA EL+ +L ++P+ LPF  II ANIGNP
Sbjct: 18  LDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNP 77

Query: 108 QQLGQKPLSFSREVLSLLESPNLLQM---PMEVLNLIYKPDAVRRAKRMMRDLQTSIGAY 164
           QQL QKPL+F+R+VL++LE P +L++    +  LNL  + DA+ RA+R++ D+  SIGAY
Sbjct: 78  QQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSR-DALERAERLLNDIGGSIGAY 136

Query: 165 SHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           SHSQGV G R+TVA++++ RDG EPA+ EDI+LTTGAS+ A+ ++ LLCK  ++G+LIPI
Sbjct: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPI 196

Query: 224 PQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNP 283
           PQYPLYTA+ +L N   LPYYLDEES WS N D++E+++ ++++K ++P+ L+VINPGNP
Sbjct: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256

Query: 284 TGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSN 343
           TGA+L  E++ RI +IAAKY I +I+DEVYQEN+F  +KF+SMKKVLR LQ  Y   F N
Sbjct: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDN 316

Query: 344 VQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLS 403
           VQL SLHS SKG   ECGQRGGYME++GFS +IR+ + K+ SI +CS V GQA+VDLM+ 
Sbjct: 317 VQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVK 376

Query: 404 RPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQK 463
            P+PGDESYE+D  ER  I + ++ R+  L+ETF  LEG+EC+KPQG+MYLFPRLVLP+K
Sbjct: 377 PPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKK 436

Query: 464 AIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWEL 523
           A+  +E L ++PDEFYCT LL STGICTVPGSGFGQ P T H+RTTFL PGT+WI+ W+ 
Sbjct: 437 ALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKE 496

Query: 524 FHKSFYDKYRD 534
           FH+ F+ KYR+
Sbjct: 497 FHQDFFSKYRN 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/501 (57%), Positives = 387/501 (77%), Gaps = 6/501 (1%)

Query: 38  LRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFK 97
           L+S+ + T  + F+P   L  +DLN++V +A+YAVRG IP RA EL+ +L R  +SLPF 
Sbjct: 9   LKSVFT-TKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFN 67

Query: 98  KIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQM---PMEVLNLIYKPDAVRRAKRMM 154
            II ANIGNPQQL QKPL+F+R+VLS+LE P +L++    +  LNL  K DA++RA+R++
Sbjct: 68  SIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAK-DALKRAQRLL 126

Query: 155 RDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCK 213
            D+  S+GAYSHSQGV G R+TVA++++ RDG EPA  EDI+LTTGAS+ A+ ++ LLCK
Sbjct: 127 DDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCK 186

Query: 214 GQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPA 273
             ++G+L+PIPQYPLYTA+ +L N   LPYYLDEE+ WS   D++ER+++++++KG++P+
Sbjct: 187 DSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPS 246

Query: 274 CLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSL 333
            LVVINPGNPTGA+L   ++ +I +IAAKY I +I+DEVYQEN+F  +KF+SMKK+LR L
Sbjct: 247 VLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKL 306

Query: 334 QRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG 393
           Q  +   F NVQL SLHS SKG  GECGQRGGYME+VGFS DIR+ + K+ SI +CS   
Sbjct: 307 QNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVAT 366

Query: 394 GQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMY 453
           GQA++DLM+  P+PGDESY++D  ER  I N +  R+  L+ETFN LEG++C+KPQG+MY
Sbjct: 367 GQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMY 426

Query: 454 LFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCP 513
           LFP+L LP+KA++ +E L+++PD  YCT LL STGICTVPGSGFGQ   T H+RTTFL P
Sbjct: 427 LFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPP 486

Query: 514 GTEWIESWELFHKSFYDKYRD 534
           GT+WI+ W  FH+ F++KYRD
Sbjct: 487 GTQWIQDWRQFHQDFFNKYRD 507

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/504 (58%), Positives = 381/504 (75%), Gaps = 11/504 (2%)

Query: 36  MGLRSISSGTS----RIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDP 91
           +G+R ++  T+    +    P   L+++DLN NVL+AKYAVRG IP RA EL+  L    
Sbjct: 15  VGVRRLTLSTTLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG- 73

Query: 92  DSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAK 151
             LPF  +I ANIGNPQQL QKPL+F R+VLS+L+ P LL    E  + I+K DA+ RA+
Sbjct: 74  QKLPFDTVINANIGNPQQLKQKPLTFYRQVLSILQYPELL----ESGSNIFKKDAIERAR 129

Query: 152 RMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIEL 210
           ++++++  S+G+YS SQG+   RKTVA +++ RD GE ++  DIFLT GAS+    ++ +
Sbjct: 130 KLLKEI-GSVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSI 188

Query: 211 LCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGV 270
           LCK ++SGVLIPIPQYPLYTAT+ LNN  ALPYYLDE  GWS +I+++E +I +S++KG+
Sbjct: 189 LCKNEKSGVLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGI 248

Query: 271 KPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVL 330
           KP  LV+INPGNPTG+IL VESME+I  +AA + IV+IADEVYQENVF   KF+SMKKVL
Sbjct: 249 KPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVL 308

Query: 331 RSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCS 390
           R+LQ+ +   +  VQL SLHSTSKG+SGECGQRGGYMEL GF+ +I++VILK+ SI LC 
Sbjct: 309 RNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCP 368

Query: 391 PVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQG 450
            V GQALVDLM+S P+ GDESYE+D  ERS+I N L  R+  LWE FN++EGV C+KP+G
Sbjct: 369 VVTGQALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEG 428

Query: 451 SMYLFPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTF 510
           +MYLFP++ LP K ++ ++ LD+ PDEFYC  LL +TGICTVPGSGFGQ P T HLRTTF
Sbjct: 429 AMYLFPKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTF 488

Query: 511 LCPGTEWIESWELFHKSFYDKYRD 534
           L PGTEWI+ W  FH  FYDKYRD
Sbjct: 489 LAPGTEWIDRWNKFHAEFYDKYRD 512

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/489 (61%), Positives = 384/489 (78%), Gaps = 5/489 (1%)

Query: 48  IRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNP 107
           + F+P   L + DLN NVL+AKYAVRGKIP RA EL+RQL+  P+SLPF KII ANIGNP
Sbjct: 50  LNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNP 109

Query: 108 QQLGQKPLSFSREVLSLLESPNLLQMPMEVL---NLIYKPDAVRRAKRMMRDLQTSIGAY 164
           QQL Q+PLSF R+VLSLL+ P LL   +E     + +YK DA+ RAK++++D+  S+GAY
Sbjct: 110 QQLQQQPLSFYRQVLSLLQYPTLLHA-IETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168

Query: 165 SHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           S SQGV G R+TVA +++ RDG EPA  EDIFLT GAS   + ++ +LCKG+++GVLIPI
Sbjct: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228

Query: 224 PQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNP 283
           PQYPLYTAT+ LNN+ ALPY+LDE +GWS+N  ++E +I ++++  +KP  LVVINPGNP
Sbjct: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288

Query: 284 TGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSN 343
           TGA+L  E++  I  IAAKY IVVIADEVYQEN+F+G+KF+S+K VLR LQR     F N
Sbjct: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 344 VQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLS 403
           VQL SLHSTSKG+SGECGQRGGYME++GF+ ++R+VILK+ASI LC  V GQALVDLM+S
Sbjct: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 404 RPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQK 463
            PK G+ES+  D ++R +I + L +R++ LW+TFN+L+G+EC+KP G+MYLFP+L LP +
Sbjct: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 464 AIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWEL 523
           AI+ A+ L++ PDEFYC ELL  TGICTVPGSGFGQ   T HLRTTFL PG EWI+SW+ 
Sbjct: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 524 FHKSFYDKY 532
           FH  F +KY
Sbjct: 529 FHIEFMEKY 537

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/488 (58%), Positives = 377/488 (77%), Gaps = 5/488 (1%)

Query: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSR--DPDSLPFKKIIYANIGNP 107
           FEP   + + DLN  ++ A+YAVRG I  RA ELE +L     P S PF++IIYANIGNP
Sbjct: 24  FEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNP 83

Query: 108 QQLGQKPLSFSREVLSLLESPNLLQMPMEVLNL-IYKPDAVRRAKRMMRDLQTSIGAYSH 166
           QQL QKPL+FSR+V+S+LE P LL+    +L+  IYK DA+ RA+ +   +  S+GAYS 
Sbjct: 84  QQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSL 143

Query: 167 SQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQ 225
           +QGV G R+T A ++S RD  E ASA+DIFLT GAS   + ++  LC+ + +G+LIPIPQ
Sbjct: 144 AQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQ 203

Query: 226 YPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTG 285
           YPLYTA+I ++N   LPYYLDEESGWS  ++++E  +I +IE G+KP+ +VVINPGNPTG
Sbjct: 204 YPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTG 263

Query: 286 AILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQ 345
           A+L V+ ++RI  +AAKY IV+IADEVYQ+N+F G +F+SMKK+LR LQ++Y   + NVQ
Sbjct: 264 AVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDNVQ 322

Query: 346 LVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRP 405
           L SLHSTSKG+SGECGQRGGYME+VGFSD++R ++LK+ASI +CS V GQALVDLM+  P
Sbjct: 323 LASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPP 382

Query: 406 KPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAI 465
             GDESYE+D  ER+ I + L++R+  L++TF+NLEG+EC+KPQG+MYLFPRL+LP +AI
Sbjct: 383 HVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAI 442

Query: 466 KAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFH 525
           + A+ L M+ DEFYC +LL +TGICTVPGSGFGQ   T H+RTTFL PGTEWI+ W+ FH
Sbjct: 443 EEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFH 502

Query: 526 KSFYDKYR 533
           + F  +Y+
Sbjct: 503 EKFMKEYQ 510

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/495 (58%), Positives = 383/495 (77%), Gaps = 3/495 (0%)

Query: 41  ISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKII 100
           +S  TSR +    + L+ EDLN NV++AKYAVRG IP+ A +L+ QL + P +LPF+ +I
Sbjct: 69  LSYSTSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVI 128

Query: 101 YANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVLNLI-YKPDAVRRAKRMMRDLQT 159
            +NIGNPQQLGQKPLSF R+VLS+LE P LL     +++ + Y PD++ RAK ++ D+  
Sbjct: 129 NSNIGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDI-G 187

Query: 160 SIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESG 218
           SIGAYS+SQGV G R+TVA+++++RD GE A  +DIFLT GAS+  S ++ +LCKGQ++G
Sbjct: 188 SIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTG 247

Query: 219 VLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVI 278
           VLIPIPQYPLYTAT+TLN+  ALPYYLDE +GWS +I+++ ++  +S+E G+KP CLVVI
Sbjct: 248 VLIPIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVI 307

Query: 279 NPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYK 338
           NPGNPTG++L VE+++ +F +AAKY +VVIADEVYQ+N+F G +F+SMKK+LR LQ+   
Sbjct: 308 NPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVP 367

Query: 339 ELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALV 398
             + N+QL SLHS SKGL GECG RGGY E +GF+ ++++VI K++SI LCS V GQALV
Sbjct: 368 NKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALV 427

Query: 399 DLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRL 458
           DLM   PK G+ SYE D  ER +IR   ++RS  L+E FN+LEGV C+KPQG+MY+FP +
Sbjct: 428 DLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNI 487

Query: 459 VLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWI 518
            LP  AIK A++LD+ PDEFYC ELL +TGICTVPGSGFGQ P T H+RTTFL PG EW+
Sbjct: 488 QLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWM 547

Query: 519 ESWELFHKSFYDKYR 533
           + WE FH  F++KYR
Sbjct: 548 KRWEKFHIEFFEKYR 562

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/489 (59%), Positives = 374/489 (76%), Gaps = 5/489 (1%)

Query: 49  RFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQL--SRDPDSLPFKKIIYANIGN 106
            F+P   + L+DLN NVL+++YAVRG IP RA ELE +L  +   DSL F+ I++ANIGN
Sbjct: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86

Query: 107 PQQLGQKPLSFSREVLSLLESPNLL-QMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYS 165
           PQQL QKPL+FSR+V+S+L+ P LL Q  + V   I+K DA+ RA+ ++  +  S+GAYS
Sbjct: 87  PQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYS 146

Query: 166 HSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIP 224
            SQGV G R+TVA Y+++RD GE AS +DIFLT GAS  AS ++ LLCK + +GVLIPIP
Sbjct: 147 SSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPIP 206

Query: 225 QYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPT 284
           QYPLYTATITL +   LPYYL+EESGWS N +++E++++++I   VKP+ +VVINPGNPT
Sbjct: 207 QYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPT 266

Query: 285 GAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNV 344
           G++L  + +  I  I AKY IV+IADEVYQEN+F+G +F+SMKKVLRSLQ++Y   +  V
Sbjct: 267 GSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAV 325

Query: 345 QLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSR 404
           QL SLHSTSKG+SGECGQRGGYMELVGF D+IR+ ILK+ASI LCS + GQALVDLM++ 
Sbjct: 326 QLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNP 385

Query: 405 PKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKA 464
           PK GDESYE D  ER +I   L+ER++ L+  F  L+GVEC+KPQG+MYLFP+L  PQ  
Sbjct: 386 PKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTL 445

Query: 465 IKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELF 524
           I  A + +M PDEFYC  LL +TGICTVPGSGFGQ   T HLRTTFL PG +W E W+LF
Sbjct: 446 ITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLF 505

Query: 525 HKSFYDKYR 533
           H+ F+ KY+
Sbjct: 506 HEEFFSKYQ 514

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/488 (56%), Positives = 377/488 (77%), Gaps = 5/488 (1%)

Query: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109
           FEP   L ++DLN NV++A++AVRG IP +A EL+ QL+++P SLPF +I  ANIGNPQ+
Sbjct: 13  FEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQE 72

Query: 110 LGQKPLSFSREVLSLLESPNLLQMPMEVLNL---IYKPDAVRRAKRMMRDLQTSIGAYSH 166
           L QKPL+F+R+V+S+L+ P LL    E+ +    IY  D+  RA++++ ++  S+GAYS 
Sbjct: 73  LHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSA 132

Query: 167 SQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQ 225
           SQGV G RKT+A Y++ RD GE AS  DIF+TTGA+  +S ++ +L  G ++GVL+PIPQ
Sbjct: 133 SQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQ 192

Query: 226 YPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIE-SIEKGVKPACLVVINPGNPT 284
           YPLYTA + L+N   LPYYL+EESGWS++ +++E+ I + ++ KG++P  +V+INPGNPT
Sbjct: 193 YPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPT 252

Query: 285 GAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNV 344
           G+IL  +S+ +IF IAAKY IV+IADEVYQEN+F G KF+S KKVLRSLQ+++   ++NV
Sbjct: 253 GSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNV 312

Query: 345 QLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSR 404
           QL SLHSTSKGL GECGQRGGYME++GF++D+R +ILK+A I +C  V GQA++DLM+  
Sbjct: 313 QLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILP 372

Query: 405 PKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKA 464
           PK GD+SY+ D  ER  I N +  R+K L++ F+++EG++C+KPQG+MYLFPRL+L  K 
Sbjct: 373 PKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKV 432

Query: 465 IKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELF 524
           I  A+  +M+PDEFYC ELLN TGICTVPGSGFGQ P+T HLRTTFL PG +WI  WE F
Sbjct: 433 IDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKF 492

Query: 525 HKSFYDKY 532
           HK+F  +Y
Sbjct: 493 HKAFLKRY 500

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/489 (57%), Positives = 366/489 (74%), Gaps = 5/489 (1%)

Query: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109
           F P   + L+DLNS +++ +YAVRG IPARA EL+ QL +DP SLPF KII ANIGNPQQ
Sbjct: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68

Query: 110 LGQKPLSFSREVLSLLESPNLLQMPMEVLNLI----YKPDAVRRAKRMMRDLQTSIGAYS 165
           LGQKPLSF R+VLS+L+ P++L+   ++  LI    Y+ D VRRA++++ ++  S+GAYS
Sbjct: 69  LGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYS 128

Query: 166 HSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIP 224
            SQGV G ++TVA+Y++ RD GE A  EDIFLTTGAS+  S ++ + C G  +GVLIPIP
Sbjct: 129 LSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIP 188

Query: 225 QYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPT 284
           QYPLYTATITL    A+ YYL+EE  WS+N  ++E  I ESI+ G+KP  +V+INPGNPT
Sbjct: 189 QYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPT 248

Query: 285 GAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNV 344
           G+IL  + +  I  I+AKY +++IADEVYQENVF G +F+S+KKVLR LQR+Y   +  V
Sbjct: 249 GSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYETV 308

Query: 345 QLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSR 404
           QL SLHSTSKGL GECGQRGGYMEL+G +DD+R  ++K+ SI +CS V GQAL+D+++S 
Sbjct: 309 QLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVSP 368

Query: 405 PKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKA 464
           P+PGDESYE D  ER++I+N L  RS+ L + F +LEGVEC +PQG+MYLFP+ + PQK 
Sbjct: 369 PRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQKF 428

Query: 465 IKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELF 524
           I  A+ L  + D  YC ELL  TGICTVPGSGFGQ P+T HLRTTFL PG  WI+ W  F
Sbjct: 429 IDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRKF 488

Query: 525 HKSFYDKYR 533
           H  F ++YR
Sbjct: 489 HTEFCERYR 497

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/491 (57%), Positives = 363/491 (73%), Gaps = 6/491 (1%)

Query: 48  IRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNP 107
           + F P + L + DLN + + A YAVRG IP RA +L  Q+  DP SLPF KII ANIGNP
Sbjct: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60

Query: 108 QQLGQKPLSFSREVLSLLESPNLLQMPMEVLNLI----YKPDAVRRAKRMMRDLQTSIGA 163
           QQ+GQKPL+F R+VLS+LE PN+L  P  +  L+    Y+ D + RA++M+  +  S+GA
Sbjct: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120

