Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43068.264ON43443423360.0
AGR084C8.264ON42743514370.0
KLLA0F19184g8.264ON51245110771e-143
SAKL0H16984g8.264ON43543010601e-141
KLTH0G13640g8.264ON4144169931e-131
Kwal_56.237828.264ON4144219621e-127
NCAS0B050308.264ON4334419321e-122
NDAI0B020008.264ON4334389271e-121
ZYRO0C01606g8.264ON4324329211e-120
TDEL0F039108.264ON4294139071e-118
Kpol_543.408.264ON4144387783e-99
YLR090W (XDJ1)8.264ON4594697814e-99
TPHA0A017908.264ON4394297743e-98
Smik_12.1498.264ON4604647632e-96
Suva_10.1748.264ON4564497493e-94
Skud_12.1588.264ON4554547466e-94
KNAG0G020508.264ON4324496933e-86
CAGL0L12276g8.264ON4524306082e-73
KLLA0F03333g2.243ON4093684851e-55
KAFR0J009402.243ON4113714789e-55
KNAG0I019002.243ON4093684781e-54
Kpol_1003.122.243ON4083684753e-54
CAGL0J09966g2.243ON4073694744e-54
TBLA0E038102.243ON4103734728e-54
YNL064C (YDJ1)2.243ON4093704683e-53
Smik_14.2632.243ON4093704665e-53
ZYRO0A01496g2.243ON4123954666e-53
Suva_14.2772.243ON4093704631e-52
KLTH0G09394g2.243ON4113714632e-52
TPHA0C031102.243ON4073714632e-52
Ecym_32812.243ON4093704613e-52
ADL257C2.243ON4103714604e-52
Skud_14.2682.243ON4103704605e-52
NDAI0D010302.243ON4113704552e-51
Kwal_23.48302.243ON4113714527e-51
SAKL0E08734g2.243ON4113704458e-50
NCAS0G030002.243ON4103914352e-48
TDEL0C046002.243ON4113694273e-47
Kwal_23.30612.218ON4584114067e-44
KLTH0G08756g2.218ON4624133998e-43
Kpol_1002.1222.218ON5034153948e-42
TDEL0C043502.218ON4624113725e-39
SAKL0E09306g2.218ON4613903621e-37
Ecym_62368.730ON3743643543e-37
KLLA0E07899g2.218ON4954293587e-37
TBLA0E036602.218ON4484313541e-36
TDEL0B037908.730ON3733603449e-36
Skud_14.2532.218ON5324243501e-35
KNAG0M020202.218ON4603643462e-35
CAGL0F03729g8.730ON3613633377e-35
YMR214W (SCJ1)8.730ON3773693333e-34
AER427W2.218ON4703813375e-34
KAFR0A041608.730ON3783663325e-34
KLLA0C07260g8.730ON3683553281e-33
TPHA0G006308.730ON3933673264e-33
Suva_13.3978.730ON3753573255e-33
Smik_13.4228.730ON3783643246e-33
CAGL0J10296g2.218ON4794373271e-32
NDAI0E008708.730ON3763623184e-32
Skud_13.3838.730ON3753563175e-32
NCAS0B005308.730ON3753633106e-31
ZYRO0A06226g8.730ON3773663081e-30
KLTH0D12496g8.730ON3753603062e-30
Kwal_26.90248.730ON3753583035e-30
SAKL0H05258g8.730ON3683652991e-29
Ecym_53842.218ON5034573033e-29
KNAG0G028808.730ON3783612949e-29
Smik_14.2492.218ON5334442972e-28
NDAI0F024502.218ON5305122921e-27
KNAG0G011308.61ON5004342803e-26
TBLA0B034908.730ON3843712755e-26
NCAS0G028502.218ON4944722761e-25
Kpol_1064.408.730ON3873622702e-25
ZYRO0C15048g2.218ON4914072546e-23
TPHA0D005508.61ON4863932539e-23
Suva_14.2622.218ON5362882485e-22
YNL077W (APJ1)2.218ON5282612477e-22
AER346W8.730ON3673532428e-22
YFL016C (MDJ1)8.61ON5114072362e-20
KAFR0C031608.61ON4984222316e-20
Smik_6.638.61ON5104062291e-19
NDAI0G032808.61ON5524212282e-19
CAGL0J04224g8.61ON5224782246e-19
Kpol_1011.98.61ON4954052174e-18
Suva_6.448.61ON5074112077e-17
NCAS0C039508.61ON5194262061e-16
TPHA0C029802.218ON5542302024e-16
CAGL0H03707g1.398ON349681843e-14
ZYRO0F03652g8.61ON4624111828e-14
NDAI0G042501.398ON363681782e-13
TBLA0C014801.398ON353681772e-13
YNL007C (SIS1)1.398ON352681763e-13
TDEL0B059601.398ON369681763e-13
KNAG0H016801.398ON363681763e-13
Smik_14.3211.398ON366681764e-13
KLLA0D04818g1.398ON354741754e-13
Suva_14.3411.398ON359681754e-13
Skud_14.3201.398ON368681754e-13
ZYRO0E04598g1.398ON357681755e-13
NDAI0C026101.398ON340681745e-13
KAFR0H031501.398ON359681745e-13
Kpol_457.151.398ON357681729e-13
NCAS0C048901.398ON367681729e-13
TPHA0B037601.398ON355681711e-12
Kwal_0.2071.398ON353741711e-12
KLTH0H12100g1.398ON350741702e-12
SAKL0D08778g1.398ON348681665e-12
TPHA0L007907.157ON446811676e-12
TBLA0D026008.61ON5104481661e-11
KLTH0A03740g7.217ON395941651e-11
NCAS0E029307.217ON387941641e-11
AAL008W1.398ON349681631e-11
Kwal_14.24521.297ON607921651e-11
Ecym_43727.217ON579711652e-11
TBLA0D042407.217ON389881632e-11
CAGL0J02750g7.217ON382831613e-11
TDEL0H022907.217ON387811613e-11
TBLA0A011007.157ON434991605e-11
Ecym_12921.398ON347681595e-11
ZYRO0G21230g1.297ON584701605e-11
Suva_5.1507.217ON391811596e-11
Skud_5.1587.217ON391811579e-11
ZYRO0D16390g7.217ON398941561e-10
Smik_5.1737.217ON391811561e-10
KNAG0F008602.15ON626831571e-10
YER048C (CAJ1)7.217ON391811551e-10
Kwal_47.181337.217ON393941551e-10
KNAG0I007407.157ON425811562e-10
KLTH0F09944g2.350ON233751512e-10
Smik_9.2037.157ON432811542e-10
Smik_14.1062.15ON593661552e-10
TBLA0J018707.157ON470811542e-10
Kpol_1070.227.217ON380811532e-10
KAFR0H023108.698ON655751553e-10
KLLA0D06402g1.297ON631711543e-10
TPHA0I011101.297ON666711543e-10
Skud_13.3232.350ON224701483e-10
NDAI0A028207.157ON4821201533e-10
TPHA0G014808.698ON660751543e-10
ADR124C1.297ON611701543e-10
Suva_14.1162.15ON600661544e-10
Skud_14.1102.15ON596661544e-10
KLLA0D19602g2.15ON620661534e-10
KNAG0B052401.297ON668811535e-10
TBLA0E024907.217ON366751515e-10
TPHA0C012607.217ON380831515e-10
Suva_12.1851.113ON168641445e-10
YMR161W (HLJ1)2.350ON224701475e-10
NDAI0E045607.217ON394811515e-10
KAFR0A016201.297ON665711526e-10
YNL227C (JJJ1)2.15ON590661518e-10
TDEL0A064308.698ON666751519e-10
KLTH0H10032g1.297ON607851509e-10
Smik_10.3851.113ON172641429e-10
Smik_10.1681.297ON649691501e-09
NCAS0A132107.157ON4141041491e-09
TBLA0B037308.698ON693751501e-09
TDEL0H032107.157ON411811481e-09
CAGL0J07370g2.15ON623851491e-09
KNAG0J018408.698ON650751491e-09
SAKL0F08052g7.217ON393811471e-09
KLLA0E04423g7.217ON428781472e-09
ZYRO0G03850g7.157ON418811472e-09
CAGL0J01936g7.157ON425991472e-09
Smik_13.3612.350ON224701432e-09
AFR507W8.61ON474691472e-09
SAKL0H05984g8.698ON658751482e-09
TDEL0G028002.350ON225691422e-09
KAFR0L007407.217ON364811462e-09
YIR004W (DJP1)7.157ON432811462e-09
CAGL0L00957g7.217ON373831452e-09
KAFR0A079502.15ON551821463e-09
Suva_13.3402.350ON225701413e-09
Suva_9.2137.157ON431811453e-09
Skud_9.1817.157ON421811453e-09
Kwal_23.44202.15ON592661463e-09
TDEL0D016401.297ON6041081463e-09
NCAS0A093201.297ON6351201463e-09
KNAG0L013307.217ON396831444e-09
KAFR0B047807.157ON4231041444e-09
TBLA0C027201.297ON715711454e-09
KLLA0C09823g8.698ON669751454e-09
SAKL0F04444g7.157ON4291041445e-09
Kpol_1027.131.297ON641711445e-09
YJR097W (JJJ3)1.113ON172641366e-09
Skud_10.1691.297ON644831446e-09
SAKL0D06226g1.297ON615691446e-09
NDAI0H031802.350ON229691386e-09
NDAI0F038002.15ON638831446e-09
Suva_6.1481.297ON642691437e-09
Ecym_23748.698ON661751438e-09
YJL073W (JEM1)1.297ON645691438e-09
ZYRO0F15972g1.113ON162931348e-09
Kwal_23.3578singletonOFF85611289e-09
KNAG0I008602.350ON219701361e-08
Kpol_1072.48.698ON661751411e-08
NDAI0C002001.92ON276771381e-08
Kpol_526.62.350ON228701361e-08
NCAS0C012208.698ON669751411e-08
ADR015W7.157ON4361211401e-08
TBLA0G001702.15ON659781402e-08
TPHA0C045902.350ON233691352e-08
NCAS0G013602.15ON616911392e-08
NCAS0D009602.350ON224691342e-08
ZYRO0F15400g2.15ON525661392e-08
Kpol_499.307.157ON408811382e-08
KLLA0D13464g7.157ON433941382e-08
Kwal_47.179578.61ON4782251382e-08
KLTH0B08338g2.15ON590661392e-08
Smik_15.4378.698ON663751393e-08
CAGL0G07469g8.698ON668751383e-08
TBLA0A055601.92ON312711363e-08
SAKL0E06050g2.350ON232701333e-08
Ecym_56262.350ON243681343e-08
ABL194C2.15ON552901373e-08
YOR254C (SEC63)8.698ON663751374e-08
CAGL0H02827g1.297ON656711374e-08
ZYRO0A07502g2.350ON238691324e-08
ZYRO0D10934g8.698ON663751374e-08
Suva_8.3038.698ON664751374e-08
Ecym_63181.297ON6241101365e-08
SAKL0E14234g2.15ON678661365e-08
Kpol_529.212.15ON622661356e-08
KNAG0B018901.92ON370771347e-08
CAGL0H04499g2.350ON232691308e-08
SAKL0C03476g1.113ON165711278e-08
Skud_10.3191.113ON168641278e-08
KLLA0E01629g2.350ON231691308e-08
TBLA0B093802.350ON227691299e-08
Kwal_26.88798.698ON656751349e-08
KLTH0D11770g8.698ON652751341e-07
TDEL0C036801.185ON556641331e-07
KLTH0F04906g1.185ON590641321e-07
Skud_15.4208.698ON665751322e-07
Kwal_55.209657.157ON4211041312e-07
Ecym_44697.157ON4331211302e-07
YJL162C (JJJ2)1.185ON583641312e-07
AFL190C2.350ON235681262e-07
KAFR0I026805.4ON433691284e-07
AFR659W1.92ON273771264e-07
SAKL0B01276gna 1ON292871264e-07
AAL103W8.698ON669751285e-07
KLLA0D07656g8.61ON471701267e-07
TDEL0C008708.61ON470701267e-07
KLLA0F03124g5.4ON433691267e-07
NDAI0D005001.113ON190701218e-07
TDEL0E005002.15ON581661268e-07
Kwal_33.138601.185ON578641268e-07
TDEL0C061001.92ON285731239e-07
Smik_10.681.185ON560641251e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4306
         (434 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   904   0.0  
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   558   0.0  
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   419   e-143
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   412   e-141
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   387   e-131
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   375   e-127
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    363   e-122
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    361   e-121
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   359   e-120
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   353   e-118
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   304   3e-99
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   305   4e-99
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   302   3e-98
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   298   2e-96
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   293   3e-94
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   291   6e-94
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   271   3e-86
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   238   2e-73
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   191   1e-55
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   188   9e-55
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   188   1e-54
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   187   3e-54
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   187   4e-54
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   186   8e-54
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   184   3e-53
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   184   5e-53
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   184   6e-53
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   182   1e-52
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   182   2e-52
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   182   2e-52
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   182   3e-52
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   181   4e-52
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   181   5e-52
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   179   2e-51
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   178   7e-51
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   176   8e-50
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   172   2e-48
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   169   3e-47
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   160   7e-44
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   158   8e-43
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...   156   8e-42
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   147   5e-39
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   144   1e-37
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   140   3e-37
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...   142   7e-37
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...   140   1e-36
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   137   9e-36
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...   139   1e-35
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   137   2e-35
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   134   7e-35
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...   132   3e-34
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   134   5e-34
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   132   5e-34
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   130   1e-33
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   130   4e-33
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   129   5e-33
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...   129   6e-33
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...   130   1e-32
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...   127   4e-32
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...   126   5e-32
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      124   6e-31
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   123   1e-30
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   122   2e-30
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...   121   5e-30
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   119   1e-29
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...   121   3e-29
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   117   9e-29
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...   119   2e-28
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...   117   1e-27
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...   112   3e-26
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...   110   5e-26
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218    110   1e-25
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....   108   2e-25
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...   102   6e-23
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...   102   9e-23
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...   100   5e-22
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...   100   7e-22
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    98   8e-22
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    96   2e-20
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    94   6e-20
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    93   1e-19
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    92   2e-19
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    91   6e-19
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    88   4e-18
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    84   7e-17
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    84   1e-16
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    82   4e-16
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    75   3e-14
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    75   8e-14
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    73   2e-13
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    73   2e-13
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    72   3e-13
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    72   3e-13
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    72   3e-13
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    72   4e-13
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    72   4e-13
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    72   4e-13
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    72   4e-13
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    72   5e-13
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               72   5e-13
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    72   5e-13
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    71   9e-13
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     71   9e-13
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    70   1e-12
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    70   1e-12
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    70   2e-12
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    69   5e-12
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    69   6e-12
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    69   1e-11
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    68   1e-11
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     68   1e-11
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    67   1e-11
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    68   1e-11
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    68   2e-11
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    67   2e-11
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    67   3e-11
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    67   3e-11
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    66   5e-11
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    66   5e-11
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    66   5e-11
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    66   6e-11
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    65   9e-11
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    65   1e-10
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    65   1e-10
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    65   1e-10
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    64   1e-10
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    64   1e-10
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    65   2e-10
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    63   2e-10
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    64   2e-10
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    64   2e-10
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    64   2e-10
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    64   2e-10
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    64   3e-10
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    64   3e-10
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    64   3e-10
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    62   3e-10
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    64   3e-10
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    64   3e-10
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    64   3e-10
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    64   4e-10
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    64   4e-10
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    64   4e-10
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    64   5e-10
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    63   5e-10
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    63   5e-10
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    60   5e-10
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    61   5e-10
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             63   5e-10
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    63   6e-10
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    63   8e-10
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    63   9e-10
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    62   9e-10
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    59   9e-10
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    62   1e-09
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    62   1e-09
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    62   1e-09
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    62   1e-09
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    62   1e-09
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    62   1e-09
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    61   1e-09
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    61   2e-09
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    61   2e-09
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    61   2e-09
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    60   2e-09
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    61   2e-09
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    62   2e-09
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    59   2e-09
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    61   2e-09
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    61   2e-09
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    60   2e-09
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    61   3e-09
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    59   3e-09
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    60   3e-09
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    60   3e-09
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    61   3e-09
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    61   3e-09
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    61   3e-09
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    60   4e-09
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               60   4e-09
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    60   4e-09
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    60   4e-09
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    60   5e-09
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    60   5e-09
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    57   6e-09
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    60   6e-09
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    60   6e-09
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      58   6e-09
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      60   6e-09
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    60   7e-09
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    60   8e-09
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    60   8e-09
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    56   8e-09
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    54   9e-09
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    57   1e-08
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    59   1e-08
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         58   1e-08
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    57   1e-08
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     59   1e-08
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    59   1e-08
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    59   2e-08
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    57   2e-08
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    58   2e-08
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    56   2e-08
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    58   2e-08
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    58   2e-08
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    58   2e-08
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    58   2e-08
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    58   2e-08
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    58   3e-08
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    58   3e-08
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    57   3e-08
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    56   3e-08
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    56   3e-08
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    57   3e-08
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    57   4e-08
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    57   4e-08
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    55   4e-08
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    57   4e-08
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    57   4e-08
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    57   5e-08
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    57   5e-08
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    57   6e-08
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    56   7e-08
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    55   8e-08
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    54   8e-08
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    54   8e-08
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    55   8e-08
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    54   9e-08
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    56   9e-08
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    56   1e-07
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    56   1e-07
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    55   1e-07
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    55   2e-07
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    55   2e-07
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    55   2e-07
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    55   2e-07
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    53   2e-07
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    54   4e-07
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    53   4e-07
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    53   4e-07
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    54   5e-07
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    53   7e-07
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    53   7e-07
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    53   7e-07
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    51   8e-07
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    53   8e-07
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    53   8e-07
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    52   9e-07
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    53   1e-06
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    52   1e-06
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    52   2e-06
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    52   2e-06
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    49   2e-06
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    52   2e-06
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    50   2e-06
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    52   2e-06
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    52   2e-06
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    52   2e-06
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    52   2e-06
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    51   3e-06
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    51   3e-06
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    49   3e-06
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    51   4e-06
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    50   4e-06
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    51   4e-06
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    51   4e-06
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    49   4e-06
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    50   5e-06
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    49   6e-06
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    50   7e-06
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    50   7e-06
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    50   7e-06
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    50   8e-06
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    50   9e-06
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    50   9e-06
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    47   1e-05
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    49   1e-05
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    49   1e-05
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    49   1e-05
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    49   1e-05
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    49   1e-05
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    49   2e-05
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    49   2e-05
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    49   2e-05
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    48   3e-05
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    46   3e-05
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    48   3e-05
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    48   3e-05
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    46   3e-05
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    46   3e-05
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    47   3e-05
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    47   4e-05
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    47   4e-05
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    47   4e-05
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    45   5e-05
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    47   5e-05
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    47   5e-05
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    47   6e-05
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    47   6e-05
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    47   8e-05
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    47   1e-04
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    46   1e-04
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    46   1e-04
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    45   2e-04
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    45   2e-04
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    45   2e-04
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    45   2e-04
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    44   3e-04
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    42   4e-04
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    44   5e-04
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    42   6e-04
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    43   8e-04
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       44   8e-04
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      43   8e-04
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    42   0.001
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    41   0.002
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    42   0.002
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    42   0.002
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    41   0.003
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    41   0.003
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    40   0.004
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    41   0.005
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    40   0.005
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    40   0.006
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    40   0.007
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    40   0.008
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    40   0.009
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    40   0.011
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    38   0.016
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    38   0.029
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    38   0.038
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    37   0.060
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    37   0.074
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    37   0.077
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    37   0.085
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    37   0.090
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    37   0.100
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    37   0.11 
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    36   0.15 
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    36   0.16 
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    36   0.18 
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    35   0.23 
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    35   0.25 
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    35   0.26 
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    35   0.27 
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    35   0.35 
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    34   0.49 
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    33   0.79 
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    33   0.84 
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    33   0.85 
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    33   1.1  
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    33   1.2  
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    33   1.3  
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    33   1.6  
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    32   2.9  
KAFR0F03210 Chr6 complement(634603..635160) [558 bp, 185 aa] {ON...    31   3.4  
Suva_4.89 Chr4 (162699..164267) [1569 bp, 522 aa] {ON} YDL156W (...    32   3.9  
YPR061C Chr16 complement(675977..676882) [906 bp, 301 aa] {ON}  ...    32   4.1  
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    31   5.7  
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    30   7.7  
NCAS0A11080 Chr1 complement(2203317..2204174) [858 bp, 285 aa] {...    30   7.9  
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    30   8.5  

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/434 (100%), Positives = 434/434 (100%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS
Sbjct: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60

Query: 61  DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKT 120
           DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKT
Sbjct: 61  DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKT 120

Query: 121 KDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKE 180
           KDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKE
Sbjct: 121 KDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKE 180

Query: 181 RVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRH 240
           RVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRH
Sbjct: 181 RVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRH 240

Query: 241 ADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRL 300
           ADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRL
Sbjct: 241 ADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRL 300

Query: 301 VARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNE 360
           VARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNE
Sbjct: 301 VARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNE 360

Query: 361 KSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQEGQQRSNQ 420
           KSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQEGQQRSNQ
Sbjct: 361 KSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQEGQQRSNQ 420

Query: 421 QYGERNTASECPVQ 434
           QYGERNTASECPVQ
Sbjct: 421 QYGERNTASECPVQ 434

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/435 (62%), Positives = 339/435 (77%), Gaps = 9/435 (2%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           M +DLY VLGI S+A+EQEVKRAYR LAL YHPDKISDES+R  SEAKFKEISAAY +LS
Sbjct: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60

Query: 61  DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYG-QYEDAEQKTSQK 119
           DEQKR+EYD +G  D G   +G   D++  G++DFMNFFRYGAGR+G Q+E+ + +   +
Sbjct: 61  DEQKRAEYDQFGTVDGG---YGH--DEFGHGDDDFMNFFRYGAGRHGYQHEEDDFEEVGR 115

Query: 120 TKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFK 179
           T D  VPLKL+TKQLYLGKTFQFK +R VLC +C G GLRKRAA    ++C  C+G+G+K
Sbjct: 116 TADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEGQGYK 175

Query: 180 ERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHR 239
           ER+SRI PG ISRERV C +C GKG  +    +DNCKKC GKCV+ E SI+++YVPRG +
Sbjct: 176 ERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVPRGSQ 235

Query: 240 HADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTR 299
           H D +R  GQ+DME GKETGDLVF IDE TD  + LERKGTDL+C++ ISLAEALTGFTR
Sbjct: 236 HGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALTGFTR 295

Query: 300 LVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLN 359
           +V RTFD+R+LRI IP GKVLRPGNYLKFTNEGWPI +G+RFGD+YV+V IEFPKDNW N
Sbjct: 296 IVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKDNWFN 355