Query: 164 YSHSQGVLGFRKTVAEYLSSRDG--EPASAEDIFLTTGASNGASLMIELLCKGQESGVLI 221
           YS SQGVLGFR+TVA++++ RDG  + AS  DIFLT GAS+    ++ +LC G E GVLI
Sbjct: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180

Query: 222 PIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPG 281
           PIPQYPLYTAT+TL+N+ A+PYYL E + WS N  ++E  I ES+  GVKP  +V+INPG
Sbjct: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240

Query: 282 NPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELF 341
           NPTGAIL    +  I  I+AKY I +IADEVYQEN+F G +F+SM+KVL +LQ  +   +
Sbjct: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300

Query: 342 SNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLM 401
            NVQL SLHSTSKG  GECGQRGGYMEL+GF D++  ++LK+ASI +CS V GQAL+DL+
Sbjct: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360

Query: 402 LSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLP 461
              P+PGD SY+ D  ER+ I+  L  R+  L+  F +LEGVEC++PQG+MYLFP+L+LP
Sbjct: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420

Query: 462 QKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESW 521
            KAI+ A  L++ PDE+YC ELL++TGICTVPGSGFGQ P T HLRTTFL PGTEWIE W
Sbjct: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480

Query: 522 ELFHKSFYDKY 532
             FH+ FY+++
Sbjct: 481 REFHQQFYERF 491

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/493 (54%), Positives = 357/493 (72%), Gaps = 9/493 (1%)

Query: 50  FEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQ 109
           F P     L D+N ++L+A+YA+RG IP RA EL+ QL  +  SLPF KI+YANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 110 LGQKPLSFSREVLSLLESPNLLQMPMEVL-NLIYKPDAVRRAKRMMRDLQTSIGAYSHSQ 168
           L Q+PL+F R+V+SL++ P+LL+    +L   IY  D++ RA +++  +  S+GAYS SQ
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQ 127

Query: 169 GVLGFRKTVAEYLSSRD--GEPA------SAEDIFLTTGASNGASLMIELLCKGQESGVL 220
           GVL  RK VA ++  RD   +P       +A ++FLT GAS     ++ L  K +  GVL
Sbjct: 128 GVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVL 187

Query: 221 IPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINP 280
           +PIPQYPLYTA +TL  +  LPYYL+E + WS +   +E+I+I++I++ +KP  LVVINP
Sbjct: 188 LPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINP 247

Query: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKEL 340
           GNPTGAIL  +S+  I  IAA+Y IV+IADEVYQENV+E  +F+S KKVL  L++ Y   
Sbjct: 248 GNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSK 307

Query: 341 FSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDL 400
           + NVQL SLHS SKG++GECGQRGGYME+ GFS+D+++V+LK+ASI +CS V GQ LVDL
Sbjct: 308 YDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDL 367

Query: 401 MLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVL 460
           M++ P+PGDESYE D  ERS I + L  +S +L++ F  L G+ C+KPQG+MYLFPRL L
Sbjct: 368 MVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHL 427

Query: 461 PQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIES 520
            + AI AA  L+++PDEFYC +LL +TGICTVPGSGFGQ P T HLRTTFL PG EWI S
Sbjct: 428 SENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINS 487

Query: 521 WELFHKSFYDKYR 533
           WE FH  F +KY+
Sbjct: 488 WEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/493 (53%), Positives = 356/493 (72%), Gaps = 11/493 (2%)

Query: 52  PGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLG 111
           P     L D++ ++L+ +YA+RG IP RA EL+ QL+  P+ LPFKKIIYANIGNPQQL 
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 112 QKPLSFSREVLSLLESPNLLQMP-MEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGV 170
           Q+PL+F R+VLSL+E PNL+    + V N IY PDA++RA+ ++  +  S+GAYS SQG+
Sbjct: 68  QEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQGI 127

Query: 171 LGFRKTVAEYLSSRDGEP----------ASAEDIFLTTGASNGASLMIELLCKGQESGVL 220
           L  RK VA+ +  RD +            +A +IFLT GA+   S ++ L  K +  GVL
Sbjct: 128 LSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGVL 187

Query: 221 IPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINP 280
           +PIPQYPLYTA +TL N+  LPYYL+E+  WS + +++E II ++I + +KP  LV+INP
Sbjct: 188 LPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIINP 247

Query: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKEL 340
           GNPTGAIL VES+ +I  IAAKY IV+IADEVYQ N+++  KF+S KK+L SL+ +Y + 
Sbjct: 248 GNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPKK 307

Query: 341 FSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDL 400
           + NVQL SLHS SKG++GECGQRGGY EL+GFSD+I+++ILK+ASI +CS V GQ LVDL
Sbjct: 308 YDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVDL 367

Query: 401 MLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVL 460
           M   P+ GD SY+ D  ER++I++ L  +S +L++ F+ L G+ C+KPQG+MYLFPRL L
Sbjct: 368 MSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLHL 427

Query: 461 PQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIES 520
               I  A+  +++PDEFYC +LL +TGICTVPGSGFGQ   T H+RTTFL  G EWI+ 
Sbjct: 428 TSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIKL 487

Query: 521 WELFHKSFYDKYR 533
           WE FH  F ++Y+
Sbjct: 488 WEKFHLEFMNQYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 72/153 (47%), Gaps = 12/153 (7%)

Query: 163 AYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIP 222
            Y   QG    RK +AE  S+ D    S E++ LT GA   A+ +      G+    +  
Sbjct: 54  TYGAIQGSHALRKLIAEMYSNED-VTLSEENVILTNGAI-AANFLTHYTLAGKGDHFICI 111

Query: 223 IPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKP--ACLVVINP 280
            P Y   ++   +        +L +E+ +  NI +LER+I        KP   C+V+  P
Sbjct: 112 SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMI--------KPNTKCIVLNTP 163

Query: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
            NP  +++P E++  I  +A K+ IVV  DEVY
Sbjct: 164 NNPLSSVIPTETLREIAELADKHGIVVFCDEVY 196

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 83/354 (23%), Positives = 145/354 (40%), Gaps = 55/354 (15%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA-SLMIELLCKGQESGVLIP 222
           YS ++G     K +A+  +   G+  SA++I + TGA+    S ++ LL KG E  V++ 
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLSADNITVHTGANEAIFSCLMGLLNKGDE--VIVF 134

Query: 223 IPQYPLYTATITLNNTVAL------PYYLDEE----SGWSLNIDDLERIIIESIEKGVKP 272
            P +  Y + I L   V        P  LD+     + W ++ D LE+ I        + 
Sbjct: 135 EPFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTI------NSRT 188

Query: 273 ACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRS 332
            C+++  P NP G +   E + R+  I    +IV+I+DEVY     E L F      + +
Sbjct: 189 KCVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVY-----EHLYFSDEFPRIAT 243

Query: 333 LQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPV 392
           L     +L       ++ S  K  +   G R G+   V  + ++   + K A  ++C   
Sbjct: 244 LSPEIGQL-----TFAVGSAGKTFAA-TGWRIGWT--VSLNKELLNYVAK-AHTRIC--- 291

Query: 393 GGQALVDLMLSRPKPGDESYERDLSERSSI------RNALQERSKSLWETFNNLEGVECR 446
                     S P P  E+    L E   I      R    ++ K     F+ L  +   
Sbjct: 292 ---------FSSPSPFQEAIAHALPEAQKIDYFETMRQEYIQKFKIFTAVFDEL-NMPYT 341

Query: 447 KPQGSMYL---FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGF 497
             +GS ++   F ++ +P+  +   E  +   D      L+N  G+  +P + F
Sbjct: 342 VAEGSYFICVNFSKVKIPEDYVFPQELQEKAKDFRISYWLMNELGVVAIPPTEF 395

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 98/438 (22%), Positives = 176/438 (40%), Gaps = 73/438 (16%)

Query: 88  SRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVLNL-----IY 142
           SR P+S      I  N+   Q + +   S + E  ++  S N      E++NL      Y
Sbjct: 13  SRKPNS------IVPNLALTQNVAKDVWSLTNEAAAVASS-NAQNKGRELINLGQGFFSY 65

Query: 143 KPD--AVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGA 200
            P   A+  A+  +      +  Y+ ++G +    ++ +  S        A ++ +TTGA
Sbjct: 66  SPPPFAIHEAQAALSS--PMVNQYAPTKGRVSLINSLVKLYSPLYNTQLDASNVQVTTGA 123

Query: 201 SNGA-SLMIELLCKGQESGVLIPIPQYPLYTATITL--NNTVALPYYLDEE--------S 249
           + G  S ++ LL  G E  V++  P +  Y + I +       +P +  +E        +
Sbjct: 124 NEGILSCLVGLLNPGDE--VIVFEPFFDQYISNIQIPGGKVTYVPMHPPKEMNVRNTKGT 181

Query: 250 GWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIA 309
            W++N D+LE  I        K   L++  P NP G +   E + RI  I  K+++V+I+
Sbjct: 182 EWTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIIS 235

Query: 310 DEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLS-GECGQRGGYME 368
           DEVY E+++   +F            R   L   +  ++L   S G S    G R     
Sbjct: 236 DEVY-EHLYFTPEF-----------TRIATLSPEIGQITLTVGSAGKSFAATGWR----- 278

Query: 369 LVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSER------SSI 422
            +G+   +   +LK AS+         A   +  S P P  E+    L+          +
Sbjct: 279 -IGWVVSLNPELLKYASM---------AHTRICFSSPSPLQEACANSLNTALDNGYFEKM 328

Query: 423 RNALQERSKSLWETFNNLEGVECRKPQGSMYL---FPRLVLPQKAIKAAESLDMQPDEFY 479
           R     + K     F+ L G+   +P+G+ ++   F ++ +P       E      D   
Sbjct: 329 RQEYINKFKIFTRVFDEL-GLPYTEPEGTYFVLVDFSKVKIPDNYPFPEELRSKGKDFRI 387

Query: 480 CTELLNSTGICTVPGSGF 497
              L+N  G+  +P + F
Sbjct: 388 SYWLVNELGVVAIPPTEF 405

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 75/328 (22%), Positives = 137/328 (41%), Gaps = 55/328 (16%)

Query: 190 SAEDIFLTTGASNGA-SLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVA-------- 240
           +AE++ +TTGA+ G  + +  L+  G E  V++  P +  Y   I L   V         
Sbjct: 128 AAENVQVTTGANEGIFACLAGLVNPGDE--VIVFEPFFDQYIPNIELLGGVVRYVPIRPP 185

Query: 241 --LPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFV 298
             L   + E + W ++ D L + I E      K   +++ +P NP G +   E + ++  
Sbjct: 186 AELSKRVTEGTEWVIDYDMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGN 239

Query: 299 IAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSG 358
           I  +  I +I+DEVY+   F                  +  + +  + +S H+ + G +G
Sbjct: 240 ICVEKGIYIISDEVYEHLYF---------------TDEFTRIATLSEEISQHTLTVGSAG 284

Query: 359 ECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDES------Y 412
           +     G+   +G+     + +L +AS         +A V +  S P P  E+      +
Sbjct: 285 KSFAATGWR--IGWVISRNKELLALAS---------KAHVRICFSSPAPLQEACAVAIEH 333

Query: 413 ERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYL---FPRLVLPQKAIKAAE 469
               +  +  R A Q++ +   + F++L G+   + +GS +L   F RL LP       E
Sbjct: 334 ALKTTYYADTRAAYQKKYERFQKPFDDL-GLPYTRAEGSYFLLVDFSRLPLPADYHFPEE 392

Query: 470 SLDMQPDEFYCTELLNSTGICTVPGSGF 497
             D   D      L+N  G+  +P S F
Sbjct: 393 LADKGRDFRVAYWLINELGLVAIPCSSF 420

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 94/196 (47%), Gaps = 23/196 (11%)

Query: 171 LGFRKTVAEY------LSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIP 224
           L F+K +++Y         ++ +P  A+++ L  G+      +I   C   +  +LI   
Sbjct: 61  LEFKKLLSDYRNKTSIFKDQNLKPLDADNLCLGVGSDESIDALIRACCVPAKEKILIAPA 120

Query: 225 QYPLYTATITLNNT--VALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGN 282
            Y +YT    +N+   V +P  L EE  + ++    E  I+E+++       + + +PGN
Sbjct: 121 TYGMYTICSQVNDVEYVTVPLLLSEEDKFQID----EEKILETLQNDPSIKLVFITSPGN 176

Query: 283 PTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFS 342
           PTG  + V  +E+I  ++   + +V+ DE Y + V EG    S K  L  L  +Y+    
Sbjct: 177 PTGTFIDVNRIEKI--LSQWQTGLVVVDEAYIDFV-EG----SDKGSLAPLATKYE---- 225

Query: 343 NVQLVSLHSTSKGLSG 358
           N+ ++   S S GL+G
Sbjct: 226 NIAVLQTLSKSFGLAG 241

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 78/358 (21%), Positives = 147/358 (41%), Gaps = 57/358 (15%)

Query: 161 IGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNG--ASLMIELLCKGQESG 218
           +  YS ++G     K++ +  S         E++ +TTGA+ G  A LM  L    Q   
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPLYKLTLKPENVLVTTGANEGILACLMGIL---NQNDE 140

Query: 219 VLIPIPQYPLYTATITL--NNTVALPYY----LDEE----SGWSLNIDDLERIIIESIEK 268
           V++  P +  Y   I L     V +P      LD+     + W+L+ +  E +I      
Sbjct: 141 VIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITN---- 196

Query: 269 GVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKK 328
             K   +++  P NP G +   E ++RI  I  K+++++I+DEVY     + L F     
Sbjct: 197 --KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVY-----DNLYFVDEFT 249

Query: 329 VLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQL 388
            + +L     +L          + S G +G+     G+   +G+   +   +L  AS   
Sbjct: 250 RIATLSPEIGQL----------TLSVGSAGKTFAATGWR--IGWVVSLNPELLNFAS--- 294

Query: 389 CSPVGGQALVDLMLSRPKPGDESYERDLS------ERSSIRNALQERSKSLWETFNNLEG 442
                 +A   +  + P P  E+    ++         ++RN   ++ K     F+ L G
Sbjct: 295 ------KAHTRICFASPSPIQEACAESINIALRNGYFENMRNEYVKKYKIFTSVFDEL-G 347

Query: 443 VECRKPQGSMYL---FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGF 497
           +   + +G+ +L   F R+ +P+      E ++   D      L+N  G+  +P + F
Sbjct: 348 LPYTEAEGTYFLLVDFSRVKIPEDYKFPEEIINKGKDFRISNWLINELGVVAIPPTEF 405

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 75/351 (21%), Positives = 153/351 (43%), Gaps = 43/351 (12%)

Query: 161 IGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA-SLMIELLCKGQESGV 219
           +  YS ++G     K++ E      G+    +++ +TTGA+ G  S ++ +L  G E  V
Sbjct: 74  VNQYSPTRGRPSLIKSLVELYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNAGDE--V 131

Query: 220 LIPIPQYPLYTATITLNNTVA--LPYYLDEESGWSLNIDDLERIIIESIEKGV--KPACL 275
           ++  P +  Y   I L   V   +P +  +E        D  +I  +++EK    K   +
Sbjct: 132 IVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTFNNKTKAV 191

Query: 276 VVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQR 335
           ++  P NP G +   + + ++  +  +++ VVI+DEVY E+++    F  +  +      
Sbjct: 192 IINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVY-EHLYFTESFPRIANI------ 244

Query: 336 RYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQ 395
              E  +N+ L ++ S  K  +   G R G+  ++  +D +   + K A  ++C      
Sbjct: 245 --NEDIANLTL-TVGSAGKSFAA-TGWRIGW--IISKNDQLLNYVSK-AHTRIC------ 291

Query: 396 ALVDLMLSRPKPGDESYERDLSERSSI------RNALQERSKSLWETFNNLEGVECRKPQ 449
                  + P P  E+    +     I      R   +++ + L   F+ L G+   +P+
Sbjct: 292 ------FASPSPLQEACAGSIEHALKIDYFPKMREEYRKKFEILTTAFDKL-GLNYTQPE 344

Query: 450 GSMYL---FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGF 497
           G+ ++   F ++ +P+  +   E L+   D      L+N  GI  +P + F
Sbjct: 345 GTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 74/160 (46%), Gaps = 11/160 (6%)

Query: 155 RDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKG 214
           RDL+ + GA   S  +   R  VA   S  D E    +D  L T  + GA+ ++     G
Sbjct: 49  RDLRFTYGAIKGSDEL---RSLVASLYS--DKEVKLDKDNVLITNGAIGANFLVSYTLAG 103

Query: 215 QESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPAC 274
               V+   P Y   ++   +         L+ E+ +  +I  L+ +I     KG    C
Sbjct: 104 PGDHVICVDPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMI-----KG-NTKC 157

Query: 275 LVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQ 314
           +V+ NP NP G+++P  ++E I  +A K  I VI DEVY+
Sbjct: 158 IVLNNPNNPLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 84/409 (20%), Positives = 163/409 (39%), Gaps = 80/409 (19%)

Query: 109 QLGQKPLSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQ 168
            LGQ   S+S    ++ E+   L++P+                         +  YS ++
Sbjct: 58  NLGQGFFSYSPPQFAIKEAQKALEIPL-------------------------VNQYSPTR 92

Query: 169 GVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA-SLMIELLCKGQESGVLIPIPQYP 227
           G      ++ +  +    +   AE++ +TTGA+ G  S ++ LL  G E  V++  P + 
Sbjct: 93  GRPSLINSLIDLYTPIYNKELKAENVVVTTGANEGILSCLMGLLNSGDE--VIVFEPFFD 150

Query: 228 LYTATITLNNTVAL------PYYLDEESG----WSLNIDDLERIIIESIEKGVKPACLVV 277
            Y   I L     +      P  LD+ +     W+++ +  E+ I        K   +++
Sbjct: 151 QYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITS------KTKAVII 204