Query: 360 EKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQEGQQRSN 419
           EK+EL+AI++ILPGL ++ ++     +DP+NTE++ +Y +I + + LPDYL +E Q  S 
Sbjct: 356 EKAELDAIRNILPGLADAPSTKT---EDPSNTEEVRAYSIIANHTGLPDYLDRENQGYSR 412

Query: 420 QQYGERNTASECPVQ 434
           QQ+       ECP+Q
Sbjct: 413 QQHESTAGTPECPMQ 427

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  419 bits (1077), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 214/451 (47%), Positives = 292/451 (64%), Gaps = 24/451 (5%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           M +  Y VLG++ +ATE E+++AYR LAL YHPDKI DE++R  SEA FKE++AAY+ILS
Sbjct: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128

Query: 61  DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF----RYGAGRYGQYEDAEQ-- 114
           D + +S YD YG    GS   G  +DD++   +DFMNFF    R   G +  Y +  Q  
Sbjct: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEF--DDFMNFFQQYQRQQHGPHASYSNRHQYG 186

Query: 115 -KTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGIC 173
              S++T D  +  K++T+QLY+GKT  F+LKR  LC  C G GLRK+      + C  C
Sbjct: 187 EPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSC 246

Query: 174 DGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLY 233
           +G+GFKER++R++ G++ ++   CD C GKG    +  SD CK C GK +I E    T+Y
Sbjct: 247 NGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVY 306

Query: 234 VPRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEA 293
           +PRG RH D  R+   ADME GKETGD++  IDE +   + LERK  DLH ++ ISL +A
Sbjct: 307 IPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSS-KSHLERKSNDLHTTLNISLVDA 365

Query: 294 LTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFP 353
           LTGF+ +V  T+D+R LR+ +P+GKV+RPGNY KF  EGWP++NG  FGD+YV++NIEFP
Sbjct: 366 LTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFP 425

Query: 354 KDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQE 413
           KDNW NEKSE+ A+++ILPGLK    S      DP NTED+ SY V+     LPDYLA+E
Sbjct: 426 KDNWFNEKSEITALRNILPGLK----SKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEE 481

Query: 414 GQQRSNQQYGERNTA----------SECPVQ 434
            ++ + +Q  E + +          SEC  Q
Sbjct: 482 KEKYNRKQQEEPHASAFDNDYTQMPSECATQ 512

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  412 bits (1060), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 210/430 (48%), Positives = 291/430 (67%), Gaps = 19/430 (4%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY VLG+  +A++ E+K+AYR LAL +HPDK++DE  R ESE KFKEI+AAY+ILSDE  
Sbjct: 4   LYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDS 63

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDA------EQKTSQ 118
           R +YD YG       P          G++DFMNFFR  AG  G Y++       E+  S 
Sbjct: 64  RKKYDVYG----DDAPGASGGGGDPFGDDDFMNFFRTYAGG-GFYDEPRQPYPEEENRSV 118

Query: 119 KTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHC--MPMKCGICDGR 176
           +T D  +PLKLS K+LY GKTF+F+ KRNVLC +C+G GLRK+       P+ C  C+G 
Sbjct: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178

Query: 177 GFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPR 236
           G KER+ R++ GF+ RE V C+ C+GKG      P D+CKKCHGKCVI E   LT+Y+PR
Sbjct: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238

Query: 237 GHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTG 296
           G R+ D ++++G+AD E  K TGDL+F I+E  +    LER+G DLH  + ISL+EA+TG
Sbjct: 239 GSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITG 298

Query: 297 FTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINN-GSRFGDLYVKVNIEFPKD 355
           F ++V  T DDR+L++ IP GKV+RPGNY++  NEGWP+++ G++FGD+YV+V+IEFP D
Sbjct: 299 FEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358

Query: 356 NWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQEG- 414
           NW +EKS++E ++ +LP + N+  +  GD +   NTE +  Y V++ +  LPDYL+ E  
Sbjct: 359 NWFSEKSDVEVLRTLLPEVPNARVADTGDLN---NTETVIDYSVVKSADELPDYLSYEKG 415

Query: 415 -QQRSNQQYG 423
             Q   Q+YG
Sbjct: 416 EYQGQEQEYG 425

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  387 bits (993), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 190/416 (45%), Positives = 283/416 (68%), Gaps = 15/416 (3%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
           D Y  LG+  +AT+ E+K+AYR LAL +HPDK+SDES R ESE KFKE++AAY++LS+E+
Sbjct: 2   DPYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEE 61

Query: 64  KRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF-RYGAGRYGQYEDAEQKTSQKTKD 122
           KR  YD YG  +  S  +  F D       DF +FF  + + RY    +A+   S +T D
Sbjct: 62  KRQNYDTYGDTNGFSGDYSGFQDG------DFASFFGNFASNRYQDEYEAQSPPSPRTDD 115

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182
             VP++L+ ++LY GKT +F+ KRNV+C++CEG G+R+RA H     C  C+G G K+R+
Sbjct: 116 AHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRARHA--SACSQCEGHGVKQRL 173

Query: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242
            R+ PGF++RE V CD+C G G  +  +  D CKKCHGK V  E+  L +Y+PRG RH D
Sbjct: 174 RRLGPGFVTREIVQCDKCKGLGKNLRSE--DMCKKCHGKRVTPESKNLNVYIPRGSRHGD 231

Query: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302
            + + G+AD E GK  GDLVF+I E     + LER+G+DL+  ITISL++ALTGF + V 
Sbjct: 232 RVVLKGEADEEPGKIPGDLVFDIAE-NSASSSLERRGSDLYAKITISLSDALTGFEKEVC 290

Query: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINN-GSRFGDLYVKVNIEFPKDNWLNEK 361
            T D RLL++ +P G+V+RPGN+++  NEGWP+++ GS+FGD+YV+++IEFP D+W +E+
Sbjct: 291 TTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHWFSER 350

Query: 362 SELEAIKHILPGLKNSSNSH--QGDGDDPANTEDINSYYVIQDSSRLPDYLAQEGQ 415
           S++++++++LP   +SS +        DPANTE    + +++ +  LP YL++E +
Sbjct: 351 SDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESE 406

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  375 bits (962), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 196/421 (46%), Positives = 279/421 (66%), Gaps = 16/421 (3%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
           D Y  LG+  +AT+ E+K+AYR LAL +HPDK+SDES R ESE KFKE++AAY++LS+E+
Sbjct: 2   DPYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEE 61

Query: 64  KRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF-RYGAGRYGQYEDAEQKTSQKTKD 122
           KR  YD YG  +  S  +G F D       DF +FF  + +GRY   ED       +T D
Sbjct: 62  KRRNYDTYGDTNGYSDSYGGFQDG------DFASFFGNFASGRYEDEEDFRAHARPRTDD 115

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182
             V L+L+ + LY GKT +F+  RNV+C++CEG G+RKRA H     C  C+G G K+R+
Sbjct: 116 AHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRARHA--SACTHCEGHGVKQRL 173

Query: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242
            R+ PGF++RE V C +C G G  +  +  D CKKCHGK V  E   L +Y+PRG RH D
Sbjct: 174 RRLGPGFVTRETVQCTKCRGLGKNLRSE--DLCKKCHGKRVTPETKNLNVYIPRGSRHND 231

Query: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302
            I ++G+AD E GK TGDLVF+I E +   + LER+G+DLH  I ISL++ALTGF + V 
Sbjct: 232 RIVLEGEADEEPGKLTGDLVFDISEDST-TSNLERRGSDLHTKIIISLSDALTGFEKEVC 290

Query: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINN-GSRFGDLYVKVNIEFPKDNWLNEK 361
            T D R LR+ IP+G+V+RPGNY+   NEGWP+++ G +FG++YV++NIEFP D+W +E+
Sbjct: 291 TTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHWYSER 350

Query: 362 SELEAIKHILPGLKNSSNSHQGDGD--DPANTEDINSYYVIQDSSRLPDYLAQEGQQRSN 419
            E+EA+++I+P   +SS +        DP NTE + ++ +++ +  LP+YL  + +Q   
Sbjct: 351 GEIEALRNIIPQSTSSSAASSSASAEPDPVNTE-MPTFDILKSAEELPNYLPDDAEQGGP 409

Query: 420 Q 420
           Q
Sbjct: 410 Q 410

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  363 bits (932), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 205/441 (46%), Positives = 281/441 (63%), Gaps = 40/441 (9%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKI--SDESQRAESEAKFKEISAAYDILSD 61
           DLY+VLG+ SNAT+ ++K+AYR LAL +HPDK+  S+   R  SE KFKEISAAY+ILSD
Sbjct: 3   DLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSD 62

Query: 62  EQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYG--QYEDAEQKTSQK 119
           E KR+ YD YG  +E       +D         F +FF +         YED      ++
Sbjct: 63  EDKRAHYDLYGSEEEQQRQQRQYDP--------FESFFNFEQDEEPSRHYEDP-----KR 109

Query: 120 TKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKR--AAHCMP--MKCGICDG 175
           + D  +PLK++ ++LY GKTF+FK KRNV+C  CEGLG R+R      +P  ++C +C G
Sbjct: 110 SPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCKG 169

Query: 176 RGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSD--NCKKCHGKCVIVENSILTLY 233
           +GF E+V  ++PGF +RE+  C +CDGKG   ++  S+   CKKCHG+ +  E+ +LT+ 
Sbjct: 170 QGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTVS 229

Query: 234 VPRGHRHADTIRIDGQADMEAGK-ETGDLVFEI--DEITDPDAELERKGTDLHCSITISL 290
           VPRG R  DTI++  +AD E GK +TGDL+F I  D+    D +LERKG++    + ISL
Sbjct: 230 VPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNISL 289

Query: 291 AEALTGFT-RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPIN-NGSRFGDLYVKV 348
           AEALTGF  + V +TFD R+L ++IP GKV+RPGN +K   EGWP+N   ++FGDLY+ V
Sbjct: 290 AEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEATKFGDLYISV 349

Query: 349 NIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPD 408
           NIEFP DNW  EKS+L  IK+ILP    S++      DDP NTE +  + V++    LPD
Sbjct: 350 NIEFPPDNWFTEKSDLTQIKNILP---RSTSDKTKLSDDPLNTELLLKFEVLE---TLPD 403

Query: 409 YLAQEGQQRSNQQYGERNTAS 429
            L +EGQ +     GE N  S
Sbjct: 404 TL-KEGQDQ-----GENNAES 418

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  361 bits (927), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 192/438 (43%), Positives = 290/438 (66%), Gaps = 31/438 (7%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
           DLYS+LG+ S+AT+ E+K+AYR LAL YHPDK+ D + R E+E KFKEI++AY+ILSDE+
Sbjct: 3   DLYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEE 62

Query: 64  KRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKDF 123
           KR+ YD YG  +E  +            N++  +FF +   +     D+    + K+KD 
Sbjct: 63  KRAHYDLYGDANENEY-----------NNQNANDFFNFETDQPDY--DSYAFDNDKSKDV 109

Query: 124 VVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKR--AAHCMP--MKCGICDGRGFK 179
            +PLKLS ++LY GKTF+F+ KRN++C +CEGLG R+R      +P  ++C  C+G G+K
Sbjct: 110 KIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGLGYK 169

Query: 180 ERVSRISPGFISRERVPCDECDGKGTVVSRDPS--DNCKKCHGKCVIVENSILTLYVPRG 237
           ER   + PGF++ +++ C++C GKG V ++  S  + CK CHGK ++ EN  L + VPRG
Sbjct: 170 ERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSVPRG 229

Query: 238 HRHADTIRIDGQADMEAGK-ETGDLVFEIDEITD--PDAELERKGTDLHCSITISLAEAL 294
            ++ DTIRI+ +AD E GK +TGD++  I+E T    D    RKGTD    +++SLAEAL
Sbjct: 230 LQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLAEAL 289

Query: 295 TGFT-RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPIN-NGSRFGDLYVKVNIEF 352
           TGF  + ++++ D R+L +++PSGKV+RPGN +K   EGWP+N   S+FGDLYV + IEF
Sbjct: 290 TGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIKIEF 349

Query: 353 PKDNWLNEKSELEAIKHILP-GLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLA 411
           P DNW +EKS+++ ++++LP G+    NS +   DDP NTE + ++ ++++   LPD L 
Sbjct: 350 PPDNWFSEKSDIQLLRNVLPSGINGMMNSWK--IDDPLNTETVTTFDILEE---LPDTL- 403

Query: 412 QEGQQRSNQQYGERNTAS 429
            E   RS    G+++ A+
Sbjct: 404 NESNNRSAYDTGDQSDAN 421

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  359 bits (921), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 192/432 (44%), Positives = 273/432 (63%), Gaps = 30/432 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY  LG+  +AT+ E+K+AYR LAL +HPDK++D+S R ESE +FKEI+AAY++LSDE+K
Sbjct: 3   LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF------RYGAGRYGQYEDAEQKTSQ 118
           RS+YD YG   +G     DF+D      E FMNFF          G  G      Q    
Sbjct: 63  RSKYDTYGDTADGP----DFED------ESFMNFFTQFNSGFGFNGGGGGGFPGAQPGDD 112

Query: 119 KTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMP-MKCGICDGRG 177
           ++ D  VPLK+S    Y GK F+F+ KR ++C KCEG G R+R+    P   C  C GRG
Sbjct: 113 RSDDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGGPPPQTNCKSCQGRG 172

Query: 178 FKERVSRISPGFISRERVPCDECDGKGTVVSRDPSD--NCKKCHGKCVIVENSILTLYVP 235
           +KE++ R++PG ++++ V C  C GKG  VS+  S+   CKKC G+ +I E   LT+ +P
Sbjct: 173 YKEQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIP 232

Query: 236 RGHRHADTIRIDGQADMEAGK-ETGDLVFEIDEITDPD--AELERKGTDLHCSITISLAE 292
           RG RH D I  +G+AD E GK +TGDL+F +DE T+P     LER+G DL  +I+ISLAE
Sbjct: 233 RGSRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAE 292

Query: 293 ALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPIN-NGSRFGDLYVKVNIE 351
           A+TG  R + +T D R+L+++ P+GKV+ PG  +K   EGWP+N + ++FGDLYV V+I 
Sbjct: 293 AITGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIV 352

Query: 352 FPKDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLA 411
           FP+DNW  EKS+L  I++ILP    S  ++     DP NTE ++   ++    +LPDY+ 
Sbjct: 353 FPRDNWFAEKSDLLKIRNILP----SEAANNDVKADPGNTEQVSDMKLV---DQLPDYMG 405

Query: 412 QEGQQRSNQQYG 423
             G Q +++ + 
Sbjct: 406 SNGDQYAHEGHA 417

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  353 bits (907), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 181/413 (43%), Positives = 272/413 (65%), Gaps = 20/413 (4%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY +LG++ +AT+ E+K+AYR  AL +HPDK++DES R ESE +FKEI+AAY++L DE+K
Sbjct: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFR-YGAGRYGQYEDAEQKTSQKTKDF 123
           R+ YD YG  D   F    F+   +  +  FMNFF  +G+     Y+   ++   ++ D 
Sbjct: 64  RARYDKYGDADGSDF----FNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDRSADV 119

Query: 124 VVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMP---MKCGICDGRGFKE 180
            VPL +S    Y GK+F+F+ KR ++C +C G G R+R  H +P   ++C  C G+GFK+
Sbjct: 120 QVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKCGGQGFKQ 179

Query: 181 RVSRISPGFISRERVPCDECDGKGTVVSRDPSD--NCKKCHGKCVIVENSILTLYVPRGH 238
           R+ R++PGF + E + C  CDGKG   S+  +D   CKKC G  V  E+  LT+ +PRG 
Sbjct: 180 RIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVSLPRGS 239

Query: 239 RHADTIRIDGQADMEAGK-ETGDLVFEIDEITD-PD-AELERKGTDLHCSITISLAEALT 295
           R  D I + G+AD E GK +TG+LVF I E T+ P+  +L+R G DL   +T+SLAEA+T
Sbjct: 240 RQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTLSLAEAIT 299

Query: 296 GFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKD 355
           GF++ + +T D R+L++ IP GKV+RPGN ++  +EGWPI+  +  GDLYV V+IEFP D
Sbjct: 300 GFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVVHIEFPPD 358

Query: 356 NWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPD 408
           NW +E+S+L  +K++LPG  N++ + +   DDP NTE + +  ++++   +PD
Sbjct: 359 NWFSERSDLTQVKNVLPGETNNNAAVE---DDPGNTETVTNINIVEE---IPD 405

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  304 bits (778), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 173/438 (39%), Positives = 260/438 (59%), Gaps = 46/438 (10%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           +D Y +LG+  +AT +E+K+ YR LAL YHPDK  DE Q+  +E KFK+I+AAY  LSDE
Sbjct: 11  RDYYEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDE 70

Query: 63  QKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKD 122
            KR+EYD+   F+    P+  F+ D+   ++          G Y        +   ++KD
Sbjct: 71  DKRNEYDNKKNFE----PY--FESDFANNHD----------GNYN------SRYRSRSKD 108

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKR---AAHCMP-MKCGICDGRGF 178
             V L L T +LY GKT +F   RN +C  C GLG R +     +  P ++C  C+G+G+
Sbjct: 109 IKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQGY 168

Query: 179 KERVSRISPGFISRERVPCDECDGKGTVVSR--DPSDNCKKCHGKCVIVENSILTLYVPR 236
           K    +++PGF + + V C  C G G    +   P + CK C+GKC+I  +  + + +PR
Sbjct: 169 KNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSIPR 228

Query: 237 GHRHADTIRIDGQADMEAGKE-TGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALT 295
           G  + D I + G+AD E GK+  GDL+FEI+EI D + +LER G  L     ISLAEA+T
Sbjct: 229 GSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEAIT 288

Query: 296 GF-TRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINN-GSRFGDLYVKVNIEFP 353
           GF  + + +TFDDR L ++ P GKV+RPG+ L+  NEGWP++  G+ FG+LYV + IEFP
Sbjct: 289 GFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIEFP 348

Query: 354 KDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQE 413
            DNW+NEK+++  I++ILP  K   N+      DP N+E I+++ +++    LP    +E
Sbjct: 349 PDNWINEKNDIIKIRNILPNEKTKRNNIV----DPINSEYISTFEIVK---SLP---QEE 398

Query: 414 GQQRSNQQYGERNTASEC 431
           G++++     E +T   C
Sbjct: 399 GEEQT-----EHDTNPSC 411

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  305 bits (781), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 267/469 (56%), Gaps = 52/469 (11%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSD 61
           G  LY VLG+  +AT QE+K AYR LAL +HPDK  D+  +  +E KFKEI+AAY+ILSD
Sbjct: 7   GDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSD 66

Query: 62  EQKRSEYDHYG-----RFDEGSFPFGDFD------DDYKRGNEDFMNFFRYGAGRYGQYE 110
            +K+S YD YG         G+  FGD D      + +  G+ D  NF        G+Y+
Sbjct: 67  PEKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNF-------PGEYD 119

Query: 111 DAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLR-KRAAHCM-PM 168
             E+  S  +KD  + + L+ K LY+GK  +F LKR V+C KC G G + KR  H    +
Sbjct: 120 AYEEGNSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDV 179

Query: 169 KCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSR--DPSDNCKKCHGKCVIVE 226
           +C  C G+G KER+ R  PG ++ + V C++C+GKG    R  +P + C  C G  ++ +
Sbjct: 180 ECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSK 239

Query: 227 NSILTLYVPRGHRHADTIRIDGQADMEAGKET-GDLVFEIDEITDPDAELERK------- 278
             I+T+ V  GH   D I + G AD E  K T GDL F    +T+    LE+K       
Sbjct: 240 KEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKF---HLTEKQENLEQKQIFLKNF 296

Query: 279 ----GTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP 334
               G DL+ SITISL+EALTGF + + +TFDDRLL +++  G+V+RPG+ +K  NEGWP
Sbjct: 297 DDGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWP 356

Query: 335 I--NNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQG----DGDDP 388
           I  N   R GDLYV V+IEFP DNW NEKSEL AIK  LP   +S  SH      D  + 
Sbjct: 357 ILDNPHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPS-SSSCASHATVNTEDDSNL 415

Query: 389 ANTEDINSYYVIQDSSRLPDYL---AQEGQQRSNQQYGERNTASECPVQ 434
            N E I+++ +I  +  LP+ +     E Q  ++Q    +  +S C +Q
Sbjct: 416 TNNETISNFRIIH-TDDLPEGIRPFKPEAQDSAHQ----KARSSYCCIQ 459

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  302 bits (774), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 177/429 (41%), Positives = 257/429 (59%), Gaps = 48/429 (11%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS-----DESQRAESEAKFKEISAAYD 57
           KDLY++L +    T+ E+K+ YR LAL YHPDK+      ++  + E E KFKEI +AY+
Sbjct: 10  KDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYE 69

Query: 58  ILSDEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTS 117
           ILSDE+KR +YD    F            D  +G++       YG G    +       +
Sbjct: 70  ILSDEEKRKQYDLQKNFR-----------DANQGSD-------YGDGINTAF------GN 105

Query: 118 QKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKR---AAHCMPM-KCGIC 173
           Q +KD  +PLK++ K LY GK  ++ +KRNV+C KC GLG R R     +  P+ +C  C
Sbjct: 106 QTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECKTC 165

Query: 174 DGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDN--CKKCHGKCVIVENSILT 231
           DG G+K+   +I+PGF +++ + C  CDGKG    +  S    C KC+GK +I  +  +T
Sbjct: 166 DGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISESIT 225

Query: 232 LYVPRGHRHADTIRIDGQADMEAGK-ETGDLVFEIDEITDPDAELERKG-TDLHCSITIS 289
           + +PRG    DTI ID +AD E GK +TGDL+F ++EI D    L+R G  DL   +TIS
Sbjct: 226 VNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELTIS 285

Query: 290 LAEALTGFT-RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPIN-NGSRFGDLYVK 347
           LA+A+TGF  + + +T D RLLR++IP GKV+R G+ LK   EGWP+N N +R GDLY+K
Sbjct: 286 LADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLYIK 345

Query: 348 VNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGD--GDD----PANTEDINSYYVIQ 401
            NIEFP DNW +E +++  I+++LP + ++     GD   DD      N+EDI++Y  ++
Sbjct: 346 FNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNSEDISNYDFVK 405

Query: 402 DSSRLPDYL 410
           D   LPD +
Sbjct: 406 D---LPDII 411

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  298 bits (763), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 183/464 (39%), Positives = 269/464 (57%), Gaps = 47/464 (10%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY VLG+ S+A+ QE+K AYR LAL +HPDK  D++ +  +E KFKEI+AAY+ILSD +K
Sbjct: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69