Query: 278 INPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRY 337
             P NP G +   + +  +  I  K+++V+I+DEVY     E L F      + +L    
Sbjct: 205 NTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVY-----EHLYFTDSFTRVATLSPEI 259

Query: 338 KELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQAL 397
            +L          + + G +G+     G+   +G+   +   +L  A+         +A 
Sbjct: 260 GQL----------TLTVGSAGKSFAATGWR--IGWVLSLNAELLSYAA---------KAH 298

Query: 398 VDLMLSRPKPGDESYERDLSERSSI---RNALQE---RSKSLWETFNNLEGVECRKPQGS 451
             +  + P P  E+    +++   I    N  QE   + K L   F+ L G+    P+GS
Sbjct: 299 TRICFASPSPLQEACANSINDALKIGYFENMRQEYITKFKILTSVFDEL-GLPYTAPEGS 357

Query: 452 MYL---FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGF 497
            ++   F ++ +P+      E +D   D      L+N  G+  +P + F
Sbjct: 358 YFVLVNFSKVKIPEDYPYPQEIMDKGKDFRISHWLINELGVVAIPPTEF 406

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 82/173 (47%), Gaps = 20/173 (11%)

Query: 188 PASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNT--VALPYYL 245
           P SA+++ L  G+      +I   C   +  +LI  P Y +Y+    +N+   + +P  +
Sbjct: 84  PLSADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIV 143

Query: 246 DEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSI 305
            E++ + +N D     +IE+++         V +PGNPTGA++ + S+E+I  ++   S 
Sbjct: 144 -EDNSFQMNTDK----VIETLQGDSNIKIAFVTSPGNPTGALIDIASIEKI--LSQWQSG 196

Query: 306 VVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSG 358
           +V  DE Y       + F S       L  +Y     N+ ++   S S GL+G
Sbjct: 197 IVAIDEAY-------IDFCSTGGSAAPLVNKY----PNLAVLQTLSKSFGLAG 238

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/354 (22%), Positives = 155/354 (43%), Gaps = 55/354 (15%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA-SLMIELLCKGQESGVLIP 222
           YS ++G     K++ ++ S    E  +  ++ +TTGA+ G  + ++ LL  G E  V++ 
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPIYNETLNESNVTITTGANEGILASLVGLLNPGDE--VIVF 145

Query: 223 IPQYPLYTATITLNN------TVALPYYLDEE----SGWSLNIDDLERIIIESIEKGVKP 272
            P +  Y + I +         +  P  L E     + W ++ D L + I E      + 
Sbjct: 146 EPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINE------RT 199

Query: 273 ACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRS 332
            C+++  P NP G +   E + ++  I  K +I +I+DEVY E+++ G +F  +  + + 
Sbjct: 200 KCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISKE 258

Query: 333 LQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPV 392
           +         ++ L S+ S  K  +   G R G+            V+ + A  +L S V
Sbjct: 259 I--------GDLTL-SVGSAGKSFAA-TGWRIGW------------VVSRNA--ELLSYV 294

Query: 393 GGQALVDLMLSRPKPGDE--SYERDLSERS----SIRNALQERSKSLWETFNNLEGVECR 446
             +A   +  S P P  E  ++  D+   +    ++R   +E+   L   F+ L G+   
Sbjct: 295 -SKAHTRICFSSPSPFQEACAHSIDIGLHNGYFENMREEYKEKFAILTRVFDEL-GLPYT 352

Query: 447 KPQGSMYL---FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGF 497
           KP G+ ++   F ++ +P +     E  +   D      L+N  G+  +P + F
Sbjct: 353 KPDGTYFVCVDFSKVQIPDEYPFPRELNERAKDFKLSYWLVNELGVVAIPPTEF 406

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 83/409 (20%), Positives = 163/409 (39%), Gaps = 80/409 (19%)

Query: 109 QLGQKPLSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQ 168
            LGQ   S+S    ++ E+   L++P+                         +  YS ++
Sbjct: 62  NLGQGFFSYSPPQFAIKEAQKALEIPL-------------------------VNQYSPTR 96

Query: 169 GVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA-SLMIELLCKGQESGVLIPIPQYP 227
           G      ++ +  S   G+    E+I +TTGA+ G  S ++ LL  G E  V++  P + 
Sbjct: 97  GRASLLNSLIKLYSPFYGKELKQENITITTGANEGILSCLMGLLNAGDE--VIVFEPFFD 154

Query: 228 LYTATITL----------NNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVV 277
            Y + I L          N    L   + E + W+++ +     I        K   ++V
Sbjct: 155 QYISNIELMGGKVVYVPINPPKDLDQRITEGTEWTIDFEQFRNAITP------KTKAVIV 208

Query: 278 INPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRY 337
            +P NP G +   E + ++  I  + ++++I+DEVY     E L F      + +L    
Sbjct: 209 NSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVY-----EFLYFNDSFTRIATLSPEI 263

Query: 338 KELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQAL 397
            +L      +++ S  K  +   G R G+  ++  + ++ + + K A  ++C        
Sbjct: 264 GQL-----TLTVGSAGKTFAA-TGWRIGW--VISQNPELLQYVSK-AHTRIC-------- 306

Query: 398 VDLMLSRPKPGDESYERDLSER------SSIRNALQERSKSLWETFNNLEGVECRKPQGS 451
                + P P  E+    +++         +R    ++ K     F  L G+   KP+G+
Sbjct: 307 ----FASPSPLQEACANSINDALESGYFEKMRKEYVQKFKIFNAVFEEL-GLPYTKPEGT 361

Query: 452 MYL---FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGF 497
            ++   F ++ +P+      E LD   D      L+N  G+  +P + F
Sbjct: 362 YFVLADFSKVKIPEDYPWPEEILDKGKDFRISHWLINELGVVAIPPTEF 410

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 74/356 (20%), Positives = 151/356 (42%), Gaps = 53/356 (14%)

Query: 161 IGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA-SLMIELLCKGQESGV 219
           +  YS ++G +   +++ +  S        AE++ +TTGA+ G  S ++ +L  G E  V
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAELKAENVTVTTGANEGILSCLMGILNPGDE--V 141

Query: 220 LIPIPQYPLYTATITL--NNTVALPYY----LDEE----SGWSLNIDDLERIIIESIEKG 269
           ++  P +  Y   I L     V +P      +D+     + W+++ +     I +     
Sbjct: 142 IVFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITD----- 196

Query: 270 VKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKV 329
            K   +++  P NP G +   E + RI  I  K ++V+I+DEVY     E L F      
Sbjct: 197 -KTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVY-----EHLYFTDSFTR 250

Query: 330 LRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLC 389
           + +L     +L      +S+ S  K  +   G R G++  V  + ++   + K A  ++C
Sbjct: 251 IATLSPEIGQL-----TLSVGSAGKSFAA-TGWRVGWV--VSLNPELLSYVSK-AHTRIC 301

Query: 390 SPVGGQALVDLMLSRPKPGDESYERDLSERSSIR--NALQERSKSLWETFNNLE---GVE 444
                        + P P  E+    +++   I     +++  K  ++ F ++    G+ 
Sbjct: 302 ------------FASPSPLQEAVANSINDALEINYFENMRQEYKHKYDIFTSVFKELGLP 349

Query: 445 CRKPQGSMYL---FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGF 497
             +P+G+ ++   F ++ +P+      E  +   D      L+N  G+  +P + F
Sbjct: 350 YTEPEGTYFILVDFSKVKIPEGYSYPEEIANKAKDFRIAYWLINELGVVAIPPTEF 405

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 75/372 (20%), Positives = 157/372 (42%), Gaps = 57/372 (15%)

Query: 146 AVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA- 204
           A++ A++ + D+   +  YS ++G +     + +  +   G     E++ +TTGA+ G  
Sbjct: 73  AIKEAQKAL-DIPL-VNQYSPTRGRVSLLNALIKQYTPIYGSELKQENVTITTGANEGIL 130

Query: 205 SLMIELLCKGQESGVLIPIPQYPLYTATITL----------NNTVALPYYLDEESGWSLN 254
           S ++ LL  G E  V++  P +  Y + I L          N    L   + E + W+++
Sbjct: 131 SCLMGLLNAGDE--VIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTVD 188

Query: 255 IDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQ 314
           ++  +  I        K   +++  P NP G +   E + +I  I  + ++++I+DEVY 
Sbjct: 189 MEQFKNAITS------KTKAVIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVY- 241

Query: 315 ENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSD 374
               E L F      + +L     +L      +++ S  K  +   G R G+  ++  + 
Sbjct: 242 ----EHLYFTDEFTRIATLSPEIGQL-----TLTVGSAGKTFAA-TGWRIGW--VISLNS 289

Query: 375 DIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSER------SSIRNALQE 428
           ++ + + K A  ++C             + P P  E+    +++         +R    +
Sbjct: 290 ELLQYVSK-AHTRIC------------FASPSPLQEACANSINDALESNYFEKMRQEYIQ 336

Query: 429 RSKSLWETFNNLEGVECRKPQGSMYL---FPRLVLPQKAIKAAESLDMQPDEFYCTELLN 485
           + K     F  L G+   KP+G+ ++   F ++ +P+      E L+   D      L+N
Sbjct: 337 KFKIFTSVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILNKGKDFRISHWLIN 395

Query: 486 STGICTVPGSGF 497
             G+  +P + F
Sbjct: 396 ELGVVAIPPTEF 407

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 77/351 (21%), Positives = 139/351 (39%), Gaps = 43/351 (12%)

Query: 161 IGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA-SLMIELLCKGQESGV 219
           +  YS ++G      ++ +  S    +  + E++ +TTGA+ G  S ++ LL  G E  V
Sbjct: 85  VNQYSPTRGRPSLINSLIKLYSPIYNKDLTTENVTVTTGANEGILSCLMGLLNAGDE--V 142

Query: 220 LIPIPQYPLYTATITL--NNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVV 277
           ++  P +  Y + I L     V +P    +E        +   I  E  EK + P    V
Sbjct: 143 IVFEPFFDQYISNIELCGGKVVYVPINPPKELDLRNTRGEEWTIDFEQFEKAITPKTKAV 202

Query: 278 I--NPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQR 335
           I   P NP G +   E +  +  I  K+++++I+DEVY+   F    F  +  +   +  
Sbjct: 203 IINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVYEHLYFTD-SFTRIATISPEIG- 260

Query: 336 RYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQ 395
                    QL     ++  L    G R G++  V  + D+   + K A  ++C      
Sbjct: 261 ---------QLTLTVGSAGKLFAATGWRIGWV--VSLNADLLSYVSK-AHTRIC------ 302

Query: 396 ALVDLMLSRPKPGDESYERDLSERSSI------RNALQERSKSLWETFNNLEGVECRKPQ 449
                  S P P  E+    + +   I      R     + K     F+ L G+    P+
Sbjct: 303 ------FSSPSPLQEACANSIDDGLKIGYFEKMRQEYITKFKIFTSIFDEL-GLPYTAPE 355

Query: 450 GSMYL---FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGF 497
           G+ ++   F ++ +P+      E  D   D      L+N  G+  +P + F
Sbjct: 356 GTYFVLVNFSKVKIPKDYSYPEEIRDKGKDFRISHWLINELGVVAIPPTEF 406

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 83/409 (20%), Positives = 158/409 (38%), Gaps = 80/409 (19%)

Query: 109 QLGQKPLSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQ 168
            LGQ   S+S    ++ E+   L +PM                         +  YS ++
Sbjct: 58  NLGQGFFSYSPPQFAIKEAQKALDIPM-------------------------VNQYSPTR 92

Query: 169 GVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA-SLMIELLCKGQESGVLIPIPQYP 227
           G      ++ +  S        AE++ +TTGA+ G  S ++ LL  G E  V++  P + 
Sbjct: 93  GRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFD 150

Query: 228 LYTATITLNNTVAL------PYYLDEESG----WSLNIDDLERIIIESIEKGVKPACLVV 277
            Y   I L     +      P  LD+ +     W+++ +  E+ I        K   +++
Sbjct: 151 QYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITS------KTKAVII 204

Query: 278 INPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRY 337
             P NP G +   E +  +  I  K+++V+I+DEVY     E L F      + +L    
Sbjct: 205 NTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY-----EHLYFTDSFTRIATLSPEI 259

Query: 338 KELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQAL 397
            +L          + + G +G+     G+   +G+   +   +L  A+         +A 
Sbjct: 260 GQL----------TLTVGSAGKSFAATGWR--IGWVLSLNAELLSYAA---------KAH 298

Query: 398 VDLMLSRPKPGDESYERDLSERSSI------RNALQERSKSLWETFNNLEGVECRKPQGS 451
             +  + P P  E+    +++   I      R     + K     F+ L G+    P+G+
Sbjct: 299 TRICFASPSPLQEACANSINDALKIGYFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGT 357

Query: 452 MYL---FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGF 497
            ++   F ++ +P+      E L+   D      L+N  G+  +P + F
Sbjct: 358 YFVLVDFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEF 406

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 75/328 (22%), Positives = 134/328 (40%), Gaps = 57/328 (17%)

Query: 191 AEDIFLTTGASNGA-SLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVAL------PY 243
           AE++ +TTGA+ G  S ++ LL  G E  V++  P +  Y   I L     +      P 
Sbjct: 131 AENVTVTTGANEGILSCLMGLLNSGDE--VIVFEPFFDQYIPNIELCGGKVVYVPINPPK 188

Query: 244 YLDEESG----WSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVI 299
            LD+ +     W+++ +  E  I        K   +++  P NP G +   E +  +  I
Sbjct: 189 ELDQRNTKGEEWTIDFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNI 242

Query: 300 AAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLS-G 358
             K+++V+I+DEVY E++F    F            R   L   +  ++L   S G S  
Sbjct: 243 CVKHNVVIISDEVY-EHLFFTDSF-----------TRIATLSPEIGQLTLTVGSAGKSFA 290

Query: 359 ECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSE 418
             G R G+             +L + + +L S    +A   +  + P P  E+    +++
Sbjct: 291 ATGWRIGW-------------VLSLNA-ELLS-YAAKAHTRICFASPSPLQEACANSIND 335

Query: 419 RSSI------RNALQERSKSLWETFNNLEGVECRKPQGSMYL---FPRLVLPQKAIKAAE 469
              I      R     + K     F+ L G+    P+G+ ++   F ++ +P+      E
Sbjct: 336 ALKIDYFEKMRQEYITKFKIFTSIFDKL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPKE 394

Query: 470 SLDMQPDEFYCTELLNSTGICTVPGSGF 497
            LD   D      L+N  G+  +P + F
Sbjct: 395 ILDKGKDFRISHWLINELGVVAIPPTEF 422

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 83/381 (21%), Positives = 156/381 (40%), Gaps = 56/381 (14%)

Query: 161 IGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA-SLMIELLCKGQESGV 219
           +  YS ++G      ++ +  S    +  + E++ +TTGA+ G  S ++ ++  G E  V
Sbjct: 85  VNQYSPTRGRPRLINSLIDLYSPFYKKQLTPENVLVTTGANEGILSCLMGIINPGDEVIV 144

Query: 220 LIP-----IPQYPL---YTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVK 271
             P     IP   L       + +N    L   + + + W+++ D+  R I        K
Sbjct: 145 FEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEWTVDFDEFTRAITP------K 198

Query: 272 PACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLR 331
              +++  P NP G +   E + ++  I  + ++++IADEVY     E L F      + 
Sbjct: 199 TKAVIINTPHNPIGKVFTREELTKLGNICVENNVIIIADEVY-----EHLYFVDEFPRIA 253

Query: 332 SLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSP 391
           +L     +L      +S+ S  K  +   G R G+  +V  + D    +L+ AS      
Sbjct: 254 TLSEEIGQL-----TLSVGSAGKSFAA-TGWRIGW--VVSQNPD----LLQYAS------ 295

Query: 392 VGGQALVDLMLSRPKPGDE--SYERDLSER----SSIRNALQERSKSLWETFNNLEGVEC 445
              +A   +  + P P  E  SY  D + +     ++R    ++ K     F+ L G+  
Sbjct: 296 ---KAHTRICFASPSPIQEACSYSIDHALKIDYFENMRQEYVKKFKIFTSVFDEL-GLPY 351

Query: 446 RKPQGSMYL---FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPD 502
             P+GS ++   F ++ +P       E +    D      L+N  G+  +P + F   P+
Sbjct: 352 TIPEGSYFVLADFSKVKIPDSYQFPEEIMSKGKDFRISNWLINELGVVAIPPTEF-YIPE 410

Query: 503 TCHLRTTFL----CPGTEWIE 519
             H     L    C   E++E
Sbjct: 411 HEHAAENLLRFAVCKDDEYLE 431

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 86/375 (22%), Positives = 157/375 (41%), Gaps = 53/375 (14%)

Query: 142 YKPDA--VRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTG 199
           Y P A  V  A++ + D    +  YS ++G +    ++ +  S        A +I +TTG
Sbjct: 65  YSPPAFVVEEAQKALDD--AMVNQYSPTKGRMSLINSLIKQYSPLYNTQLQANNIQVTTG 122

Query: 200 ASNGA-SLMIELLCKGQESGVLIPIPQYPLYTATITL--NNTVALPYYLDEE-------- 248
           A+ G  + ++ LL  G E  V++  P +  Y + I +       +P +  +E        
Sbjct: 123 ANEGILACLVGLLNPGDE--VIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMSVRPTEG 180

Query: 249 SGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVI 308
           + W+++ D+L   I        K   L++  P NP G +   E + +I  I  + ++V+I
Sbjct: 181 TEWTVDYDELRAAITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVVII 234

Query: 309 ADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLS-GECGQRGGYM 367
           +DEVY E+++   +F            R   L   +  ++L   S G S    G R G+ 
Sbjct: 235 SDEVY-EHLYFTPEF-----------TRVATLSPEIGQITLTIGSAGKSFAATGWRIGW- 281

Query: 368 ELVGFSDDIREVILKMASIQLC--SPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNA 425
            +V  + ++ E    MA  ++C  SP   Q      L  P   D  Y + + E    +  
Sbjct: 282 -IVSLNPELLEYA-SMAHTRICFASPSPLQEACANAL--PIALDNGYFKKMREEYIHKFN 337

Query: 426 LQERSKSLWETFNNLEGVECRKPQGSMYL---FPRLVLPQKAIKAAESLDMQPDEFYCTE 482
           +  R       F+ L G+   KP+G+ ++   F ++ +P+      E      D      
Sbjct: 338 IFTR------VFDEL-GLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAKDFRISYW 390

Query: 483 LLNSTGICTVPGSGF 497
           L+N  G+  +P + F
Sbjct: 391 LINELGVVAIPPTEF 405

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 118/264 (44%), Gaps = 29/264 (10%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           Y +SQG     K   E+ S          D+  T G +     ++ + C     G  I  
Sbjct: 105 YGYSQGQPEITKFFKEHHSLIHDMKYENWDVLATIGNTGAWESVLRIFCN---RGDTILA 161

Query: 224 PQYPLYTATITL---NNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINP 280
            Q+  ++++I+          P  LDE     +    LE I+    E   KP  L  +  
Sbjct: 162 EQF-AFSSSISAAEAQGVNVFPIPLDEHG---IIPSKLETILDNWTEGAAKPKLLYTVPT 217

Query: 281 G-NPTGAILPVESMERIFVIAAKYSIVVIADEVY---QENVFEG------LKFYS-MKKV 329
           G NPTG+ L  +  E I+ IA K+  ++I DE Y   Q   +E       +K Y+  K+ 
Sbjct: 218 GQNPTGSSLSFDRKEEIYRIAQKHDFIIIEDEPYYFLQMEKYEKDPANRVVKSYADHKEF 277

Query: 330 LRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLC 389
           +++L++ +  + +  +++ L S SK L+   G R G+  +VG + DI   IL +  + + 
Sbjct: 278 IQNLEKSFVSIDTEGRVLRLDSLSKVLA--PGTRFGW--IVG-AKDILARILSLQEMTIQ 332

Query: 390 SPVG-GQALVDLMLSRPKPGDESY 412
           +P G  Q+++   ++R   G E Y
Sbjct: 333 APAGFTQSIIAGTMNR--WGQEGY 354

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/375 (19%), Positives = 152/375 (40%), Gaps = 63/375 (16%)

Query: 146 AVRRAKRMMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA- 204
           A++ A+R +      +  YS ++G L    ++ ++ +        A +  + TGA+    
Sbjct: 63  AIKEAQRALE--IPLVNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIF 120

Query: 205 SLMIELLCKGQESGVLIPIPQYPLYTATITLNN------TVALPYYLDEE----SGWSLN 254
           S++I LL  G E  V++  P +  Y   I L+        +  P  LD        W ++
Sbjct: 121 SILIGLLNPGDE--VIVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQID 178

Query: 255 IDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQ 314
            D L+  +        K   +++  P NP G +     + R+  I  K ++V+I+DEVY+
Sbjct: 179 WDSLQAAM------NSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYE 232

Query: 315 ENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLH----STSKGLSGECGQRGGYMELV 370
              F                   K+ F+ +  +S      + + G +G+     G+   +
Sbjct: 233 HLYF-------------------KDSFTRIATLSPEIGQLTLTVGSAGKSFAATGWR--I 271

Query: 371 GFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSSIRNALQERS 430
           G++  + + +L  A+         +A   +  + P P  E+     ++   +    + R 
Sbjct: 272 GWALSLNQELLSYAA---------KAHTRICFASPSPLQEAVANAFNDAEKVEYFKETRL 322

Query: 431 KSL--WETFNNL---EGVECRKPQGSMYL---FPRLVLPQKAIKAAESLDMQPDEFYCTE 482
           + +  +E F N+    G+   +P+G+ ++   F ++ +P       E L+   D      
Sbjct: 323 QYIRKYEIFTNVLNELGLPYTEPEGTYFILVNFSKVKIPPDYKYPEELLNKAKDFRISYW 382

Query: 483 LLNSTGICTVPGSGF 497
           L+N  G+  +P + F
Sbjct: 383 LMNELGVVAIPPTEF 397

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 93/202 (46%), Gaps = 25/202 (12%)

Query: 168 QGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYP 227
           +G+L   +  A         P +A++I L  G+      +I   C  +E  V++  P Y 
Sbjct: 64  KGLLASYRNAASAFREEGLAPLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYG 123

Query: 228 LYTATITLNNT--VALPYYLDEESGWSLNIDDLERIIIE-SIEKGVKPACLVVINPGNPT 284
           +Y     +N+   V +P      S  S  ID+ +RI+ + +++K +K   + + +PGNPT
Sbjct: 124 MYKVCADINDVGYVEVPLI---SSDNSFQIDE-DRILEQLNLDKSIK--VVFITSPGNPT 177

Query: 285 GAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNV 344
           GA + V  +E++  +    + +V+ DE Y       + F + K  L  L  ++       
Sbjct: 178 GACIEVGRVEKL--LRNWTAGIVVVDEAY-------IDFSADKPSLSPLVNKHP------ 222

Query: 345 QLVSLHSTSKGLSGECGQRGGY 366
            LV L + SK  SG  G R G+
Sbjct: 223 NLVVLQTLSKA-SGLAGIRLGF 243

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 115/255 (45%), Gaps = 25/255 (9%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           Y  SQG     + V ++ S       +  D+  T G +N     + + C   ++ +L   
Sbjct: 106 YGFSQGQPELMEFVRKHTSLVHDIKYADWDVLATAGNTNAWESTLRVFCNRGDT-ILAEA 164

Query: 224 PQYP--LYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPG 281
             +   LY A     N   +P  LDE   + +  + LE I+     +  KP  L  I  G
Sbjct: 165 YSFSSSLYAAEAQGVNVFPVP--LDE---FGIIPEKLESIMDNWNPETPKPKLLYTIPTG 219

Query: 282 -NPTGAILPVESMERIFVIAAKYSIVVIADEVY----------QENVFEGLKFYSMKKVL 330
            NPTG+ L  +   +I+ IA K++ ++I DE Y            +  E   + S  + +
Sbjct: 220 QNPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPYYFLQMEPYVKDASAREKKTYSSHDEFI 279

Query: 331 RSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCS 390
           +SL + +  L ++ ++V L S SK L+   G R G+  +VG S  I E  L++  + + +
Sbjct: 280 QSLAKSFISLDTDGRVVRLDSFSKVLA--PGTRLGW--IVG-SKKILEPYLRLHEMTIQA 334

Query: 391 PVG-GQALVDLMLSR 404
           P G  Q+LV   L+R
Sbjct: 335 PSGFTQSLVAGTLNR 349

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 99/217 (45%), Gaps = 33/217 (15%)

Query: 188 PASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNT--VALPYYL 245
           P S ++I L  G+  G   +I   C  +   VL+  P Y +Y+    +N+T  V  P  +
Sbjct: 84  PISYKNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECP-LI 142

Query: 246 DEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSI 305
            E++ + +++D+    ++E++        L +  PGNPTGA +   S ++I ++   +S 
Sbjct: 143 TEDNSFDMDLDN----VLETLSNDDSIKLLFITTPGNPTGASI---STQKIEMLLNNWSA 195

Query: 306 -VVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRG 364
            +V+ DE Y +        +S       L  +Y        LV + + SK   G  G R 
Sbjct: 196 GIVVVDEAYID--------FSSSDSAAPLVNKYP------NLVVIQTLSKSF-GLAGVRL 240

Query: 365 GYMELVGFSDDIREVILKMAS----IQLCSPVGGQAL 397
           G   L   S+DI +V+  M +     ++ S +G  AL
Sbjct: 241 G---LTFASEDISKVLNVMKAPYNISKMASEIGISAL 274

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 69/151 (45%), Gaps = 8/151 (5%)

Query: 163 AYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIP 222
            Y    G    R  VA+ + S D    +A+++ +T GA  GA+ ++     G    ++  
Sbjct: 54  TYGSIWGTPVLRDLVAK-IHSSDEIQLTADNVLITNGAI-GANFLVHYTAAGPGDHIICV 111

Query: 223 IPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGN 282
            P Y   ++  ++        +L+ E G++ NI  L+  +  + +       +V+ NP N
Sbjct: 112 DPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVRANTKY------IVLNNPNN 165

Query: 283 PTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           P G+++  E M  I   A +  I ++ DEVY
Sbjct: 166 PLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 83/174 (47%), Gaps = 17/174 (9%)

Query: 187 EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNT--VALPYY 244
           EP + +++ L  G+      +I   C+ +   +L   P Y +Y+    +N+   V  P  
Sbjct: 80  EPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECP-L 138

Query: 245 LDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYS 304
           + E++ + +N+ +    ++ +++   K   L + +PGNPTG ++  + +E  F++    +
Sbjct: 139 ITEDNSFQMNVPE----VLSTLKNDPKIKLLFITSPGNPTGKLVNKKDIE--FILENWTN 192

Query: 305 IVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSG 358
            +V+ DE Y +        YSM K++          + N+ ++   S S GL+G
Sbjct: 193 GLVVVDEAYIDFADAEGTTYSMAKLVTK--------YPNLTVLQTLSKSFGLAG 238

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 82/173 (47%), Gaps = 20/173 (11%)

Query: 188 PASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNT--VALPYYL 245
           P + E++ L  G+      +I   C   +  +LI  P Y +Y+    +N+   V +P  +
Sbjct: 84  PLTHENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVV 143

Query: 246 DEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSI 305
           ++ S       D E++I E+++       + + +PGNPTGA++  E++E++  ++   S 
Sbjct: 144 EDNSFQM----DTEKVI-ETLQNDPSIKLVFITSPGNPTGALIKPENIEKL--LSQWQSG 196

Query: 306 VVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSG 358
            V+ DE Y       + F +    +  L  +Y     N+ ++   S S GL+G
Sbjct: 197 FVVVDEAY-------IDFCTTGGSVAPLVNKY----PNLAVLQTLSKSFGLAG 238

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 85/192 (44%), Gaps = 20/192 (10%)

Query: 190 SAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEES 249
           S  D+  TTG +N     + + C   +  +L     +    A       +  P  +DE  
Sbjct: 129 SDWDVVATTGNTNAWESTLRVFCDKGDV-ILAEAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 250 GWSLNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVI 308
              +  + LE+I+    E   KP  L  I  G NPTG+ L  +  E+I+ +A K+  ++I
Sbjct: 188 ---IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIII 244

Query: 309 ADEVYQ--------ENVFEGLKFYS-----MKKVLRSLQRRYKELFSNVQLVSLHSTSKG 355
            DE Y         ++  E  K YS       + ++SL + +  + ++ ++V + S SK 
Sbjct: 245 EDEPYYFLQIDEYVKDKDERNKLYSRPTPTHDEFVKSLAKTFLSVDTDGRVVRMDSFSKV 304

Query: 356 LSGECGQRGGYM 367
           L+   G R G++
Sbjct: 305 LA--PGTRLGWI 314

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 71/147 (48%), Gaps = 13/147 (8%)

Query: 173 FRKTVAEYLSSRDGEPA----SAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPL 228
           F+   A Y +S+D        S +++ L  G+      +I   CK     +++  P Y +
Sbjct: 62  FKTLFAHYRNSKDNTANVPDLSHKNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSM 121

Query: 229 YTATITLNNT--VALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGA 286
           Y+    +N+   V  P  +++ S       D++R + E+++K      L + +PGNPTG 
Sbjct: 122 YSVCANINDVDVVNCPLIVEDNSFQM----DVKRTL-ETLKKDDLIRLLFITSPGNPTGK 176

Query: 287 ILPVESMERIFVIAAKYSIVVIADEVY 313
           I+ ++ +  I+V+    + +V+ DE Y
Sbjct: 177 IIAIKDI--IYVLEHWKNGLVVVDEAY 201

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 79/406 (19%), Positives = 159/406 (39%), Gaps = 74/406 (18%)

Query: 109 QLGQKPLSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQ 168
            LGQ   S+S    ++ E+   L++P+                         +  YS ++
Sbjct: 65  NLGQGFFSYSPPQFAIHEAQKALEIPL-------------------------VNQYSPTK 99

Query: 169 GVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGA-SLMIELLCKGQESGVLIP----- 222
           G      ++ +  S   G+    E++ +TTGA+ G  S ++ +L  G E  V  P     
Sbjct: 100 GRPSVINSLKKLYSPLYGQELKDENVTITTGANEGILSSLMGILNPGDEVIVFEPFFDQY 159

Query: 223 IPQYPLYTATIT---LNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVIN 279
           IP   L    +    +N    +   + E   W+++ ++L +          K   L++  
Sbjct: 160 IPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYEELAKAFTS------KTKALILNT 213

Query: 280 PGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKE 339
           P NP G +   E + +I  +  + ++V+I+DEVY     E L F      + +L     +
Sbjct: 214 PHNPIGKVFTKEELTKIGNLCVENNVVIISDEVY-----EFLYFTDSYTRIATLSPEIGQ 268

Query: 340 LFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVD 399
           L      +++ S  K  +   G R G++  +  + ++   + K    ++C          
Sbjct: 269 L-----TLTVGSAGKTFAA-TGWRIGWV--ISLNPELLSYVSK-GHTRIC---------- 309

Query: 400 LMLSRPKPGDESYERDLSE--RSSIRNALQERSKSLWETFNNL---EGVECRKPQGSMYL 454
              S P P  E+    + +  +     A++      +E F ++    G+    P+G+ ++
Sbjct: 310 --FSSPSPIQEAVANSIEDALKGDYFEAMRTDYIRKFEIFTSVFKEMGLPYTIPEGTYFI 367

Query: 455 ---FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGF 497
              F ++ +P+      E LD   D      L+N  G+  +P + F
Sbjct: 368 LVDFSKVNVPEDYPYPEELLDKGKDFRISYWLINELGVVAIPPTEF 413

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 91/213 (42%), Gaps = 21/213 (9%)

Query: 190 SAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEES 249
           S  D  LTTG +NG    + + C   +  +L     +    A+      +  P  +D + 
Sbjct: 129 SDWDSILTTGNTNGWESTLRIFCNKGDV-ILAEAHSFSSSLASAEAQGVITFPVPIDSDG 187

Query: 250 GWSLNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVI 308
              +  + LE I+        KP  L  I  G NPTG+ L  E  E I+ IA K+  ++I
Sbjct: 188 ---IIPEKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIII 244

Query: 309 ADEVY-------------QENVFEGLK-FYSMKKVLRSLQRRYKELFSNVQLVSLHSTSK 354
            DE Y             Q   +E  +   + ++ L+SL + +  L +  +++ + S SK
Sbjct: 245 EDEPYYFLQTGPYLKDLEQRKKYEDQQEQQNHEQFLKSLAKTFLSLDTEGRVIRMDSFSK 304

Query: 355 GLS--GECGQRGGYMELVGFSDDIREVILKMAS 385
            L+     G   G  +++ +   + E+ ++ AS
Sbjct: 305 VLAPGARLGWLTGSKKILQYYVSLHEMTVQGAS 337

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 20/182 (10%)

Query: 147 VRRAKRMMRDLQTSIG-AYSHSQG---VLGFRKTVAEYLSSRDGEPASAEDIFLTTGASN 202
           +   KR  ++L  S+   YS +QG   +L F KT    L++      +  DI L  G+S+
Sbjct: 119 IHVTKRFPQELPLSMSLQYSETQGMKPLLDFIKTFITKLNNTPPYNETLYDIMLANGSSD 178

Query: 203 GASLMIELLCKGQ-----ESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDD 257
               + E LC        E    +P+    + T    +   + L Y   E+ G  ++I+ 
Sbjct: 179 SMFKVFETLCDESTTVLMEEFTFVPVISNVMATGAKCIPLKLNLNY---EDQG--IDIEY 233

Query: 258 LERIIIE-----SIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADE 311
           LE ++       + +   KP  L  I+ G NP G  L +E   +I+ IA ++ ++++ D+
Sbjct: 234 LENLLDNWGGKSNTKHLSKPKILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDD 293

Query: 312 VY 313
            Y
Sbjct: 294 PY 295

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 69/154 (44%), Gaps = 21/154 (13%)

Query: 171 LGFRKTVAEYLSSRDGE---------PASAEDIFLTTGASNGASLMIELLCKGQESGVLI 221
           L F+  +A +   R+GE         P +AE++ L  G+      +I   C   +  +L+
Sbjct: 60  LAFKTAMANF---RNGENHQYKDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILV 116

Query: 222 PIPQYPLYTATITLNNT--VALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVIN 279
             P Y +Y+    +N+   V  P    + S +  N D+    +I++ +       + + +
Sbjct: 117 LPPTYSMYSVCAHINDVEIVKCPLITSDNS-FQANTDE----VIKTAQNDPSIKLIFITS 171

Query: 280 PGNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           PGNPTGA +    +E+I     +  +VV  DE Y
Sbjct: 172 PGNPTGAKVETSRIEKILQNWDRGMVVV--DEAY 203

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 96/228 (42%), Gaps = 25/228 (10%)

Query: 193 DIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWS 252
           D+  TTG +N     + + C   +  +L     +    A+      +  P  +D      
Sbjct: 132 DVVATTGNTNAWESTLRVFCNRGDV-ILAEAHSFSSSLASAEAQGIITFPVPIDAHG--- 187

Query: 253 LNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADE 311
           +  + LE ++    E   KP  L  I  G NPTG+ L  E  + I+ IA K+  ++I DE
Sbjct: 188 IIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDE 247