Query: 65  RSEYDHYG-----RFDEGSFPFG------DFDDDYKRGNEDFMNFFRYGAGRYGQYEDAE 113
           +S YD YG         G+  FG       F++ +  G+ +  +F R       +Y+  E
Sbjct: 70  KSHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPR-------EYDTYE 122

Query: 114 QKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLG--LRKRAAHCMPMKCG 171
           +   + +KD  + + L+ K LY+GK  +F+LKR ++C  C G G  L+K+      ++C 
Sbjct: 123 EDKCKSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECE 182

Query: 172 ICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSR--DPSDNCKKCHGKCVIVENSI 229
            C G+G KER+ R  PG ++ + V C++C GKG  V R  +P + C  C G  +  +  I
Sbjct: 183 SCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEI 242

Query: 230 LTLYVPRGHRHADTIRIDGQADMEAGKET-GDLVFEIDEITDPDAELERK---------- 278
           +T+ V  GH   D I I G AD E  K   GDL F + E  +    LE+K          
Sbjct: 243 ITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE---NLEQKQIFLKNFDEG 299

Query: 279 -GTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINN 337
              DL+ S TISL+EALTGF + + RTFDDRLL ++I  G+V+RPG+ +K TNEGWPI +
Sbjct: 300 SAEDLYTSATISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMD 359

Query: 338 GSR--FGDLYVKVNIEFPKDNWLNEKSELEAIKHILPG-----LKNSSNSHQGDGDDPAN 390
             R   GDLYV ++IEFP DNW NEKSEL AIK +LP       + ++N+ + D  +P N
Sbjct: 360 DPRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGE-DDRNPIN 418

Query: 391 TEDINSYYVIQDSSRLPDYLAQEGQQRSNQQYGERNTASECPVQ 434
            E I+++ +I +   LP+ +     +  N  + ++  +S CP+Q
Sbjct: 419 NETISNFQII-NMEELPEGMKIFNSESQNSAH-QKAKSSYCPMQ 460

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  293 bits (749), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 178/449 (39%), Positives = 261/449 (58%), Gaps = 21/449 (4%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY VLG+   A+ QE+K AYR LAL +HPDK  D+  +  +E KFKEI+AAY+ILSD +K
Sbjct: 10  LYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEK 69

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRY-GQYEDAEQKTSQKTKDF 123
           +S YD YG  +         DDD+     +F N   + A  +  ++E  E   +  +KD 
Sbjct: 70  KSHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGNETTSSKDI 129

Query: 124 VVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLR-KRAAHCM-PMKCGICDGRGFKER 181
            + L  + K LY+GK  +F+LKR ++C KC+G G + K+  H    M+C  C G+G KER
Sbjct: 130 DIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEMECESCGGKGSKER 189

Query: 182 VSRISPGFISRERVPCDECDGKGTVVSR--DPSDNCKKCHGKCVIVENSILTLYVPRGHR 239
           + R  PG ++ + V C++C GKG    R  +  + C  C    +  +  ++T+ VP GH 
Sbjct: 190 LKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKKEVITVNVPPGHH 249

Query: 240 HADTIRIDGQADMEAGKET-GDLVFEI----DEITDPDAELERKG----TDLHCSITISL 290
             D + + G AD E  K   GDL+F +    +++      +++ G     DL+ SIT+SL
Sbjct: 250 FNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGNLQDLYVSITVSL 309

Query: 291 AEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSR--FGDLYVKV 348
           +EALTGF + + RTFDDRLL ++I  GKV+RPG+ +K TNEGWPI +  R   GDLYV V
Sbjct: 310 SEALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDHPRGQCGDLYVFV 369

Query: 349 NIEFPKDNWLNEKSELEAIKHILP-GLKNSSNSHQGDGDD--PANTEDINSYYVIQDSSR 405
           +IEFP DNW NEKSEL AIK  LP      SN+    G D  P N+E ++++ +I  S  
Sbjct: 370 DIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPINSETVSNFQIIH-SDD 428

Query: 406 LPDYLAQEGQQRSNQQYGERNTASECPVQ 434
           LP+ +     +     + ++ ++S CP+Q
Sbjct: 429 LPEGMKTFNPKPQTSAH-QKASSSYCPMQ 456

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  291 bits (746), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 183/454 (40%), Positives = 259/454 (57%), Gaps = 32/454 (7%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY VLG+  +A  QE+K AYR LAL +HPDK  D+  +  +E KFKEI+AAY+ILSD +K
Sbjct: 10  LYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEK 69

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYG-----QYEDAEQKTSQK 119
           +S YD YG  D G+   G  D        +F N F    G  G     +Y+  E   S  
Sbjct: 70  KSHYDLYGD-DNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKMYEDNDSAS 128

Query: 120 TKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGL--RKRAAHCMPMKCGICDGRG 177
           +KD  + + L+ K LY+GK  +F LKR V+C KC G G   +KR      ++C  C G+G
Sbjct: 129 SKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECESCGGKG 188

Query: 178 FKERVSRISPGFISRERVPCDECDGKGTV--VSRDPSDNCKKCHGKCVIVENSILTLYVP 235
            KER+ R  PG ++ + V C++C GKG      ++P + C  C G  +  +  ++T+ V 
Sbjct: 189 SKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVITVIVA 248

Query: 236 RGHRHADTIRIDGQADMEAGKET-GDLVFEIDEITDP------------DAELERKGTDL 282
            GH   D I I+G AD E GK   GDL F ++E  +             D  +E    D 
Sbjct: 249 PGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNME----DS 304

Query: 283 HCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGS--R 340
           + S+TISL+EALTGF + + +TFDDRLL ++I  G+V+RPG+ LK TNEGWPI + +  R
Sbjct: 305 YVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARGR 364

Query: 341 FGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVI 400
            GDLYV ++IEFP DNW NEKSEL  IK  LP   +SS +  GD +D  N E ++++ +I
Sbjct: 365 CGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCA-SGDANDLINNETVSNFQII 423

Query: 401 QDSSRLPDYLAQEGQQRSNQQYGERNTASECPVQ 434
             +  LP+ +     +  N  + +  +A  CP+Q
Sbjct: 424 H-TDDLPEGVKTFKPKPQNPAHKKARSAY-CPMQ 455

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  271 bits (693), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 163/449 (36%), Positives = 257/449 (57%), Gaps = 43/449 (9%)

Query: 6   YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
           Y +LG+  ++T+ E+++AYR LAL +HPDK+ D  ++A +E KFKEI+ AY+ILS+ +  
Sbjct: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNGEYV 66

Query: 66  SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRY---GQYEDAEQKTSQKTKD 122
            E +         F FGD          DFMNFF  G   +   G  +  ++ T++ T+ 
Sbjct: 67  EEMEEEYEGQGYGFNFGD----------DFMNFFNEGRNAHPMGGHPQREDESTNEATQ- 115

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRA---AHCMP-MKCGICDGRGF 178
             + ++++ K LY GK  +F+L RNV+C+ C+G   R+R     +  P + C  C G G+
Sbjct: 116 --IEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKGAGY 173

Query: 179 KERVSRISPGFISRERVPCDECDGKGTVVSRDPSD--NCKKCHGKCVIVENSILTLYVPR 236
            ER+   SP F   +R+ C +C GKG   ++  SD   CK CHG+ +I E   L + +PR
Sbjct: 174 VERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPR 233

Query: 237 GHRHADTIRIDGQADMEA-GKETGDLVFEI---DEIT--DPDAELERKGTDLHCSITISL 290
           G  +++TI    + D +   +  GD+VF +   DE    DPD  + ++GTDLH +I I L
Sbjct: 234 GSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPL 293

Query: 291 AEALTGFT-RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP-INNGSRFGDLYVKV 348
            EA++G   R + +TFDDR+L++T+P GKVLRPG+ +    EGWP   NG+ FGD++V V
Sbjct: 294 IEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHV 353

Query: 349 NIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPD 408
           N+EFP DNW++E++++  + ++LP  K S + H   G D  N E +  Y +++ +     
Sbjct: 354 NVEFPPDNWISERNDITTLTNVLPAGK-SDDGHAQTG-DANNAEFVKDYEILKATD---- 407

Query: 409 YLAQEGQQRSNQQYGERNTAS---ECPVQ 434
               EG + SN +   R  A    +C +Q
Sbjct: 408 ----EGTRSSNTKTASRPPAQGLYKCSIQ 432

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  238 bits (608), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 145/430 (33%), Positives = 230/430 (53%), Gaps = 43/430 (10%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKI-----SDESQRAESEAKFKEISAAYDI 58
           D Y +LG+  +A++ E+KRAYR LAL +HPDK       ++S     +  FKE++AAY +
Sbjct: 2   DYYGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQV 61

Query: 59  LSDEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFR-----YGAGRYGQYEDAE 113
           LSD   R+EYD    F+  + P+GD         +DFMNFF         G    ++   
Sbjct: 62  LSDASLRAEYDQKLAFE--AQPYGD---------DDFMNFFSGFNGGSHPGHRSGFDSGR 110

Query: 114 QKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLG-------LRKRAAHCM 166
                K+ D  + LK+ T +LY GK   F LKR   C +C+G G       ++K+ A   
Sbjct: 111 GARRYKSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFF 170

Query: 167 PMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTV--VSRDPSDNCKKC--HGKC 222
              C  C+G+G ++R+ +++PGF++ E + C +C GKG +  + +   + C  C   G  
Sbjct: 171 WNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTV 230

Query: 223 VIV-ENSILTLYVPRGHRHADTIRIDGQADME-AGKETGDLVFEIDEITDPDAELERKGT 280
            +V EN ++T+ + +G    D I + G+AD +    E GDLV +I E+ +P  ++ R G 
Sbjct: 231 GMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGY 290

Query: 281 DLHCSITISLAEALTGF-TRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP----- 334
           DL     I LA+A+ GF  + +  T+D R+L+ +   GKV+RP + ++  NEGWP     
Sbjct: 291 DLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDA 350

Query: 335 --INNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTE 392
              N   + GDLYV V+I FP DNW  E ++  A+++I+P   N   S    G+   N E
Sbjct: 351 NDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTS-GESILNVE 409

Query: 393 DINSYYVIQD 402
           +IN   ++++
Sbjct: 410 NINVSEIVKE 419

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  191 bits (485), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 186/368 (50%), Gaps = 23/368 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY +LG+   A + ++K+AYR  AL +HPDK   E    E+  KFKEI++AY+ILSD QK
Sbjct: 7   LYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSE----EAAEKFKEITSAYEILSDSQK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKDFV 124
           R  YD +G         G        G + F  FF  G+ R         +  QK +D  
Sbjct: 63  REVYDQFGLEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSSR--------PRGPQKGRDIR 114

Query: 125 VPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSR 184
             +  + +QL+ G+T +  L + ++C  CEG G ++ +      KC  C G+GFK    +
Sbjct: 115 HEIPATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGSVK----KCTACSGQGFKFVTRQ 170

Query: 185 ISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTI 244
           + P  I R +V C+ C G G ++  DP   CK C GK V+ E  +L + +  G +    I
Sbjct: 171 MGP-MIQRFQVECESCHGAGEII--DPKGRCKVCSGKKVVNERKVLEVNIEPGMKDGQRI 227