Query: 312 VY--------------QENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLS 357
            Y              +  V +     S +  L+SL   +  + ++ +++ + S SK L+
Sbjct: 248 PYYFLQVGEYISDLSKRAEVAQKNANISHEDFLKSLALTFLSVDTDGRVIRMDSFSKVLA 307

Query: 358 GECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG-GQALVDLMLSR 404
              G R G+   +  S  + +  L +  + + SP G  Q+LV   L+R
Sbjct: 308 --PGTRLGW---ITGSSKLLQAYLSLHEMTIQSPSGFSQSLVSGTLNR 350

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 87/180 (48%), Gaps = 18/180 (10%)

Query: 147 VRRAKRMMRDLQTSIG-AYSHSQG---VLGFRKTVAEYLSSRDGEPASAEDIFLTTGASN 202
            R   ++ R+L   I   YS +QG   +L F K +   +++ +  P    D+ L  G+S+
Sbjct: 94  ARIDNKLPRELPIPISFQYSQTQGLAPILDFLKLI---VANCNNPPYQNWDLLLANGSSD 150

Query: 203 GASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWS---LNIDDLE 259
               + + L   + + VL+    +    + IT      +P  L+  S  S   +N+  L+
Sbjct: 151 SMFKLFDTLTD-ETTTVLVEEFTFSPVLSNITATGASCVPLQLNFTSNPSNQGINVTYLQ 209

Query: 260 RIIIESIEKG-----VKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
            ++ E+ + G      +P+ L  I+ G NPTG  + +E+  RI+ +A KY+ +++ D+ Y
Sbjct: 210 HLL-ENWQSGPYKHLNRPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 59/150 (39%), Gaps = 13/150 (8%)

Query: 190 SAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEES 249
           S  DI LTTG +NG    + + C   +  +L     +    A+         P  +DE  
Sbjct: 129 SDWDIILTTGNTNGWESTLRVFCNKGDV-ILAEAHSFSSSLASAEAQGITTFPIPIDEHG 187

Query: 250 GWSLNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVI 308
              +  + LE I+        KP  L  I  G NPTG  L  E    I+ IA K+  ++I
Sbjct: 188 ---IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLII 244

Query: 309 ADEVYQENVFEGLKFYSMKKVLRSLQRRYK 338
            DE Y         F  M + +  L  R K
Sbjct: 245 EDEPYY--------FLQMGEYIADLDERKK 266

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 92/227 (40%), Gaps = 24/227 (10%)

Query: 193 DIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWS 252
           D+F T G +N     + L C   +  +L     +    A+      +  P  +D +    
Sbjct: 134 DVFATAGNTNAWESTLRLFCNRGDV-ILAEAHSFSSSLASAEAQGVITFPVPIDADG--- 189

Query: 253 LNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADE 311
           +  + L +I+        KP  L  I  G NPTG  +     E I+ IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 312 VY---QENVF----------EGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSG 358
            Y   Q N +          +        + L+SL   +  L +  +++ + S SK L+ 
Sbjct: 250 PYYFLQMNPYIKDLKEREKAQNCPKQDHDEFLKSLANTFLSLDTEGRVIRMDSFSKVLA- 308

Query: 359 ECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG-GQALVDLMLSR 404
             G R G+   +  S  I +  L +  + + SP G  Q LV   LSR
Sbjct: 309 -PGTRLGW---ITGSSRILKHYLSLHEMTVQSPAGFTQVLVSSTLSR 351

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 77/159 (48%), Gaps = 17/159 (10%)

Query: 258 LERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADEVY--- 313
           LE I+     +  KP  L  I  G NPTG+ L  +  + I+ IA K+  ++I DE Y   
Sbjct: 196 LEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPYYFL 255

Query: 314 QENVFE-------GLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGY 366
           Q + +E        ++F S  + + SL + +  L +  +++ + S SK L    G R G+
Sbjct: 256 QMDAYEKDPSKRKAIEFASHDEFVNSLAKSFISLDTEGRVIRMDSFSKVLG--PGTRLGW 313

Query: 367 MELVGFSDDIREVILKMASIQLCSPVG-GQALVDLMLSR 404
             LVG S  I     ++  + + +P G  QA+V   L+R
Sbjct: 314 --LVG-SKRILRAYTQLHEMTIQNPSGFSQAIVSGTLNR 349

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 122/290 (42%), Gaps = 55/290 (18%)

Query: 192 EDIFLTTGASNGA-SLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEE-- 248
           E+I +TTGA+ G  + ++ LL  G E  VL P     +Y   +       +P    ++  
Sbjct: 100 ENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDLK 159

Query: 249 ------SGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAK 302
                 S W+L+ D     I E      K   +++ +P NPTG +   E +  +  I  +
Sbjct: 160 TRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICVE 213

Query: 303 YSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQ 362
            ++ +I+DEVY     E L F      L SL        SN+ L ++ S  K +    G 
Sbjct: 214 KNVYIISDEVY-----ENLYFTPECVKLASLSPE----ISNITL-TIGSAGK-IFAVTGW 262

Query: 363 RGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPG--------DESYER 414
           R G++     S+++   +LK+AS          A + +  S P P         D +   
Sbjct: 263 RIGWI----ISENVE--LLKLAS---------SAHIKICFSSPSPPQLACAHAIDIALNS 307

Query: 415 DLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYL---FPRLVLP 461
           D  +R  +R    E+ + L   F  L G+    P+GS ++   F +L +P
Sbjct: 308 DYFDR--MRKDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 69/185 (37%), Gaps = 17/185 (9%)

Query: 193 DIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWS 252
           DI  T G +N     + + C   +  +L     +    A          P  +D+     
Sbjct: 133 DIIATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSCLAAAQAQGITTFPIPIDDNG--- 188

Query: 253 LNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADE 311
           +  + LE+I+        KP  L  I  G NPTG  LP   ME I+ IA K+  +++ D 
Sbjct: 189 IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDA 248

Query: 312 VYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSG---ECGQRGGYME 368
            Y         F  M K ++ +  R   L S V+  +     K L      C   G  + 
Sbjct: 249 PYY--------FLQMDKYVKDVNER-TALRSQVKKQTHEEFLKALDKTFLSCDNDGRVIR 299

Query: 369 LVGFS 373
           L  FS
Sbjct: 300 LDSFS 304

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 95/227 (41%), Gaps = 24/227 (10%)

Query: 193 DIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWS 252
           D+  T G +N     + + C   +  +L+    +    A+      +  P  +D +    
Sbjct: 134 DVLATAGNTNAWESTLRVFCNRGDV-ILVEAHSFSSSLASAEAQGVITFPVPIDADG--- 189

Query: 253 LNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADE 311
           +  + L +++        KP  L  I  G NPTG  +     E I+ IA KY  +++ DE
Sbjct: 190 IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDE 249

Query: 312 VY---QENVF-----EGLKFYSMKK-----VLRSLQRRYKELFSNVQLVSLHSTSKGLSG 358
            Y   Q N +     E  K  S  K      L+SL   +  L +  +++ + S SK L+ 
Sbjct: 250 PYYFLQMNPYIKDLKEREKAQSSPKQDHDEFLKSLANTFLSLDTEGRVIRMDSFSKVLA- 308

Query: 359 ECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG-GQALVDLMLSR 404
             G R G+   +  S  I +  L +  + + +P G  Q LV+  LSR
Sbjct: 309 -PGTRLGW---ITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATLSR 351

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 95/227 (41%), Gaps = 24/227 (10%)

Query: 193 DIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWS 252
           D+  T G +NG    + + C   +  +L     +    A+      +  P  +D      
Sbjct: 134 DVLATAGNTNGWESTLRVFCNRGDV-ILAEAHSFSSSLASAEAQGVITFPIPID---AGG 189

Query: 253 LNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADE 311
           +  + L +I+        KP  L  I  G NPTG  +     E I+ IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 312 VY---QENVF-----EGLKFYSMKK-----VLRSLQRRYKELFSNVQLVSLHSTSKGLSG 358
            Y   Q N +     E  K  S  K      L+SL   +  L ++ +++ + S SK L+ 
Sbjct: 250 PYYFLQMNPYIKDLKEREKAQSSPKQDHDEFLKSLANTFLSLDTDGRVIRMDSFSKVLA- 308

Query: 359 ECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG-GQALVDLMLSR 404
             G R G+   +  S  I +  L +  + + +P G  Q LV+  LSR
Sbjct: 309 -PGTRLGW---ITGSSKILKPYLSLHEMTIQAPAGFTQVLVNATLSR 351

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 117/290 (40%), Gaps = 39/290 (13%)

Query: 136 EVLNLIYKPDAVRRAKR-----MMRDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPAS 190
           +  ++  K D V +A       + R LQ     Y  S G   F   V E+         S
Sbjct: 78  DTCHIAIKKDGVSKAGSSTDIPLSRALQ-----YGFSMGQPEFLSFVREHTQLVHKMKYS 132

Query: 191 AEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPL----YTATITLNNTVALPYYLD 246
             ++  TTG +      + + C     G  I   QY      Y A     N   +P   D
Sbjct: 133 DWNVLATTGNTGSWESTLRIFCN---RGDTILAEQYTFSSSVYAAEAQGINVFPVPLDAD 189

Query: 247 EESGWSLNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSI 305
                 L  + LE I+        KP  L  I  G NPTG+ L  +    I+ IA K+ +
Sbjct: 190 -----GLIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDL 244

Query: 306 VVIADE--------VYQENVFE--GLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKG 355
           ++I DE         YQ++V +     F S +  + SL + +  L +  +++ L S SK 
Sbjct: 245 LIIEDEPYYFLQMDAYQKDVSQRKETHFASQEDFVNSLAKSFISLDTEGRVLRLDSFSKV 304

Query: 356 LSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG-GQALVDLMLSR 404
           L    G R G+  +VG S  I +   ++  + + +P G  QA+V   L+R
Sbjct: 305 LG--PGTRLGW--IVG-SKKILQKYTQLHEMTIQNPSGFSQAIVAGTLNR 349

>SAKL0E02948g Chr5 complement(241418..242689) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q01802 Saccharomyces cerevisiae
           YKL106W AAT1 Mitochondrial aspartate aminotransferase
           catalyzes the conversion of oxaloacetate to aspartate in
           aspartate and asparagine biosynthesis
          Length = 423

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 122/292 (41%), Gaps = 22/292 (7%)

Query: 146 AVRRAKRMM---RDLQTSIGAYSHSQGVLGFRKTVAEYL---SSRDGEPASAED--IFLT 197
           +V RA++++   + L T + +Y    G   ++  V  +L   S   GEP  + D   F+ 
Sbjct: 58  SVARAQQILENHKQLNTDL-SYLPITGSAEYQSNVLNFLFRDSCPQGEPYLSHDKISFVQ 116

Query: 198 TGASNGA-SLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNID 256
           T +  GA ++  +LL       V IP P +  +T     N    + YY    +G +L++D
Sbjct: 117 TLSGTGALAVASKLLYLFVSKTVWIPAPSWANHTNVFQSNGFKDIRYYTYYNNG-TLDVD 175

Query: 257 DLERIIIESIEKGVKPACLVV-INPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQE 315
              + +  +  K   P C+V+     NPTG    +E   +I       +++ I D  YQ 
Sbjct: 176 SWLQDLRSATRKYRAPQCIVLHACCHNPTGVDPTIEQWSKILDAIHDLNMIPILDMAYQG 235

Query: 316 NVFEGLKFYSMKKVLRSLQRRYKELFSN-VQLVSLHSTSKGLSGE----CGQRGGYMELV 370
              E    Y    +LR      +  +SN + L    + + GL GE               
Sbjct: 236 --LESGNLYRDAYLLRMCLDSSRYHWSNGLYLCQSFAKNMGLYGERVGSLSVVVPSSVTH 293

Query: 371 GFSDDIREVILKMASIQLCSPVG-GQALVDLMLSRPKPGDESYE--RDLSER 419
           G   +I   + K+      SP G G  + +L+LS  K  D+ +   R++S+R
Sbjct: 294 GLKLNIDSQLKKIVRGIYSSPPGYGSRVANLVLSDQKLKDQWFRDVRNMSQR 345

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 67/147 (45%), Gaps = 11/147 (7%)

Query: 173 FRKTVAEY------LSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQY 226
           F+K +A Y        S D  P + E+  L  G+      +I   C   +  +L+  P Y
Sbjct: 62  FKKAMASYRNKTSVFRSYDLVPLTDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTY 121

Query: 227 PLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGA 286
            +Y+    +N+   +   L  E   S  ID  E + I + +  +K   + + +PGNPTGA
Sbjct: 122 SMYSVCANINDVDVVTCPLITEDN-SFQIDATEILNILANDPLIK--LVFITSPGNPTGA 178

Query: 287 ILPVESMERIFVIAAKYSIVVIADEVY 313
            + ++ +E  +++      +VI DE Y
Sbjct: 179 KIEIDRIE--YLLKNWDQGLVIVDEAY 203

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 96/227 (42%), Gaps = 24/227 (10%)

Query: 193 DIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWS 252
           D+  T G +N     + + C   +  +L     +    A       +A P  +D +    
Sbjct: 134 DVVATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSSLAAAEAQGIIAFPVPIDADG--- 189

Query: 253 LNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADE 311
           +  + L +I+        KP  L  I  G NPTG  +     E I+ IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIVEDE 249

Query: 312 VY---QENVF-----EGLKFYSMKK-----VLRSLQRRYKELFSNVQLVSLHSTSKGLSG 358
            Y   Q N +     E  K  S  K      L+SL + +  L ++ +++ + S SK L+ 
Sbjct: 250 PYYFLQMNAYIKDLKEREKAQSSPKQDHDEFLKSLSKTFLSLDTDGRVIRMDSFSKVLA- 308

Query: 359 ECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG-GQALVDLMLSR 404
             G R G+  + G S  + E    +  + + +P G  Q LV+  LSR
Sbjct: 309 -PGTRLGW--ITGSSKTL-EPYYSLHEMTIQAPAGFTQVLVNATLSR 351

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 74/330 (22%), Positives = 132/330 (40%), Gaps = 65/330 (19%)

Query: 193 DIFLTTGASNGA-SLMIELLCKGQESGVLIPIPQYPLYTATITL--NNTVALPYYLDEE- 248
           ++ +TTGA+    S ++ LL +G E  V++  P +  Y + I +       +P +  +E 
Sbjct: 120 NVQVTTGANEAILSCLVGLLNQGDE--VIVFEPFFDQYISNIEIPGGKVTYVPLHPPKEL 177

Query: 249 -------SGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAA 301
                  + W+++ D+L   I        K   L++  P NP G +   E +  I  I  
Sbjct: 178 ENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNICV 231

Query: 302 KYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECG 361
           + ++V+I+DEVY     E L F S    + +L      L          + S G +G+  
Sbjct: 232 ENNVVIISDEVY-----EHLYFTSEFTRIATLSPEIGNL----------TLSVGSAGKTF 276

Query: 362 QRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDESYERDLSERSS 421
              G+   +G+       +LK AS+         A   +  + P P  E+  +      S
Sbjct: 277 AATGWR--IGWIVSQNAELLKYASM---------AHTRICFASPSPFQEACAK------S 319

Query: 422 IRNALQER--SKSLWETFNNLE---------GVECRKPQGSMYL---FPRLVLPQKAIKA 467
           I  ALQ     K   E  N  +         G+   +P+G+ ++   F ++ +P+     
Sbjct: 320 IEIALQNNYFEKMRQEYINKFDIFTRVFDELGLPYTQPEGTYFVLVDFSKVKIPEDYPFP 379

Query: 468 AESLDMQPDEFYCTELLNSTGICTVPGSGF 497
            E L    D      L+N  G+  +P + F
Sbjct: 380 EELLSKAKDFRISYWLINELGVVAIPPTEF 409

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 63/128 (49%), Gaps = 9/128 (7%)

Query: 188 PASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNT--VALPYYL 245
           P +AE+I L  G+      +I + C   +  ++I  P Y +Y+    +N+   V +P  +
Sbjct: 84  PLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPL-V 142

Query: 246 DEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSI 305
            E++ + ++       ++E++ +      + + +PGNPT A++    +E+  V+      
Sbjct: 143 AEDNSFQMDTSK----VLETLAQDPTIKLIFITSPGNPTAALIDTAEIEK--VLNNWTGG 196

Query: 306 VVIADEVY 313
           +V+ DE Y
Sbjct: 197 LVVVDEAY 204

>KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 525

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 66/137 (48%), Gaps = 14/137 (10%)

Query: 188 PASAE-DIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPL--YTATITLNNTVALPYY 244
           PA  E D+ L  G+S+    +IE LC   +S V + + ++      A IT      +P  
Sbjct: 149 PAYNEWDVTLANGSSDATFKIIETLC---DSSVTVLVEEFTFSPTLAIITAAGGTTVPLK 205

Query: 245 LDEESGWSLNIDDLERI--IIESIEKG-----VKPACLVVINPG-NPTGAILPVESMERI 296
           LD  +   +   ++E +  ++++  +G      KP  L  I  G NPTG  L  E  ++I
Sbjct: 206 LDITADPDVQGINVEYLTDLLDNWSQGPNAHLSKPKLLYTIPTGQNPTGMTLSFEKRKQI 265

Query: 297 FVIAAKYSIVVIADEVY 313
           + +A K+  ++I D+ Y
Sbjct: 266 YALAEKHDFIIIEDDPY 282

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 65/141 (46%), Gaps = 5/141 (3%)

Query: 173 FRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTAT 232
           +R   + Y +  + +P +A+++ L  G+      +I   C   +  +L+  P Y +Y+  
Sbjct: 69  YRNKTSSYANDPEVKPLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVC 128

Query: 233 ITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVES 292
             +N+   +   L    G S  +D    + I   +  +K   + V +PGNPTGA +    
Sbjct: 129 ANINDIEVVQCPLTVSDG-SFQMDTEAVLTILKNDSLIK--LMFVTSPGNPTGAKIKTSL 185