Query: 245 RIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVART 304
              G+AD   G   GD+VF + E   P    +R G DLH    I L  A+ G  +   + 
Sbjct: 228 VFQGEADQSPGIIPGDVVFVVSE--QPHPVFKRDGNDLHYDAEIDLLSAIAG-GQFAVKH 284

Query: 305 FDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSEL 364
                L++ I  G+V+ PG+      +G PI     +G+L +K NI+FP  ++ ++++ L
Sbjct: 285 VSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKYGGYGNLLIKFNIKFPPAHFTDDET-L 343

Query: 365 EAIKHILP 372
           + ++ ILP
Sbjct: 344 KKLEEILP 351

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  188 bits (478), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 121/371 (32%), Positives = 184/371 (49%), Gaps = 21/371 (5%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY +LG+   A++ E+K+AYR  AL YHPDK   E    E+  KFKE S+AY++LSD +K
Sbjct: 7   LYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSE----EAAEKFKEASSAYEVLSDSEK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKDFV 124
           R  YD +G+                   ED  + F  GAG       +  +  Q+ +D  
Sbjct: 63  RDIYDQFGQDGLSGNGGMPGGAGGFGFGEDLFSQFFGGAGA------SRPRGPQRGRDIK 116

Query: 125 VPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSR 184
             + +S ++LY GKT +  L + +LC  CEG G +K A      KC  C+G+G K    +
Sbjct: 117 HEISVSLEELYKGKTSKLALNKQILCKTCEGRGGKKGAVK----KCSSCNGQGIKFVTRQ 172

Query: 185 ISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTI 244
           + P  I R +  CD C G G ++  D  D CK CHGK +  E  IL + V  G ++   +
Sbjct: 173 MGP-MIQRFQTECDVCHGTGDII--DAKDRCKDCHGKKIANERKILQVNVDPGMKNGQKV 229

Query: 245 RIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVART 304
              G+AD       GD++F I E   P    +R G DL     I L  A+ G        
Sbjct: 230 VFKGEADQAPDIIPGDVIFVISE--KPHKHFQRVGDDLIYEAEIDLLTAVAG-GEFALEH 286

Query: 305 FDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSEL 364
                L+++I  G+V+ P        +G PI     +G+L +K +I+FP++++ +E + L
Sbjct: 287 VSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGGYGNLIIKFSIKFPENHFADEDT-L 345

Query: 365 EAIKHILPGLK 375
           + ++ ILP  K
Sbjct: 346 KKLEEILPARK 356

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  188 bits (478), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 184/368 (50%), Gaps = 21/368 (5%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY VLG+   AT+ E+K+AYR +AL +HPDK   E    E+  KFKE S+AY++LSD  K
Sbjct: 7   LYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSE----EAAEKFKEASSAYEVLSDADK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKDFV 124
           R  YD +G                    +D  + F  GAG          +  Q+ +D  
Sbjct: 63  RDTYDQFGLEGLSGAGGMGGAGGGFGFGDDIFSQFFGGAGA------QRPRGPQRGRDIK 116

Query: 125 VPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSR 184
             + ++ ++LY GKT +  L + +LC  CEG G +K A      KC  C+G+G K    +
Sbjct: 117 HEINVTLEELYRGKTSKLALNKQILCKTCEGRGGKKGAVK----KCSSCNGQGIKFVTRQ 172

Query: 185 ISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTI 244
           + P  I R +  CD C G G +V  DP D CK C+GK V  E  IL ++V  G ++   +
Sbjct: 173 MGP-MIQRFQTECDVCHGAGDIV--DPKDRCKSCNGKKVASERKILEVHVDPGMKNGQKV 229

Query: 245 RIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVART 304
              G+AD       GD+VF I+E   P    +R G +L     + L  A+ G    +   
Sbjct: 230 VFKGEADQAPDVIPGDVVFVINE--KPHKHFQRSGDNLVYEAEVDLLTAIAGGEFAIEHV 287

Query: 305 FDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSEL 364
             D  L++ I  G+V+ PG       +G P+     +G+L +K  ++FP+ ++  E++ L
Sbjct: 288 SGD-WLKVAIVPGEVIAPGARKVIDGKGMPVAKYGGYGNLIIKFTVKFPEPHFTTEEN-L 345

Query: 365 EAIKHILP 372
           + ++ ILP
Sbjct: 346 KKLEEILP 353

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  187 bits (475), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 119/368 (32%), Positives = 184/368 (50%), Gaps = 21/368 (5%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
            Y +LG+  NA+E E+K+ YR  AL YHPDK    +   E+  KFKE S AY++LSD QK
Sbjct: 7   FYDLLGVSPNASESEIKKGYRKAALKYHPDK----NPTDEAAEKFKECSGAYEVLSDSQK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKDFV 124
           R  YD YG         G     +    +D  + F  GAG       +  +  Q+ KD  
Sbjct: 63  REIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGAGA------SRPRGPQRGKDIR 116

Query: 125 VPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSR 184
             ++ + ++LY G+T +  L + +LC  CEG G ++ A      KC  C G+G K    +
Sbjct: 117 HEIQNTLEELYKGRTAKLALNKQILCKGCEGRGGKEGAVK----KCSSCGGQGVKFVTRQ 172

Query: 185 ISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTI 244
           + P  I R +  CD C G G ++  DP D CK+C G  V  E  +L ++V  G R    +
Sbjct: 173 MGP-MIQRFQTECDVCHGSGDII--DPKDRCKECKGNKVANERKVLEVHVEPGMREGQKV 229

Query: 245 RIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVART 304
              G+AD       GD++F + E   P    +R G DL     + L  A+ G    +   
Sbjct: 230 TFKGEADQAPDIIPGDVIFVVTE--KPHKHFKRSGDDLLYEAEVDLLTAIAGGDFAIEHV 287

Query: 305 FDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSEL 364
             D  L++TI  G+V+ PG       +G P+     +G+L +   I+FP++++ +E ++L
Sbjct: 288 SGD-WLKVTIVPGEVISPGVRKVIDGKGMPVQKYGGYGNLIITFKIKFPENHFADE-AKL 345

Query: 365 EAIKHILP 372
           +A++ ILP
Sbjct: 346 KALEDILP 353

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  187 bits (474), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 127/369 (34%), Positives = 186/369 (50%), Gaps = 24/369 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY  LG+   A++ E+K+AYR  AL YHPDK   E    E+  KFKE+S+AY+ILSD QK
Sbjct: 7   LYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSE----EAAEKFKEVSSAYEILSDSQK 62

Query: 65  RSEYDHYGRFDEG-SFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKDF 123
           R  YD +G  +EG S   G          ED  + F      +G       +  Q+ +D 
Sbjct: 63  REVYDQFG--EEGLSGNGGAGFPGGFGFGEDIFSQF------FGGATGGRPRGPQRGRDI 114

Query: 124 VVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVS 183
              +  S ++LY G+T +  L + +LC  CEG G ++ A      KC  C+G+G K    
Sbjct: 115 KHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGAVK----KCSSCNGQGIKFVTR 170

Query: 184 RISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADT 243
           ++ P  I R +  CD C G G ++  D  D CK C+GK V  E  IL + +  G +    
Sbjct: 171 QMGP-MIQRFQTECDVCHGTGDII--DAKDRCKSCNGKKVDNERKILEVRIEPGMKDGQK 227

Query: 244 IRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVAR 303
           I   G+AD       GD+VF I E   P    +R G DL     I L  AL G    +  
Sbjct: 228 IVFKGEADQAPDVIPGDVVFVISE--KPHKHFQRAGDDLIYEAEIDLLTALAGGQFALEH 285

Query: 304 TFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSE 363
              D  L++ I  G+V+ PG       +G PI     +G+L +K NI+FP++++ +E++ 
Sbjct: 286 VSGD-WLKVDIVPGEVIAPGARKIVEGKGMPIQKYGGYGNLLIKFNIKFPENHFTSEEN- 343

Query: 364 LEAIKHILP 372
           L+ ++ ILP
Sbjct: 344 LKKLEEILP 352

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  186 bits (472), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 125/373 (33%), Positives = 185/373 (49%), Gaps = 29/373 (7%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
            Y +LG+   A+E E+K+ YR  AL YHPDK    +  AE+  KFKE SAAY++LSD +K
Sbjct: 7   FYDILGVSPTASESEIKKGYRKAALKYHPDK----NPTAEAAEKFKECSAAYEVLSDPEK 62

Query: 65  RSEYDHYGRFDEG-----SFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQK 119
           R  YD YG  +EG         G F      G++ F  FF  GA +         +  QK
Sbjct: 63  RDVYDQYG--EEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQ-------RPRGPQK 113

Query: 120 TKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFK 179
            +D    +  + ++LY G+T +  L + +LC  CEG G +  A      KC  C G+G K
Sbjct: 114 GRDIKHEIAATLEELYKGRTAKLALNKQILCKSCEGRGGKADAVK----KCSSCGGQGIK 169

Query: 180 ERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHR 239
               ++ P  I R +  CD C G G ++  DP   CK CHGK +  E  IL + +  G +
Sbjct: 170 FVTKQMGP-MIQRFQTECDVCHGTGDII--DPKGRCKSCHGKKIANERKILEVKIEPGMK 226

Query: 240 HADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTR 299
               I   G++D       GD+VF ++E   P    +R G DL     I L  A+ G   
Sbjct: 227 DGQRIVFKGESDQAPDIIPGDVVFVVNE--KPHKHFQRSGNDLVYLAEIDLLTAIAG-GE 283

Query: 300 LVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLN 359
                     L+I I +G+V+ PG       +G PI     +G+L ++ NI+FP++++ +
Sbjct: 284 FALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYGGYGNLIIQFNIKFPENHFTD 343

Query: 360 EKSELEAIKHILP 372
           E S L+ ++ ILP
Sbjct: 344 E-SNLKKLEEILP 355

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  184 bits (468), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 186/370 (50%), Gaps = 24/370 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
            Y +LG+   AT+ E+K+AYR  AL YHPDK   E    E+  KFKE SAAY+ILSD +K
Sbjct: 7   FYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSE----EAAEKFKEASAAYEILSDPEK 62

Query: 65  RSEYDHYGR--FDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKD 122
           R  YD +G           G     +  G++ F  FF  G  +         +  Q+ KD
Sbjct: 63  RDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQ-------RPRGPQRGKD 115

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182
               +  S ++LY G+T +  L + +LC +CEG G +K A      KC  C+G+G K   
Sbjct: 116 IKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVK----KCTSCNGQGIKFVT 171

Query: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242
            ++ P  I R +  CD C G G ++  DP D CK C+GK V  E  IL ++V  G +   
Sbjct: 172 RQMGP-MIQRFQTECDVCHGTGDII--DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQ 228

Query: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302
            I   G+AD       GD+VF + E   P    +R G DL     I L  A+ G    + 
Sbjct: 229 RIVFKGEADQAPDVIPGDVVFIVSE--RPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALE 286

Query: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKS 362
               D  L++ I  G+V+ PG       +G PI     +G+L +K  I+FP++++ +E++
Sbjct: 287 HVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKFPENHFTSEEN 345

Query: 363 ELEAIKHILP 372
            L+ ++ ILP
Sbjct: 346 -LKKLEEILP 354

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  184 bits (466), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 125/370 (33%), Positives = 184/370 (49%), Gaps = 24/370 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
            Y +LG+   AT+ E+K+AYR  AL YHPDK   E    E+  KFKE S+AY+ILSD +K
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSE----EAAEKFKEASSAYEILSDSEK 62

Query: 65  RSEYDHYGR--FDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKD 122
           R  YD +G           G     +  G++ F  FF  G  +         +  Q+ KD
Sbjct: 63  REVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQ-------RPRGPQRGKD 115

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182
               +  S ++LY G+T +  L + +LC  CEG G +K A      KC  C+G+G K   
Sbjct: 116 IKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVK----KCSSCNGQGIKFVT 171

Query: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242
            ++ P  I R +  CD C G G ++  DP D CK C+GK V  E  IL ++V  G +   
Sbjct: 172 RQMGP-MIQRFQTECDVCHGTGDII--DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQ 228

Query: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302
            I   G+AD       GD+VF + E   P    +R G DL     I L  A+ G    + 
Sbjct: 229 RIVFKGEADQAPDVIPGDVVFIVSE--RPHKNFKRDGDDLVYEAEIDLLTAIAGGEFALE 286

Query: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKS 362
               D  L++ I  G+V+ PG       +G PI     +G+L +K  I+FP++++  E++
Sbjct: 287 HVSGD-WLKVGIVPGEVISPGMRKVIEGKGMPIPKYGGYGNLVIKFTIKFPENHFTTEEN 345

Query: 363 ELEAIKHILP 372
            L+ ++ ILP
Sbjct: 346 -LKKLEEILP 354

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  184 bits (466), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 131/395 (33%), Positives = 196/395 (49%), Gaps = 32/395 (8%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
            Y +LG+ + A+E E+K+AYR  AL YHPDK   E    E+  KFKE S+AY++L D +K
Sbjct: 7   FYDLLGVSATASETEIKKAYRKTALKYHPDKNPSE----EAAEKFKEASSAYEVLMDAEK 62

Query: 65  RSEYDHYGRFDEG-------SFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTS 117
           R  YD +G  +EG          FG F      G++ F  FF  GA R         +  
Sbjct: 63  REAYDQFG--EEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASR--------PRGP 112

Query: 118 QKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRG 177
           Q+ +D    + ++ ++LY G+T +  L + +LC  CEG G ++ A      KC  C+G+G
Sbjct: 113 QRGRDIKHEITVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGAVK----KCTSCNGQG 168

Query: 178 FKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRG 237
            K    ++ P  I R +  CD CDG G ++  +P D CK C GK V  E  IL ++V  G
Sbjct: 169 VKFITRQMGP-MIQRFQTECDACDGTGDII--NPKDRCKACSGKKVANERKILEVHVDPG 225

Query: 238 HRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGF 297
            +    I   G+AD       GD++F + E   P     R   DL     I L  A+ G 
Sbjct: 226 MKDGQKIVFKGEADQAPDIIPGDVIFVVSE--RPHKHFRRDSDDLVYEADIDLLTAIAGG 283

Query: 298 TRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNW 357
              +     D  L++ I  G+V+ PG       +G P+     FG+L VK NI FPKD++
Sbjct: 284 EFAIEHVSGD-WLKVEIVPGEVISPGMRKVIEGKGMPVLKYGGFGNLLVKFNIVFPKDHF 342

Query: 358 LNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTE 392
            + ++ ++ ++ ILP  K +S   +   DD   +E
Sbjct: 343 TSLEN-MKKLEEILPPRKKTSIPSKAHVDDCVLSE 376

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  182 bits (463), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 123/370 (33%), Positives = 185/370 (50%), Gaps = 24/370 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
            Y +LG+   AT+ E+K+AYR  AL +HPDK   E    E+  KFKE S+AY++LSD +K
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSE----EAAEKFKEASSAYEVLSDSEK 62

Query: 65  RSEYDHYGR--FDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKD 122
           R  YD +G           G     +  G++ F  FF  G  +         K  Q+ +D
Sbjct: 63  REVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQ-------RPKGPQRGRD 115

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182
               +  S ++LY G+T +  L + +LC +CEG G +K A      KC  C+G+G K   
Sbjct: 116 IKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVK----KCTGCNGQGIKFVT 171

Query: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242
            ++ P  I R +  CD C G G +V  DP D CK C+GK +  E  IL ++V  G +   
Sbjct: 172 RQMGP-MIQRFQTECDACHGTGDIV--DPKDRCKSCNGKKIENERKILEVHVEPGMKDGQ 228

Query: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302
            I   G+AD       GD+VF + E   P    +R G DL     I L  A+ G    + 
Sbjct: 229 KIVFKGEADQAPDVIPGDVVFLVSE--RPHKHFKRDGDDLVYEAEIDLLTAIAGGEFALE 286

Query: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKS 362
               D  L++ I  G+V+ PG       +G P+     +G+L VK  I+FP++++  E++
Sbjct: 287 HVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGGYGNLIVKFTIKFPENHFTTEEN 345

Query: 363 ELEAIKHILP 372
            L+ ++ ILP
Sbjct: 346 -LKKLEEILP 354

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  182 bits (463), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 121/371 (32%), Positives = 181/371 (48%), Gaps = 26/371 (7%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
            Y +LG+  +A + ++K+ YR  AL +HPDK    +  AE+  KFKE++ AY++LSD QK
Sbjct: 7   FYDLLGVPVDANDAQIKKGYRKQALKFHPDK----NPSAEAADKFKELTVAYEVLSDSQK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNED---FMNFFRYGAGRYGQYEDAEQKTSQKTK 121
           R  YD  G         G        G      F  FF  GA R         +  QK +
Sbjct: 63  RDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGASR--------PRGPQKGR 114

Query: 122 DFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKER 181
           D    +  S ++LY G+T +  L + VLC  CEG G ++ A      KC  C+G+G K  
Sbjct: 115 DIKHEMSASLEELYKGRTAKLALNKQVLCKTCEGRGGKEGAVK----KCASCNGQGVKFI 170

Query: 182 VSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHA 241
             ++ P  I R +  CD C+G G +V  DP D CK C+GK +  E  IL +++  G +  
Sbjct: 171 TRQMGP-MIQRFQAECDACNGTGDIV--DPKDRCKTCNGKKIDNERKILEVHIEPGMKDG 227

Query: 242 DTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLV 301
             I   G+AD   G   GD++F I +   P    ERKG +L+    + L  A+ G     
Sbjct: 228 QKIVFQGEADQAPGVIPGDVIFVISQ--RPHKHFERKGDNLYYQAEVDLLSAIAG-GEFA 284

Query: 302 ARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEK 361
                   L++ I  G+V+ PG       +G P+     FGDL V   + FP +++ +E+
Sbjct: 285 IEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGGFGDLIVTFKVNFPTNHFADEE 344

Query: 362 SELEAIKHILP 372
           S L+ ++ ILP
Sbjct: 345 S-LKKLEEILP 354

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  182 bits (463), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/371 (33%), Positives = 182/371 (49%), Gaps = 25/371 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
            Y +LG+  NA+E E+K+ YR  AL YHPDK   E    E+  KFKE SAAY++LSD QK
Sbjct: 7   FYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSE----EAAEKFKECSAAYEVLSDSQK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTS--QKTKD 122
           R  YD YG         G F        +D  + F  GAG         Q+ S  Q+ +D
Sbjct: 63  REVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAG--------AQRPSGPQRGRD 114

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182
               ++ + ++LY G+T +  L + +LC  CEG G +  A      KC  C+G+G K   
Sbjct: 115 IKHEIQNTLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVK----KCTSCNGQGIKFVT 170

Query: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242
            ++ P  I R +  CD C G G ++  DP D CK C GK +  E  +L ++V  G R   
Sbjct: 171 RQMGP-MIQRFQTECDVCHGSGDII--DPKDRCKDCKGKKIANERKVLEVHVEPGMREGQ 227

Query: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302
            I   G+AD       GD++F +  +  P    +R G DL     I L  A+ G    + 
Sbjct: 228 KIVFKGEADQAPDVIPGDVIFVV--VEKPHKHFKRAGDDLLYEAEIDLLTAIAGGEFAIQ 285

Query: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKS 362
               D L   T+P G+V+  G       +G P+     +G+L V   I+FP++N+  E  
Sbjct: 286 HVSGDWLKVSTVP-GEVISSGMKKVIEGKGMPVPKYGGYGNLIVTFKIKFPENNFATE-D 343

Query: 363 ELEAIKHILPG 373
           +L+ +++ILP 
Sbjct: 344 KLKELENILPA 354

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  182 bits (461), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 118/370 (31%), Positives = 190/370 (51%), Gaps = 24/370 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY +LG+ ++A + ++K+AYR  AL YHPDK    +  +E+  KFK+++AAY+ILSD QK
Sbjct: 7   LYDLLGVSADANDAQIKKAYRKAALKYHPDK----NPSSEAADKFKQMTAAYEILSDSQK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNED--FMNFFRYGAGRYGQYEDAEQKTSQKTKD 122
           R  YD +G         G        G  +  F  FF  G         +  +  QK +D
Sbjct: 63  REVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQFFGGGGA-------SRPRGPQKGRD 115

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182
               +  + + LY G+T +  L + VLC  CEG G +  +      KC  C G G K   
Sbjct: 116 IKHDISCTLENLYKGRTAKLALNKTVLCKSCEGRGGKSGSVK----KCSSCGGHGVKFVT 171

Query: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242
            ++ P  I R +  C+ C+G+G V+  DP D C++C GK +  E  IL + +  G ++  
Sbjct: 172 RQMGP-MIQRFQTTCEACNGEGDVI--DPKDRCRECSGKKISNERKILEVNIEPGMKNGQ 228

Query: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302
            +   G+AD + G+  GD+VF ++E   P  +  R G +LH    I L  A+ G    + 
Sbjct: 229 KVVFQGEADQQPGQIPGDVVFVVNEQEHP--KFVRNGDNLHYEAQIDLLTAVAGGQFALE 286

Query: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKS 362
               D  L++ I  G+V+ PG       +G PI     +G+L +K N++FPK ++ ++ +
Sbjct: 287 HVSGD-WLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGSYGNLLIKFNVKFPKSHFASD-A 344

Query: 363 ELEAIKHILP 372
           +L+ ++ ILP
Sbjct: 345 DLKKLEEILP 354

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  181 bits (460), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 122/371 (32%), Positives = 184/371 (49%), Gaps = 25/371 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY +LG+  +A + ++K+AYR  AL YHPDK   E    E+  KFK+I+ AY+ILSD QK
Sbjct: 7   LYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSE----EAADKFKQITGAYEILSDSQK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNED---FMNFFRYGAGRYGQYEDAEQKTSQKTK 121
           R  YD +G         G        G      F  FF  G         +  +  QK +
Sbjct: 63  REMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGA-------SRPRGPQKGR 115

Query: 122 DFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKER 181
           D    +  + + LY G+  +  L + VLC +CEG G +  +      KC  C+G+G K  
Sbjct: 116 DIRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRGGKAGSVK----KCTSCNGQGVKFV 171

Query: 182 VSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHA 241
              + P  I R +  C+ C+G+G V+    +D CK C GK +  E  IL + +  G +H 
Sbjct: 172 TRHMGP-MIQRFQTTCEVCNGEGDVIPA--ADRCKDCDGKKIASERKILEVNIQPGMKHG 228

Query: 242 DTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLV 301
             I   G+AD + G+  GD+VF ++E   P     R G +LH    I L  A+ G    +
Sbjct: 229 QKIVFQGEADQQPGQIPGDVVFVVNEQEHP--RFVRNGDNLHYEAEIDLLTAIAGGQFAL 286

Query: 302 ARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEK 361
                D  L+I I  G+V+ PG       +G PI     +GDL +K N++FPK ++ +E+
Sbjct: 287 EHVSGD-WLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGSYGDLLIKFNVKFPKSHFADEE 345