Query: 293 MERIFVIAAKYSIVVIADEVY 313
           +E+  V+    + +V+ DE Y
Sbjct: 186 IEK--VLQNWDNGLVVVDEAY 204

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 117/282 (41%), Gaps = 39/282 (13%)

Query: 168 QGVLGFRKTVAEYLSSRDGEPASAEDI------FLTTGASNGA-SLMIELLCKGQESGVL 220
           +G   F+  V  +L  RD  P  A  +      F+ T +  GA ++  +LL       V 
Sbjct: 83  KGCPDFQINVLSFLY-RDSCPRGATFLDQNRISFVQTLSGTGALAVASKLLSLFMSRSVW 141

Query: 221 IPIPQYPLYTATITLNNTVALPYY-------LDEESGWSLNIDDLERIIIESIEKGVKPA 273
           IP P +P +      N    + YY       LD E GW   I DLE+    + ++G  P 
Sbjct: 142 IPNPSWPNHANVFQNNGFKEINYYSYYKDGSLDIE-GW---IQDLEK---HAQKEGEDPQ 194

Query: 274 CLVV-INPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLR- 331
           C+V+     NPTG     E  +RI     + +++ I D  YQ    +    Y    +L  
Sbjct: 195 CIVLHACCHNPTGIDPSKEQWQRILDKIHELNLIPIIDMAYQG--LDSGDLYKDAYLLNM 252

Query: 332 SLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSD-----DIREVILKMASI 386
           SL     +  + + L    + + GL GE   R G + +V   D     ++   + K+   
Sbjct: 253 SLDENRYQWKNGLFLCQSFAKNMGLYGE---RVGSLSVVTPPDSKLKVNVDSQLKKIVRG 309

Query: 387 QLCSPVG-GQALVDLMLSRPKPGDESYERDLSERSSIRNALQ 427
              SP G G  + +L+LS P   +E +E    +  ++ N LQ
Sbjct: 310 MYSSPPGYGSRVANLVLSTPHLKEEWFE----DVKNVANRLQ 347

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 77/151 (50%), Gaps = 14/151 (9%)

Query: 175 KTVAEYLSSRDGEPA-SAE--DIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTA 231
           +  A+YL ++  +PA SA+  D+ L++G+ +      E  C  ++S VL+    +    +
Sbjct: 135 RNFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFC-DEKSTVLMEEFTFTPVIS 193

Query: 232 TITLNNTVALPYYLD---EESGWSLNIDDLERIIIESIEKG-----VKPACLVVINPG-N 282
            +       +P  ++   + S   +++D L +++ ++   G      KP  L  I  G N
Sbjct: 194 HVKATGAECIPLKMNLTKDPSTQGIDVDYLTQLL-DNWSSGPYKHLNKPRILYTICTGQN 252

Query: 283 PTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           PTG  +P+E+  +I+ +A K++ +++ D+ Y
Sbjct: 253 PTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 76/161 (47%), Gaps = 16/161 (9%)

Query: 155 RDLQTSIGAYSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKG 214
           +DLQ + G+   S  +   R  +A    S  G   + +++ +T GA   A+ +I     G
Sbjct: 49  QDLQLTYGSIKGSDKL---RSLIA----SMYGPEFNKDNVLVTNGAI-AANFLIYYTLVG 100

Query: 215 QESGVLIPIPQYP-LYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPA 273
               V+   P Y  LY+        V+L   L +E G+  NI+ L+++I  + +      
Sbjct: 101 PGDHVICVDPTYAQLYSVPKMFGAEVSL-LKLQKEDGFIPNIETLKKMIKSNTK------ 153

Query: 274 CLVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQ 314
            +++ NP NP G+ +  E++  I  +  + +I +  DEVY+
Sbjct: 154 LIIINNPNNPLGSAISTETLNDICQLCEENNIYLHCDEVYK 194

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 70/148 (47%), Gaps = 15/148 (10%)

Query: 173 FRKTVAEYL----SSRDGEPASAEDIFLTTGASNGASLMIELLC-KGQESGVLIPIPQYP 227
           F+  +A Y     S +D  P +AE++ L  G+      +I   C  G+E  + +P P Y 
Sbjct: 62  FKTAMANYRNRTSSFKDITPLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMP-PTYG 120

Query: 228 LYTATITLNNT--VALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTG 285
           +Y+   ++N+   V  P      S  S  +D     ++++++K      + + +PGNPTG
Sbjct: 121 MYSVCASVNDVEIVKCPLV---TSDNSFQVD--TEAVLDTLKKDPLIKLVFITSPGNPTG 175

Query: 286 AILPVESMERIFVIAAKYSIVVIADEVY 313
           A +    +E+I     +  +VV  DE Y
Sbjct: 176 AKIETSRIEKILQNWDQGILVV--DEAY 201

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 67/152 (44%), Gaps = 16/152 (10%)

Query: 171 LGFRKTVAEY-------LSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           L F+  +AEY        +     P ++ +I L  G+      +I   C      +L+  
Sbjct: 60  LQFKTAIAEYRNRSSTFTADECTRPLTSGNICLGVGSDESIDAIIRATCVPAREKILVLP 119

Query: 224 PQYPLYTATITLNNT--VALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPG 281
           P Y +Y+    +N+   V  P  + E++ + ++ D +  I+    E  +    L + +PG
Sbjct: 120 PTYSMYSVCAKINDVEVVTCPL-ITEDNSFQMDSDKVLDILNNDQEIKL----LFITSPG 174

Query: 282 NPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           NPTGA +    +E++     +  +VV  DE Y
Sbjct: 175 NPTGAQIETARIEKVLQNWDRGLVVV--DEAY 204

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 118/270 (43%), Gaps = 49/270 (18%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAE------DIFLTTGASNGASLMIELLCKGQES 217
           Y+ S+G     + V + + SR   P  ++      D+ L+ G+++    + E +C  + +
Sbjct: 102 YAESKGTPPLLRFVKD-MVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETIC-DEST 159

Query: 218 GVLIPIPQYPLYTATITLNNT---------VALPYYLDEESGWSLNIDDLERIIIESIEK 268
            VLI       +T T  ++N          + +   LD +S   +++D L +++ ++   
Sbjct: 160 TVLIE-----EFTFTPAMSNVEATGAKVVPIKINLTLDRDSQ-GIDVDHLTQLL-DNWST 212

Query: 269 G-----VKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADEVY--------- 313
           G      KP  L  I  G NPTG  +P    E+I+ +A K+  +++ D+ Y         
Sbjct: 213 GPYKHLAKPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPYGYLYFPPFN 272

Query: 314 ----QENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMEL 369
                EN ++     + + +   L + +  L ++ +++ L + SK  +   G R  ++  
Sbjct: 273 SEDPSENPYQSSNLTTERYLNDYLMKSFLTLDTDARVIRLETFSKIFA--PGLRLAFIVA 330

Query: 370 VGFSDDIREVILKMASIQLCSPVGG-QALV 398
             F     E IL +A I   +P G  QA+V
Sbjct: 331 NKF---FLERILDLADITTRAPSGASQAIV 357

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 68/144 (47%), Gaps = 9/144 (6%)

Query: 172 GFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTA 231
            +R   + YL+    +P SA+++ L  G+      +I   C   +  +L+  P Y +Y+ 
Sbjct: 68  AYRNETSSYLNDPTVKPLSADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSV 127

Query: 232 TITLNNT--VALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILP 289
              +N+   V  P  + + S + +N + +  + I + +  +K   +   +PGNPTGA + 
Sbjct: 128 CANINDVEVVQCPLTVSDNS-FQMNTEAV--LTILNNDPLIK--IMFATSPGNPTGAKIK 182

Query: 290 VESMERIFVIAAKYSIVVIADEVY 313
              +E   V+    + +V+ DE Y
Sbjct: 183 TCLIEE--VLQKWDNGIVVVDEAY 204

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 67/143 (46%), Gaps = 10/143 (6%)

Query: 173 FRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTAT 232
           +R T + +   RD    + E++ L  G+      +I   C   +  +L+  P Y +Y+  
Sbjct: 70  YRNTTSAF-KDRDLATLTNENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVC 128

Query: 233 ITLNN--TVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPV 290
             +N+   V  P  + E++ + LN D     +++ ++       + + +PGNPTG  +  
Sbjct: 129 ANINDIEVVECPL-IYEDNSFQLNSDK----VLDILKNDPLIKLVFITSPGNPTGVKIET 183

Query: 291 ESMERIFVIAAKYSIVVIADEVY 313
           + +E+  V+    + +V+ DE Y
Sbjct: 184 KRIEK--VLQNWDNGLVVVDEAY 204

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 95/226 (42%), Gaps = 20/226 (8%)

Query: 193 DIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWS 252
           DI  TTG++ G    + + C   ++ VL+    Y              +P  LD E    
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEDYTYSSSVEAADAQGLNCVPMPLDGEGIVP 190

Query: 253 LNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADE 311
             ++++         +   P  L  I  G NPTG  L       I+ +A +Y I++I D+
Sbjct: 191 SKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIIIEDD 250

Query: 312 VY----------QENVFEGLKFYSMKKV--LRSLQRRYKELFSNVQLVSLHSTSKGLSGE 359
            Y          ++   E  +  +M +   + SL R + EL ++ ++V L S SK  +  
Sbjct: 251 PYYFLQMDPYVSEDARLETAEASTMSQATFMNSLNRSFLELDTDGRVVRLESVSKTFAPG 310

Query: 360 CGQRGGYMELVGFSDDIREVILKMASIQLCSPVG-GQALVDLMLSR 404
           C  R G+  LVG S  + +    +  + + S  G  Q ++  +L+R
Sbjct: 311 C--RMGW--LVG-SKHLLDNYWNLHEVSIQSTCGFAQTILSGILNR 351

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 117/267 (43%), Gaps = 40/267 (14%)

Query: 187 EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLD 246
           E  S  D+ L+ G+++    + E +C  + + V+I    +    + +       +P  +D
Sbjct: 130 ETESNWDVILSGGSNDSMFKVFETIC-DESTTVMIEEFTFTPAMSNVEATGAKVIPIKMD 188

Query: 247 -----EESGWSLNIDDLERIIIESIEKG-----VKPACLVVINPG-NPTGAILPVESMER 295
                E  G  ++++DL R++ ++   G      KP  L  I  G NPTG  +P    E+
Sbjct: 189 LTFDRERQG--IDVEDLTRLL-DNWSTGPYKHLNKPKVLYTIATGQNPTGMSVPRWKREK 245

Query: 296 IFVIAAKYSIVVIADEVYQ-------------ENVFEGLKFYSMKKVLRSLQRRYKELFS 342
           I+ +A K+  +++ D+ Y              EN ++       + +   L + +  L +
Sbjct: 246 IYQLAQKHDFLIVEDDPYGYMYFPSYNPQNPLENPYDSSDLTIERYLNDFLMKSFLTLDT 305

Query: 343 NVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG-GQALVDLM 401
           + +++ L + SK  +   G R  ++    F   + + IL +A I   +P G  QA+V   
Sbjct: 306 DARVIRLETFSKIFAP--GLRLSFIVANKF---LLQKILDLADITTRAPSGTSQAIV--- 357

Query: 402 LSRPKPGDESYERDLSERSSIRNALQE 428
            S  K   ES   ++S   S R+A+ E
Sbjct: 358 YSTIKAMAES---EMSSSVSFRDAMFE 381

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 95/230 (41%), Gaps = 30/230 (13%)

Query: 193 DIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYT--ATITLNNTVALPYYLDEESG 250
           ++  + G +N     + + C   + G ++   +Y   +  A         +P  +D    
Sbjct: 131 EVIASVGNTNAWESTLRIFC---DRGDVVLFEEYSFSSCLAACEAQGVTTIPIPID---A 184

Query: 251 WSLNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIA 309
           + +  + LE ++        KP  L  I  G NPTG  LP +  E I+ IA K+  +++ 
Sbjct: 185 FGIVPEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVE 244

Query: 310 DEVY--------------QENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKG 355
           DE Y              +E V+   K  S ++  +SL + +  L +  +++ L S SK 
Sbjct: 245 DEPYYFLQVGDYIEDLKKREQVYSAPK-QSHEEFKKSLVKSFLSLDTEGRVIRLDSFSKV 303

Query: 356 LSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG-GQALVDLMLSR 404
           L    G R G+   +  S  + +  + +  + +  P G  Q LV   L R
Sbjct: 304 LG--PGTRLGW---ITGSKQLMKAYVSLHEMTIQCPSGFSQVLVAGTLHR 348

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 107/258 (41%), Gaps = 26/258 (10%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           Y +S+G       + E+ S     P    DI  TTG++ G    + + C   ++ VL+  
Sbjct: 103 YGNSRGQKELVAYLKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFCNKGDT-VLLEE 161

Query: 224 PQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIE---KGVKPACLVVINP 280
             Y              +P  LD E    +  + LE ++I   +       P  L  I  
Sbjct: 162 YTYSSSVEAADAQGLNCIPMPLDGEG---IIPEKLEEMLINWSDLYPDIPMPKLLYTIPT 218

Query: 281 G-NPTGAILPVESMERIFVIAAKYSIVVIADEVY---QENVFE---------GLKFYSMK 327
           G NPTG  L       I+ +A KY +++I DE Y   Q + +E           +  +  
Sbjct: 219 GQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHA 278

Query: 328 KVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQ 387
           + + SL + + EL    ++V L S SK  +  C  R G+  LVG S  + +    +  + 
Sbjct: 279 EFIGSLGKSFLELDVEGRVVRLDSVSKTFAPGC--RMGW--LVG-SKHLLDNYWNLHEVS 333

Query: 388 LCSPVG-GQALVDLMLSR 404
           + S  G  Q+++  +L+R
Sbjct: 334 IQSTCGFAQSILGGILNR 351

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 76/164 (46%), Gaps = 20/164 (12%)

Query: 164 YSHSQGV---LGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQ----- 215
           YS ++G+   L F +   +++ +      S  ++ L  G+S+    + E LC        
Sbjct: 109 YSETRGLNPLLDFIRYFIKWIGNSPPYEDSLWEVMLANGSSDSMFKVFETLCDESDTVLM 168

Query: 216 ESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKG-----V 270
           E    +P+    + T    +   V L Y   E+ G  ++ID L  ++  + ++G      
Sbjct: 169 EEFTFVPVISNVMATGAKCIPIKVNLNY---EDQG--IDIDYLSNLL-NNWKEGPYKHLS 222

Query: 271 KPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           KP  L  I+ G NP G  L +E  E+I+ IA ++ ++++ D+ Y
Sbjct: 223 KPKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPY 266

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 54/252 (21%), Positives = 108/252 (42%), Gaps = 20/252 (7%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           Y HSQG     K + E+            ++ +T G ++     + + C   ++ +L   
Sbjct: 103 YGHSQGQPELLKFIREHTEIIHTMQYDDWELLVTAGNTSAWESTLRIFCNRGDT-ILAEA 161

Query: 224 PQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPG-N 282
             +    +       +  P  +D++    +  + L  I+     +  KP  L  I  G N
Sbjct: 162 HSFSSSLSAAQAQGIITFPVPIDDKG---IIPEKLAAIMDNWNPETPKPKLLYTIPTGQN 218

Query: 283 PTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEG-LKFYSMKK--------VLRSL 333
           PTG+ L  E   +++ IA K+  +++ DE Y     E  +K  S++K         L SL
Sbjct: 219 PTGSSLDAERKSQVYKIAQKHDFLIVEDEPYYFLQMEDYVKDPSLRKEVKLSHDEFLASL 278

Query: 334 QRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG 393
            + +  + ++ +++ + S SK L+   G R G++     S+ I +  L +  + + +  G
Sbjct: 279 DQTFLSIDTDGRVIRMDSFSKVLA--PGSRLGWITC---SNQIMKAYLALYEMSMQAAAG 333

Query: 394 -GQALVDLMLSR 404
             Q++V   LS+
Sbjct: 334 FTQSIVSATLSK 345

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 103/235 (43%), Gaps = 30/235 (12%)

Query: 187 EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLD 246
           E  S  D+ L+ G+++    + E  C  + + V+I    +    + +       +P  ++
Sbjct: 178 ETDSNWDVILSGGSNDSMYKVFETFCD-ESTTVMIEEFTFTPAVSNVEATGATVVPIKIN 236

Query: 247 ---EESGWSLNIDDLERIIIESIEKGV-----KPACLVVINPG-NPTGAILPVESMERIF 297
              +    S+++D L +++ E+   G      KP  L  I  G NPTG  +P    E+I+
Sbjct: 237 LSADRETQSVDVDYLSQLL-ENWSTGPYRHLNKPRVLYTIATGQNPTGMSVPQWKREKIY 295

Query: 298 VIAAKYSIVVIADEVYQ-------------ENVFEGLKFYSMKKVLRSLQRRYKELFSNV 344
            +A ++  +++ D+ Y              EN ++     + + +   L + +  L ++ 
Sbjct: 296 ELAQRHDFLIVEDDPYGYLYFPPFDPENPLENPYQSSSVTTERYLNEFLMKSFLTLDTDA 355

Query: 345 QLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVG-GQALV 398
           +++ L + SK  +   G R  ++    F   I E +L +A I   +P G  QA+V
Sbjct: 356 RVIRLETFSKIFAP--GLRLSFIVANKF---ILEKVLDLADITTRAPSGTSQAIV 405

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 54/145 (37%), Gaps = 13/145 (8%)

Query: 193 DIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWS 252
           D+  T G +N     + + C   +  +L     +    A          P  +D++    
Sbjct: 133 DVVATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSCLAAAQAQGITTFPVPIDDKG--- 188

Query: 253 LNIDDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADE 311
           +    LE I+        KP  L  I  G NPTG  L  E    IF IA K+  ++I D 
Sbjct: 189 IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDA 248

Query: 312 VYQENVFEGLKFYSMKKVLRSLQRR 336
            Y         F  M K  R LQ+R
Sbjct: 249 PYY--------FLQMDKYERDLQKR 265

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 62/130 (47%), Gaps = 9/130 (6%)

Query: 186 GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYP-LYTATITLNNTVALPYY 244
           G   SA+++ +T GA  GA+ ++     G+   V+   P Y  LY+        V L   
Sbjct: 74  GVQFSADNVLVTNGAI-GANFLLYYTLVGKGDHVICVHPTYSQLYSVPKMFGAEVTL-LE 131

Query: 245 LDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYS 304
           L E+  +  N+D L++ I  + +       +++ NP NP G ++  E +  I  +  + +
Sbjct: 132 LSEKDSFLPNLDTLKKAIKSNTK------LIIINNPNNPLGCVISDELLTSICELCKEKN 185

Query: 305 IVVIADEVYQ 314
           + +  DEVY+
Sbjct: 186 VYLHCDEVYR 195

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 64/143 (44%), Gaps = 9/143 (6%)

Query: 173 FRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYTAT 232
           +R   + Y +    +P  A+++ L  G+      +I   C   +  +L+  P Y +Y+  
Sbjct: 69  YRNKTSSYSNDPTVKPLRADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVC 128

Query: 233 ITLNNT--VALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPV 290
             +N+   V  P  + + S     +D    + I   +  +K   + V +PGNPTGA +  
Sbjct: 129 ANINDVEVVQCPLTVSDNS---FQMDTEAALTILKNDPLIK--LIFVTSPGNPTGAKIKT 183

Query: 291 ESMERIFVIAAKYSIVVIADEVY 313
             +E+I  +    + +V+ DE Y
Sbjct: 184 CLIEKI--LQNWENGLVVVDEAY 204

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 81/177 (45%), Gaps = 12/177 (6%)

Query: 147 VRRAKRMMRDLQTSIG-AYSHSQGVLGFRKTVAEYLSSRDGEPA-SAEDIFLTTGASNGA 204
           V   K+  +D+  S+   Y++++G +G   + A+ +  R   PA    ++ +  G+S+  
Sbjct: 76  VHMDKQEPKDMPLSMSLQYTNTEG-MGPLVSFAKKMIERINPPAYGGWNVCMANGSSDAM 134

Query: 205 SLMIELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYLD-----EESGWSLN--IDD 257
             + E+LC  ++S V++    +    + I L     +P  +      E+ G  ++   D 
Sbjct: 135 YKVFEVLCD-EDSTVMLEEFTFSPVISNIKLQGASVVPVKMQLSADPEQQGIDVDRLADL 193

Query: 258 LERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           L+   +   +   KP  L  +  G NPTG  L      RI+ IA K+  +++ D+ Y
Sbjct: 194 LDNWSVGPYKHLNKPKALYTVATGQNPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPY 250

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 70/152 (46%), Gaps = 16/152 (10%)

Query: 171 LGFRKTVAEY---LSSRDGEPA----SAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           L F+  +  Y    SS   +PA    +A+++ L  G+      +I   C   +  +L+  
Sbjct: 60  LEFKTAMTTYRNKTSSYSNDPAVKSLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLP 119

Query: 224 PQYPLYTATITLNN--TVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPG 281
           P Y +Y+    +N+   V  P  + + S + ++++     ++  +E       + V +PG
Sbjct: 120 PTYSMYSVCANINDIEVVQCPLVVSDNS-FQMDVE----AVLTILENDPLIKLVFVTSPG 174

Query: 282 NPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           NPTGA +    +E+  V+    + +V+ DE Y
Sbjct: 175 NPTGAKIKTSLIEQ--VLQNWQNGLVVVDEAY 204

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 112/264 (42%), Gaps = 33/264 (12%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           Y +S+G       + E+ S     P +  DI  TTG++      + + C   ++ VL+  
Sbjct: 104 YGNSRGQKELVSFLKEHTSIFHSIPYNDWDIITTTGSTQAWDASLRIFCNKGDT-VLLEE 162

Query: 224 PQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEK--GVK-PACLVVINP 280
             Y              +P  +D +    +  + LE ++    ++  G+  P  L  I  
Sbjct: 163 FTYSSSVEAADAQGLNCIPVPMDNQG---IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPT 219

Query: 281 G-NPTGAILPVESMERIFVIAAKYSIVVIADEVY------------------QENVFEGL 321
           G NPTG  L       I+ +A KY I+++ D+ Y                  Q+ V + L
Sbjct: 220 GQNPTGCTLSECRKPCIYRLAQKYDILIVEDDPYYFLQMGTYVSPDKRETDEQDIVTQEL 279

Query: 322 KFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVIL 381
           K  +  + ++SL R + +L  + ++V L S SK  +  C  R G+  +VG S  + +   
Sbjct: 280 K-QNHGEFVKSLSRSFLDLDRDGRVVRLDSMSKTFAPGC--RLGW--IVG-SKHLLDNYW 333

Query: 382 KMASIQLCSPVG-GQALVDLMLSR 404
            +  + + S  G  Q+++  +L+R
Sbjct: 334 NLHEVSIQSTCGFAQSILGGLLNR 357

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 90/228 (39%), Gaps = 45/228 (19%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           Y +S+G       + E++      P S  D+ +T G++      + L C   +S VL+  
Sbjct: 100 YGNSRGQRELVSFLKEHIVKFHQIPYSDWDVLITAGSTQAWDASLRLFCNPGDS-VLLES 158

Query: 224 PQYP----------LYTATITLNNTVALPYYLDEESGWSL-NIDDLE--RIIIESIEKGV 270
             Y           +Y   + ++    +P    E+  W L N DDL   R +        
Sbjct: 159 WTYSSSVEAAEAQGMYCVGVEIDGHGVVP----EKLEWLLQNWDDLHPGRSL-------- 206

Query: 271 KPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADEVY---------------Q 314
            P  L VI  G NP G  L  E    I+ I  KY +V+I D+ Y                
Sbjct: 207 -PKLLYVIPTGQNPMGVTLADERKPLIYNIIQKYDMVLIEDDPYYFLQMDPYKPKAERSA 265

Query: 315 ENVFEGLKFY--SMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGEC 360
            ++ E   ++    ++  +SL R + E     +++ L STSK ++  C
Sbjct: 266 SSLEESTNYWMDHHEEFAKSLTRSFLEWDVEGRVLRLESTSKTIAPGC 313

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 74/188 (39%), Gaps = 41/188 (21%)

Query: 163 AYSHSQGVLGFRKTVAEY-------LSSRDGEPASAEDIFLTTGASNGA-SLMIE--LLC 212
            Y   +G L  R+T+  +       LS  D   +  E + L +GAS G  S+++E  L  
Sbjct: 53  TYGSDEGALWVRETICHFNNDEAFRLSPGDRARSKPEHLNLNSGASYGVLSILLETTLAH 112

Query: 213 KGQESGVLIPIPQYPLYTATIT----LNNTVALPYYLDEESGWSLNID------------ 256
            G      +  P Y L           N T A+    DE     +++D            
Sbjct: 113 TGYTRQAFVITPTYFLINDCFIDAGFANKTTAI----DELGDGKVDLDSLEKKLEELEKQ 168

Query: 257 --------DLERII--IESIEKGVKPACLVVI-NPGNPTGAILPVESMERIFVIAAKYSI 305
                   DLE I    +S  K V    L  I    NP+G    +E+  R+  IA KY +
Sbjct: 169 HEGQDDSKDLELINNPWKSTHKKVYRYVLYCIPTFANPSGQTYTLETRRRLIEIARKYDM 228

Query: 306 VVIADEVY 313
           +++AD+VY
Sbjct: 229 LILADDVY 236

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 77/164 (46%), Gaps = 20/164 (12%)

Query: 256 DDLERIIIESIEKGVKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADEVYQ 314
           + LE+I+ E      +P  L  I  G NPTG  L  +  + I+ IA K+  ++I DE Y 
Sbjct: 190 EKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPYY 249

Query: 315 --------ENVFEGLKFYSMKK-----VLRSLQRRYKELFSNVQLVSLHSTSKGLSGECG 361
                   E+V +  +  +  K      L+SL R +  + +  +++ + S SK L+   G
Sbjct: 250 FLQMDPYVEDVGKREELRNKPKQTHDEFLKSLARTFLSVDTEGRVIRMDSFSKVLA--PG 307

Query: 362 QRGGYMELVGFSDDIREVILKMASIQLCSPVG-GQALVDLMLSR 404
            R G+  L G S  + +  +++  + + +P G  Q +V   L R
Sbjct: 308 TRLGW--LTG-SKALLQKYVELHEMTIQAPAGFTQVVVSSTLRR 348

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 67/151 (44%), Gaps = 15/151 (9%)

Query: 171 LGFRKTVAEY------LSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIP 224
           L F+  +A Y        + +  P ++E++ L  G+      +I   C   +  +L+  P
Sbjct: 62  LEFKTAMASYRNKTSTYKAENLTPLTSENLCLGVGSDESIDAIIRATCVPGKEKILVLPP 121

Query: 225 QYPLYTATITLNNT--VALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGN 282
            Y +Y+    +N+   V  P  L + + + ++ +     ++  ++       L + +PGN
Sbjct: 122 TYSMYSVCAEINDIEIVECPL-LYKNNSFQMDTES----VLTVLQNDPLIKLLFITSPGN 176

Query: 283 PTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           PTGA +  E +E   V+      +V+ DE Y
Sbjct: 177 PTGARIETERIET--VLQNWTDGLVVVDEAY 205

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 70/329 (21%), Positives = 126/329 (38%), Gaps = 61/329 (18%)

Query: 181 LSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYP-LYTATITLNNTV 239
           ++S  G   + +DI LT GA  GA+ +      G    V+   P Y  LY+        V
Sbjct: 68  IASLYGPDFTMDDILLTNGAI-GANFLAFYTLVGAGDHVICVEPTYSQLYSVPEMFGAEV 126

Query: 240 ALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVI 299
            L   L +E  +  N+  L+ +I  + +       +++ NP NP G+++  + +++I  +
Sbjct: 127 DL-LTLKKEDDFLPNLQTLKSMIKNNTK------LIIINNPNNPLGSVIKKDLLKQICKL 179

Query: 300 AAKYSIVVIADEVYQENVFEGL----------KFYSMKKVLRSLQRRYKELFSNVQLVSL 349
             +  I + +DEVY+  +F  L          + YS   V  S+ + Y    + ++L  L
Sbjct: 180 CEENDIYLHSDEVYRP-IFHSLEDEMVPPSACELYSKAIVSGSMSKAYS--VAGIRLGWL 236

Query: 350 HSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGD 409
            S  K    +   R  Y                M S+ +      Q ++D   +R     
Sbjct: 237 VSKDKQFLRDAASRRDY---------------NMISVSMIDDQIAQYVLD---NREYVIK 278

Query: 410 ESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAE 469
            +YE  L+    + + + E S   +E ++        KP  +     ++      +K A 
Sbjct: 279 RNYELCLNNFRLLNDFMDEHSDK-FEFYH--------KPTAATVCLAKVKGVNDTMKFA- 328

Query: 470 SLDMQPDEFYCTELLNSTGICTVPGSGFG 498
                      T L    G+  VPG  FG
Sbjct: 329 -----------TFLAEKYGVLAVPGEAFG 346

>KLLA0F13640g Chr6 complement(1264781..1266037) [1257 bp, 418 aa]
           {ON} similar to uniprot|Q01802 Saccharomyces cerevisiae
           YKL106W AAT1 Mitochondrial aspartate aminotransferase
           catalyzes the conversion of oxaloacetate to aspartate in
           aspartate and asparagine biosynthesis
          Length = 418

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 117/284 (41%), Gaps = 29/284 (10%)

Query: 162 GAYSHSQGVLGFRKTVAEYLSSRDGEPASAED--IFLTTGASNGA-SLMIELLCKGQESG 218
           G+  +   VL F      Y  S DG      +   F+ T +  GA ++  +LL       
Sbjct: 83  GSQDYQNNVLNFL-----YRESSDGSELLENNRITFVQTLSGTGALAVASKLLATFVSKT 137

Query: 219 VLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESI---EKGVKPACL 275
           V IP P +  ++     N    + YY   E G  L+ID   + + ES    +    P+ +
Sbjct: 138 VWIPNPSWANHSNVFQWNGFNQIKYYTYYEDG-KLSIDKWLKELKESCSSRDPDWPPSIV 196

Query: 276 VVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQR 335
           +     NPTG    +E  ++I  +     I  I D  YQ     G++  ++ +    L+ 
Sbjct: 197 LHACCHNPTGVDPTLEQWQQILPVIHDLGITPIIDMAYQ-----GMESGNLIQDAYLLRM 251

Query: 336 RYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELV------GFSDDIREVILKMASIQLC 389
             +  + N  L    S +K + G  G+R G + +V           I   + K+      
Sbjct: 252 CLEYEWPN-GLFVCQSFAKNM-GLYGERVGSLSVVVPPNPLDLKSTIDSQLKKIVRGIYS 309

Query: 390 SPVG-GQALVDLMLSRPKPGDESY--ERDLSER-SSIRNALQER 429
           SP G G  + +L+LS PK   + +   +++S+R  ++R  + ER
Sbjct: 310 SPPGYGSRVANLVLSNPKLKQQWFVDVKNMSDRLWNVRIQMHER 353

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 54/267 (20%), Positives = 116/267 (43%), Gaps = 43/267 (16%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAE------DIFLTTGASNGASLMIELLCKGQES 217
           Y+ ++G+      V +++S R   PA ++      D+ L+ G+++    + E +C   + 
Sbjct: 102 YAETKGLPPLLHFVKDFVS-RINRPAFSDETESNWDVILSGGSNDSMFKVFETIC---DE 157

Query: 218 GVLIPIPQYPLYTATITLNNT------VALPYYLDEESGWSLNIDDLERIIIESIEKG-- 269
              + I ++    A   +  T      + +    D ES   ++++ L +++ ++   G  
Sbjct: 158 STTVMIEEFTFTPAMSNVEATGAKVIPIKMNLTFDRESQ-GIDVEYLTQLL-DNWSTGPY 215

Query: 270 ---VKPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADEVYQ----------- 314
               KP  L  I  G NPTG  +P    E+I+ +A ++  +++ D+ Y            
Sbjct: 216 KDLNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPYGYLYFPSYNPQE 275

Query: 315 --ENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGF 372
             EN +      + + +   L + +  L ++ +++ L + SK  +   G R  ++    F
Sbjct: 276 PLENPYHSSDLTTERYLNDFLMKSFLTLDTDARVIRLETFSKIFA--PGLRLSFIVANKF 333

Query: 373 SDDIREVILKMASIQLCSPVG-GQALV 398
              + + IL +A I   +P G  QA+V
Sbjct: 334 ---LLQKILDLADITTRAPSGTSQAIV 357

>Skud_4.553 Chr4 (982230..985460) [3231 bp, 1076 aa] {ON} YDR291W
           (REAL)
          Length = 1076

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 79/181 (43%), Gaps = 34/181 (18%)

Query: 191 AEDIFLTTGASNGASLM-----IELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYYL 245
            E++ +TT  S+G SL+     ++LL K  ES  +   P     T  +  +   A    L
Sbjct: 304 GENVIITTSTSSGKSLIYQLVAVDLLLKDPESTFMYIFP-----TKALAQDQKRAFKVIL 358

Query: 246 DEESGWSLNIDDLERIIIESIEKGVKP---------ACLVVINPGNPTGAILPVESMERI 296
            +       I +L+  ++++ +   +P         A ++  NP     ++LP  +  R 
Sbjct: 359 SK-------IPELKHTVVDTYDGDTEPSERAYIRKNARIIFTNPDMIHTSVLPNHANWRH 411

Query: 297 FVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSN--VQLVSLHSTSK 354
           F+   K   +V+ DE++   +++GL    +  V+R L R     + N  +Q +S  +T K
Sbjct: 412 FLYHLK---LVVVDELH---IYKGLFGSHVALVMRRLLRLCHCFYENNKMQFISCSATLK 465

Query: 355 G 355
            
Sbjct: 466 S 466

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 11/149 (7%)

Query: 171 LGFRKTVAEYLSSRDG------EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIP 224
           L F++ +A Y ++          P + +++ L  G+      +I   C   +  +L   P
Sbjct: 60  LEFKRQMATYRNNSSSFKDLSLPPLTEDNLCLGVGSDESIDAVIRACCVPGKEKILTLPP 119

Query: 225 QYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPT 284
            Y +Y+    +N+   L   L  E   S   D  + I I S +  +K   + + +PGNPT
Sbjct: 120 TYSMYSVCANINDVEVLECPLIYEDN-SFQPDSQKVISILSSDPLIK--LVFLTSPGNPT 176

Query: 285 GAILPVESMERIFVIAAKYSIVVIADEVY 313
           GA   ++S   I ++ +     V+ DE Y
Sbjct: 177 GA--KIDSNIIIKILESWDGGFVVVDEAY 203

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 34.7 bits (78), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 73/183 (39%), Gaps = 33/183 (18%)

Query: 164 YSHSQGVLGFRKTVAEY-------LSSRDGEPASAEDIFLTTGASNGA-SLMIE--LLCK 213
           Y   +G L  R+ +  +        +  D   +  E + L++GAS G  S++++  L   
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGVLSILLQATLAHT 110

Query: 214 GQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVK-- 271
           G      I  P Y L           +    +DE+   S+++  LER + E  +K  +  
Sbjct: 111 GYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFTEEE 170

Query: 272 ----------PACLV-----------VINPGNPTGAILPVESMERIFVIAAKYSIVVIAD 310
                     PA  V           +    NPTG     E+  ++  IA KY +++IAD
Sbjct: 171 DQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIAD 230

Query: 311 EVY 313
           +VY
Sbjct: 231 DVY 233

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 282 NPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           NPTGAI    S  ++  +A KY I++I+D+VY
Sbjct: 198 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>TBLA0B09330 Chr2 (2216165..2217391) [1227 bp, 408 aa] {ON}
           Anc_2.420 YLR027C
          Length = 408

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 77/179 (43%), Gaps = 22/179 (12%)

Query: 242 PYYLDEESGWSLNIDDLERIIIESIEKG---VKPACLVVINPGNPTGAILPVESMERIFV 298
           PY+  +E   +L+ID   + I E+ +KG   V  AC       NPTG     E  E++  
Sbjct: 151 PYW--KEDTKTLDIDGWLKTI-EAAKKGSVFVLHAC-----AHNPTGMDPTPEEWEQVLD 202

Query: 299 IAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLHSTSKGLSG 358
             AKY  + + D  YQ     G     + +  ++++  + +L     ++   S SK L G
Sbjct: 203 AMAKYHHIALFDSAYQ-----GFASGDLDRDAKAIRLGHAKLSKQSPIIICQSFSKNL-G 256

Query: 359 ECGQRGGYMELVGFSDDIREVILKMASIQLCS-----PVGGQALVDLMLSRPKPGDESY 412
             G+R G + +V  +   +  I+   S    S     P  G  +   +LS+ +  D+ Y
Sbjct: 257 LYGERIGCLHIVNPTSASKANIISQLSTLTRSEYSNPPAYGADIASRILSQHELRDQWY 315

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 75/331 (22%), Positives = 133/331 (40%), Gaps = 60/331 (18%)

Query: 190 SAEDIFLTTGASNG--ASLMIELLCKGQESGVLIPIPQYPLYTATIT--------LNNTV 239
           + E+I +TTGA      SLM  L+  G E  V+ P     ++   I         L N  
Sbjct: 97  TNENILVTTGAIQALLESLM-ALIKPGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPN 155

Query: 240 ALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVI 299
                + E + W L+ + L     +      K   +++ NP NP G +   + +  +  +
Sbjct: 156 QGKKRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATL 209

Query: 300 AAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNV-QLVSLHSTSKGLSG 358
                  +IADEVY     E L+F         L R      SN+ + ++  + + G +G
Sbjct: 210 CVNNGAYIIADEVY-----EFLQF-----TPNPLSR-----ISNLSEAIAQKTITIGSAG 254

Query: 359 E----CGQRGGYMELVGFSDDIREVILKMASIQ----LCSPVGGQALVDLMLSRPKPGDE 410
           +     G R G+M     S + RE++ K+ ++      CSP   Q    L + R      
Sbjct: 255 KIFRVTGWRVGWM----ISKN-RELVEKVTAVHVRMGFCSPSISQVASGLGIQR------ 303

Query: 411 SYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYL---FPRLVLPQKAIKA 467
               +     S+ N    +   +++  + L GV   KPQG+ ++   F ++ +P+   + 
Sbjct: 304 --ALECGYFLSMPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIPED-YQF 359

Query: 468 AESLDMQPDEFYCTELLNST-GICTVPGSGF 497
            E L  +  +F+ +  L     I  +P S F
Sbjct: 360 PEYLKNRARDFFISYWLTQEFCILLLPCSEF 390

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 282 NPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           NPTGAI    S  ++  +A KY I++I+D+VY
Sbjct: 199 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 92/220 (41%), Gaps = 24/220 (10%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           Y  SQG       V E+         +  D+  T G ++     + + C     G  I  
Sbjct: 103 YGFSQGQPELMDFVREHTRRLHRMQYADWDVLATVGNTSAWESTLRVFCN---RGDTILA 159

Query: 224 PQYPLYTATITL--NNTVALPYYLDEESGWSLNIDDLERII--IESIEKGV-KPACLVVI 278
            +Y   ++ +        A P  LDE     +  + L  ++   E    GV +P  L  +
Sbjct: 160 EEYTFSSSLVAAEAQGVRAYPVPLDENG---MVPERLGELLDNWERWHDGVPRPKLLYTV 216

Query: 279 NPG-NPTGAILPVESMERIFVIAAKYSIVVIADEVY---QENVFEGLK-------FYSMK 327
             G NPTG  L  +  + ++ +A ++ ++++ DE Y   Q + +E          F S +
Sbjct: 217 PTGQNPTGTCLSNDRRQAVYRLAQQHDLLIVEDEPYYFLQLDPYEADAGRRAPRVFASHE 276

Query: 328 KVLRSLQRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYM 367
           + + SL R +  L ++ +++ L S SK L+   G R G++
Sbjct: 277 EFVGSLVRSFLSLDTDGRVLRLDSFSKVLA--PGTRLGWI 314

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
            NP+G    +E+  R+  IA KY ++VI+D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
            NP+G    +E+  R+  IA KY ++VI D+VY
Sbjct: 202 ANPSGNTYSLETRRRLIEIARKYDMLVITDDVY 234

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 66/155 (42%), Gaps = 11/155 (7%)

Query: 164 YSHSQGVLGFRKTVAEYLSSRDGEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223
           Y +S+G       + E+ S       +  D+  T G++      + L C   E+ VL+  
Sbjct: 99  YGNSRGQPELISFLKEHTSIFHNISINDWDLITTAGSTQAWDACLRLFCNRGET-VLMEE 157

Query: 224 PQYP--LYTATITLNNTVALPYYLDEESGWSLNIDDLERII--IESIEKGVKPACLVVI- 278
             Y   L  A     N VA+   +D++    + +D L  ++   +   +G  P  L  I 
Sbjct: 158 YTYSSSLEAAVAQGLNCVAMK--MDKDG---IKVDKLSEMLRDWDVAVQGPFPKLLYTIP 212

Query: 279 NPGNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           N  NPTG  L  E    +  +A++Y  ++I D+ Y
Sbjct: 213 NGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPY 247

>TPHA0E01420 Chr5 complement(287481..290837) [3357 bp, 1118 aa] {ON}
           Anc_5.301 YDR291W
          Length = 1118

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 32/185 (17%)

Query: 190 SAEDIFLTTGASNGASLM-----IELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYY 244
           + E++ +TT  S+G SL+     I+ L K   S  L   P     T  +  +   A    
Sbjct: 328 NGENVIITTSTSSGKSLIYQLSTIDFLLKKPNSTFLYIFP-----TKALAQDQKRAFENL 382

Query: 245 L---DEESGWSLNIDDLERIIIESIEKGVKP---------ACLVVINPGNPTGAILPVES 292
           L   +E S  S  I +L  III++ +              A ++  NP     +ILP   
Sbjct: 383 LTTINENSNNS--IPELRNIIIDTYDGDTDQQKRKFIRDNARIIFTNPDMIHTSILPNHP 440

Query: 293 MERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSN--VQLVSLH 350
             R F+    +   ++ DE++   +++ L    +  V+R LQR  +E + N  +Q +S  
Sbjct: 441 KWRPFLYNLTF---IVVDELH---IYKSLFGSHVVLVMRRLQRLCREYYENNFLQFISCS 494

Query: 351 STSKG 355
           +T K 
Sbjct: 495 ATLKN 499

>Ecym_3178 Chr3 (339229..342534) [3306 bp, 1101 aa] {ON} similar to
           Ashbya gossypii AAL080W
          Length = 1101

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 79/181 (43%), Gaps = 34/181 (18%)

Query: 190 SAEDIFLTTGASNGASLM-----IELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYY 244
           S E++ +TT  S+G SL+     +ELL K   S  +   P     T  +  +   +    
Sbjct: 314 SGENVIITTSTSSGKSLIYQLSAMELLSKDHNSTFMYIFP-----TKALAQDQKRSFQQL 368

Query: 245 LDEESGWSLNIDDLERIIIESIEKGV---------KPACLVVINPGNPTGAILPVESMER 295
           L +       I +L  +I+++ +            K A ++  NP     +ILP     R
Sbjct: 369 LAK-------IPELCNVIVDTYDGDTSQQDRSFIRKNARVIFTNPDIIHTSILPNHPNWR 421

Query: 296 IFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSN--VQLVSLHSTS 353
            F++  +   +V+ DE++   +++GL    +  V+R L R  K  + N  +Q +S  +T 
Sbjct: 422 HFLMHLR---LVVVDELH---IYKGLFGSHVSLVMRRLLRIVKGFYENAKLQFISCSATL 475

Query: 354 K 354
           K
Sbjct: 476 K 476

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 73/189 (38%), Gaps = 38/189 (20%)

Query: 163 AYSHSQGVLGFRKTVAEYLSSR-------DGEPASAEDIFLTTGASNGASLMIELLCKGQ 215
            Y  ++G L  R  + E+++ +       D   +  E + LT+GAS G  L I L     
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGV-LNILLQATLP 108

Query: 216 ESGV----LIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLER----------- 260
            +GV     I  P Y L                +DE+   S++++ LE            
Sbjct: 109 HTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDPN 168

Query: 261 ---------------IIIESIEKGVKPACLVVINPGNPTGAILPVESMERIFVIAAKYSI 305
                          I I  ++K  K    V+    NP+G    +E+  ++  +A KY +
Sbjct: 169 PVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDM 228

Query: 306 VVIADEVYQ 314
           ++I D+VY 
Sbjct: 229 LIITDDVYD 237

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 67/182 (36%), Gaps = 31/182 (17%)

Query: 163 AYSHSQGVLGFRKTVAEY-------LSSRDGEPASAEDIFLTTGASNGASLMIELLC--- 212
            Y  ++G    R T+ ++            G  ++ E + LT+GAS G  L I L C   
Sbjct: 52  TYGSNEGAHWVRSTICKFNNEEIFKFGENYGARSAPECLNLTSGASYGV-LNILLQCTLP 110

Query: 213 -KGQESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIE--SIEKG 269
                    I  P Y L                ++E    S++ D LE  + E  SI+  
Sbjct: 111 HNNYTRQAFIISPTYFLINDCFIDAGFHGKLTAINEMGTDSIDFDTLESNLAELDSIKAD 170

Query: 270 VKPACLV-----------------VINPGNPTGAILPVESMERIFVIAAKYSIVVIADEV 312
           V   C+                  V    NP+G    + +  R+  +A KY I++I D+V
Sbjct: 171 VGTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILIITDDV 230

Query: 313 YQ 314
           Y 
Sbjct: 231 YD 232

>SAKL0E08646g Chr5 (706740..708158) [1419 bp, 472 aa] {ON} similar
           to uniprot|P41814 Saccharomyces cerevisiae YNL062C GCD10
           Subunit of tRNA (1-methyladenosine) methyltransferase
           with Gcd14p required for the modification of the adenine
           at position 58 in tRNAs especially tRNAi-Met first
           identified as a negative regulator of GCN4 expression
          Length = 472

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 66/143 (46%), Gaps = 18/143 (12%)

Query: 277 VINPGNPTGAILPVESMERIFVIAAKYSIV---VIADEVYQENVFEGLKFYSMKKVLRSL 333
           +IN GN    +    SME I ++  K +I    +IA  +     F     YS +K L+  
Sbjct: 118 LINVGNKIQKL----SMEEIELLK-KQTISGEEIIAKMIESHGSFHKKTIYSQEKYLKRK 172

Query: 334 QRRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQ-----L 388
           ++++ + F+ V+ +S    S GL      +G  + ++  S +   +IL +A+I+     L
Sbjct: 173 KQKFAKFFT-VEYLS----STGLLNYLIDKGDTLRVMDMSQETLGMILNLANIRSSGTYL 227

Query: 389 CSPVGGQALVDLMLSRPKPGDES 411
           C    G  +V  ML R   GD +
Sbjct: 228 CVDETGGLMVYAMLERMFGGDNN 250

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
            NP+G    +E+  R+  IA KY +++I D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVY 227

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 23/34 (67%)

Query: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVYQ 314
            NP+G    +E+ +++  +A KY +++IAD+VY 
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVYD 238

>KAFR0E01420 Chr5 complement(284395..287583) [3189 bp, 1062 aa] {ON}
           Anc_5.301 YDR291W
          Length = 1062

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 77/173 (44%), Gaps = 36/173 (20%)

Query: 190 SAEDIFLTTGASNGASLM-----IELLCKGQESGVLIPIPQYPL-------YTATITLNN 237
           + E++ +TT  S+G SL+     I++L K  ES  +   P   L       + A I+   
Sbjct: 306 NGENVIITTSTSSGKSLIYQLSAIDILLKDPESTFMYIFPTKALAQDQKRAFEAIIS--- 362

Query: 238 TVALPYYLDEESGWSLNID----DLERIIIESIEKGVKPACLVVINPGNPTGAILPVESM 293
              +P   D      L +D    D E    +SI K  +   ++  NP     +ILP    
Sbjct: 363 --KIPQLRD------LRVDTYDGDTEPSQRQSIRKNAR---VIFTNPDMIHVSILPNHVN 411

Query: 294 ERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQL 346
              F+   K   +V+ DE++   +++GL   ++  V+R L R  KE ++N +L
Sbjct: 412 WTHFLYNLK---IVVVDELH---IYKGLFGSNVALVMRRLLRVCKEYYANNEL 458

>AAL080W Chr1 (204017..207199) [3183 bp, 1060 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR291W
          Length = 1060

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 72/171 (42%), Gaps = 32/171 (18%)

Query: 190 SAEDIFLTTGASNGASLM-----IELLCKGQESGVLIPIPQYPLYTATITLNNTVALPYY 244
           +  ++ +TT  S+G SL+     I+ L K ++S  +   P     T  +  +   A    
Sbjct: 284 AGNNVIITTSTSSGKSLIYQLCAIDALLKDRDSTFMYIFP-----TKALAQDQKRAFQQL 338

Query: 245 LDEESGWSLNIDDLERIIIESIEKGV---------KPACLVVINPGNPTGAILPVESMER 295
           L         I  L  +++ + +            K A ++  NP     +ILP     R
Sbjct: 339 LSR-------IPSLATVVVATYDGDTEQQNRAAIRKHARVIFTNPDMIHSSILPNHPGWR 391

Query: 296 IFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQL 346
            F++  K   +V+ DE++   V++GL    +  V+R L R  ++ + N QL
Sbjct: 392 HFLMHLK---LVVVDELH---VYKGLFGSHVALVMRRLLRLVRDFYLNAQL 436

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
            NP+G    +E+  R+  IA +Y ++VI D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARQYDMLVITDDVY 227

>TPHA0G03160 Chr7 (672920..674251) [1332 bp, 443 aa] {ON} Anc_2.475
           YKL106W
          Length = 443

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 126/322 (39%), Gaps = 44/322 (13%)

Query: 169 GVLGFRKTVAEYLSSR---DGEPASAEDIFLTTGASNGASLMI--ELLCKGQESGVLIPI 223
           G  G+RK V  +L       GE    E I L    S   +L I    L       V I  
Sbjct: 104 GHEGYRKAVKRFLFDECVSKGEIIEQERISLIQTLSGTGALAITSRFLSTFVSDTVWISD 163

Query: 224 PQYPLYTATITLNNTVALPYYLDEESG------WSLNIDDLERIIIESIEKGVKPACLVV 277
           P +  +      N    + +Y   ++G      W   +DDL+R      +K  KP  +V+
Sbjct: 164 PSWVNHDNIFEKNGFKNINHYSYVKNGILTVDEW---LDDLKRD--PGKDKSTKPQAVVL 218

Query: 278 -INPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLK--FYSMKKVLRSLQ 334
                NPTG     E  ERI       +++ I D  YQ      LK   Y +K +L   +
Sbjct: 219 HACCHNPTGIDPTKEEWERILDEIYNLNMIPIVDMAYQGLDTGNLKNDAYLLKMILN--E 276

Query: 335 RRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELV------GFSDDIREVILKMA-SIQ 387
           ++YK   + + +    + + GL  E   R G + +V      G   +I   + K+  SI 
Sbjct: 277 KKYKSWSNGIFVCQSFAKNMGLYSE---RVGSLSIVVPPNSEGLKKNIDSQLQKIVRSIY 333

Query: 388 LCSPVGGQALVDLMLSRPKPGDESY---ERDLSERSSIRNALQERSKSLWETFNNLEGVE 444
              P  G  +   +LS P   ++ +   E+ ++  + +R  + +R +  W    N     
Sbjct: 334 SSPPSYGSKIAYSVLSDPILKEKWFQDVEKMVNRLTHVRMEMHKRLE--WPDLIN----- 386

Query: 445 CRKPQGSMYLFPRLVLPQKAIK 466
            +  Q  M+ F  + L +K IK
Sbjct: 387 -KNQQHGMFYF--INLNEKQIK 405

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 282 NPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEG 320
           NP+GA    E   ++  +A +Y I++I+D+VY    F G
Sbjct: 200 NPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHG 238

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 271 KPACLVVINPG-NPTGAILPVESMERIFVIAAKYSIVVIADEVY 313
           KP  +  +  G NPTG  L  E   +I+ +A +++ +++ D+ Y
Sbjct: 241 KPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPY 284

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 80  AMELERQLSRDPDSLPFKKIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVLN 139
           A +L++QL  +   LP  K  Y++ G  + L Q  +S   E+L  L+SP   ++P++++N
Sbjct: 296 ANQLKKQLFVESLLLPLWKRSYSDHGEVE-LHQPIMSSLEEMLYFLQSPTPTRLPLQLIN 354

Query: 140 LIY 142
           + Y
Sbjct: 355 VTY 357

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,597,906
Number of extensions: 2323694
Number of successful extensions: 6101
Number of sequences better than 10.0: 140
Number of HSP's gapped: 6150
Number of HSP's successfully gapped: 140
Length of query: 534
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 420
Effective length of database: 40,409,475
Effective search space: 16971979500
Effective search space used: 16971979500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)