Query: 362 SELEAIKHILP 372
           + L+ ++ ILP
Sbjct: 346 A-LKKLEAILP 355

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  181 bits (460), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 124/370 (33%), Positives = 183/370 (49%), Gaps = 23/370 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
            Y +LG+   AT+ E+K+AYR  AL YHPDK   E    E+  KFKE S+AY+ILSD +K
Sbjct: 7   FYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSE----EAAEKFKEASSAYEILSDSEK 62

Query: 65  RSEYDHYGR--FDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKD 122
           R  YD +G           G     +  G++ F  FF    G          +  Q+ KD
Sbjct: 63  RDVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGGA------QRPRGPQRGKD 116

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182
               +  S ++LY G+T +  L + +LC  CEG G +K A      KC  C+G+G K   
Sbjct: 117 IKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVK----KCSSCNGQGIKFVT 172

Query: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242
            ++ P  I R +  CD C G G +V  DP D CK C+GK V  E  IL ++V  G +   
Sbjct: 173 RQMGP-MIQRFQTECDVCHGTGDIV--DPKDRCKSCNGKKVENERKILEVHVEPGMKDGQ 229

Query: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302
            I   G+AD       GD+VF + E   P    +R G DL     I L  A+ G    + 
Sbjct: 230 RIVFKGEADQAPDVIPGDVVFLVSE--RPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALE 287

Query: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKS 362
               D  L++ I  G+V+ PG       +G P+     +G+L +K  ++FP++++  E++
Sbjct: 288 HVSGD-WLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGGYGNLIIKFTVKFPENHFTAEEN 346

Query: 363 ELEAIKHILP 372
            L+ ++ ILP
Sbjct: 347 -LKKLEEILP 355

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  179 bits (455), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 183/370 (49%), Gaps = 22/370 (5%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
            Y +LG+  +A+  E+K+AYR  AL YHPDK   E    E+  KFKE SAAY++LSD++K
Sbjct: 7   FYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSE----EAAEKFKEASAAYEVLSDDEK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNED--FMNFFRYGAGRYGQYEDAEQKTSQKTKD 122
           R  YD +G       P G        G  D  F  FF               +  Q+ +D
Sbjct: 63  REMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAG-----AGAGRPRGPQRGRD 117

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182
               L  + ++LY G+T +  L + +LC  CEG G +K A      KC  C+G+G K   
Sbjct: 118 IKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVK----KCSSCNGQGVKFVT 173

Query: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242
            ++ P  + R +  C+ C G G ++  DP D CK C+ K V  E  IL +++  G +   
Sbjct: 174 RQMGP-MLQRFQAECEVCHGTGDII--DPKDRCKTCNAKKVTNERKILEVHIEPGMKDGQ 230

Query: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302
            +   G+AD       GD++F + +   P    +R G DL     I L  A+ G      
Sbjct: 231 KVVFKGEADQAPDIIPGDVIFVVSQ--KPHEHFQRAGDDLVYEAEIDLLTAIAG-GEFAI 287

Query: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKS 362
           +      L++ I  G+V+ PG     +++G PI     +G+L VK NI+FP +++ +E+S
Sbjct: 288 KHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKYGGYGNLIVKFNIKFPPNHFTDEES 347

Query: 363 ELEAIKHILP 372
            L+ ++ ILP
Sbjct: 348 -LKKLEEILP 356

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  178 bits (452), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 121/371 (32%), Positives = 178/371 (47%), Gaps = 25/371 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
            Y +LG+  +A + ++K+AYR  AL +HPDK   E    E+  KFKE++ AY+ILSD QK
Sbjct: 7   FYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSE----EAADKFKELTVAYEILSDSQK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNED---FMNFFRYGAGRYGQYEDAEQKTSQKTK 121
           R  YD  G         G        G      F  FF  G  +         +  QK +
Sbjct: 63  RDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQ-------RPRGPQKGR 115

Query: 122 DFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKER 181
           D    +  S ++LY G+T +  L + +LC  CEG G +  A      KC  C+G+G K  
Sbjct: 116 DIKHEMSASLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVK----KCSSCNGQGIKFI 171

Query: 182 VSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHA 241
             ++ P  I R +  CD C G G ++  DP D CK C+GK +  E  IL +++  G +  
Sbjct: 172 TRQMGP-MIQRFQAECDVCSGTGDII--DPKDRCKSCNGKKIDNERKILEVHIEPGMKDG 228

Query: 242 DTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLV 301
             I   G+AD   G   GD+VF I +   P    ERKG DL     + L  A+ G     
Sbjct: 229 QKIVFQGEADQAPGIIPGDVVFVISQ--RPHKHFERKGDDLLYQAEVDLLSAIAG-GEFA 285

Query: 302 ARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEK 361
                   L+++I  G+V+ PG       +G PI     +G+L V   I FP +++ +E+
Sbjct: 286 IEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGGYGNLIVTFKINFPTNHFADEE 345

Query: 362 SELEAIKHILP 372
           S L+ ++ ILP
Sbjct: 346 S-LKKLEEILP 355

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  176 bits (445), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 125/370 (33%), Positives = 184/370 (49%), Gaps = 23/370 (6%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY ++G+   A + ++K+AYR  AL YHPDK   E    E+  KFKEIS+AY+ILSD QK
Sbjct: 7   LYDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTE----EAAEKFKEISSAYEILSDSQK 62

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNED--FMNFFRYGAGRYGQYEDAEQKTSQKTKD 122
           R  YD +G         G        G  D  F  FF    G       +  +  QK +D
Sbjct: 63  REMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGG------SSRPRGPQKGRD 116

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182
               +  + ++LY G+T +  L + +LC  CEG G +  A      KC  C+G+GFK   
Sbjct: 117 IRHEISATLEELYKGRTAKLALNKQILCKSCEGRGGKAGAVK----KCSSCNGQGFKFIT 172

Query: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242
            ++ P  I R +  CD C+G G ++  D  D CK C+GK +  E  IL +++  G +   
Sbjct: 173 RQMGP-MIQRFQAECDACNGTGDII--DAKDRCKACNGKKIANERKILEVHIEPGMKDGQ 229

Query: 243 TIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVA 302
            I   G+AD       GD+VF + E   P     RKG DL+    + L  A+ G    V 
Sbjct: 230 KIVFQGEADQAPDVVPGDVVFVVSE--RPHERFNRKGDDLYYEAEVDLLTAIAGGEFAVQ 287

Query: 303 RTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKS 362
               D  L++ I  G+V+ PG       +G P+     FG+L VK  I+FP +++ +E S
Sbjct: 288 HVSGD-WLKVEIVPGEVIAPGATKIIEGKGMPVQKYGGFGNLIVKFKIKFPPNHFADEAS 346

Query: 363 ELEAIKHILP 372
            L+ +++ILP
Sbjct: 347 -LKQLENILP 355

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  172 bits (435), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 127/391 (32%), Positives = 186/391 (47%), Gaps = 23/391 (5%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY VLG+   A + E+K+AYR  AL YHPDK   E    E   KFKE+SAAY+ILSD +K
Sbjct: 7   LYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTE----EGAEKFKEVSAAYEILSDSEK 62

Query: 65  RSEYDH---YGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTK 121
           R  YD     G    G    G F      G++ F  FF               +  Q+ +
Sbjct: 63  REIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAG-----AGAGRPRGPQRGR 117

Query: 122 DFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKER 181
           D    +  + ++LY G+T +  L + +LC  CEG G +K A      KC  C+G+G K  
Sbjct: 118 DIKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVK----KCSSCNGQGVKFV 173

Query: 182 VSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHA 241
             ++ P  I R +  CD C G G ++  DP D CK C+ K V  E  IL +++  G +  
Sbjct: 174 TRQMGP-MIQRFQAECDVCSGTGDII--DPKDRCKTCNAKKVTNERKILEVHIEPGMKDG 230

Query: 242 DTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLV 301
             I   G+AD       GD++F + +   P    +R G DL     I L  A+ G    +
Sbjct: 231 QNIVFKGEADQAPDVIPGDVIFVVAQ--KPHKHFQRSGDDLVYEAEIDLLTAIAGGEFAL 288

Query: 302 ARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEK 361
                D  L+++I  G+V+ PG+      +G PI      G+L V   ++FP+ ++ +E 
Sbjct: 289 EHVSGD-WLKVSILPGEVISPGSKKVIEGKGMPIPKYGGHGNLIVHFTVKFPQKHFADED 347

Query: 362 SELEAIKHILPGLKNSSNSHQGDGDDPANTE 392
           S L+ ++ ILP  K  S       DD   +E
Sbjct: 348 S-LKKLEEILPPRKKISIPANATVDDCVLSE 377

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  169 bits (427), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 118/369 (31%), Positives = 182/369 (49%), Gaps = 23/369 (6%)

Query: 6   YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
           Y +LG+  +ATE E+K+AYR  AL YHPDK    +  AE+  KFKE+S+AY++LSD +KR
Sbjct: 8   YDLLGVSVSATEIEIKKAYRKSALKYHPDK----NPSAEAAEKFKEVSSAYEVLSDSEKR 63

Query: 66  SEYDHYGRFDEGSFPFGDFDDDYKRGNED--FMNFFRYGAGRYGQYEDAEQKTSQKTKDF 123
             YD +G         G        G  D  F  FF               +  Q+ +D 
Sbjct: 64  QVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGG------APGGGRPRGPQRGRDI 117

Query: 124 VVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVS 183
              + ++ ++LY G+T +  L + +LC  C G G ++ A      KC  C+G+G+K    
Sbjct: 118 KHEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEGAVK----KCSSCNGQGYKFVTR 173

Query: 184 RISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADT 243
           ++ P  I R +  C+ C G G ++  DP D CK C+GK V  E  IL ++V  G +    
Sbjct: 174 QMGP-MIQRFQTECEACAGTGDII--DPKDRCKSCNGKKVANERKILEVHVDPGMKDGQK 230

Query: 244 IRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVAR 303
           I   G+AD       GD++F + E   P    +R G DL     I L  A+ G    +  
Sbjct: 231 IVFKGEADQAPDVIPGDVIFVVSE--KPHKNFQRVGDDLVYEAEIDLLTAVAGGEFSLEH 288

Query: 304 TFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSE 363
              D  L++ I  G+V+ PG       +G PI     +G+L V   I FP +++ ++++ 
Sbjct: 289 VSGD-WLKVAIVPGEVISPGMRKVVEGKGMPIAKFGGYGNLLVTFKINFPPNHFTSDEN- 346

Query: 364 LEAIKHILP 372
           L+ ++ ILP
Sbjct: 347 LKKLEEILP 355

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  160 bits (406), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 194/411 (47%), Gaps = 48/411 (11%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           M  DLY  LG+ +NA+ QE+K+AYR  AL +HPDK     Q   S+ KF++I  AY+IL 
Sbjct: 5   MNNDLYDTLGVAANASRQEIKKAYRLKALKHHPDKNGHSEQ---SKLKFQQICKAYEILG 61

Query: 61  DEQKRSEYDHYGRFDEGSF---------PFGDFDDDY-----------KRGNEDFMNFFR 100
           D++KR  YD +G  DE  +         P G    D                 + M+FF 
Sbjct: 62  DDKKREMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMDFF- 120

Query: 101 YGAGRYGQYEDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRK 160
            G+ R  + + + +   Q+  D    LK + +++Y GK  +  LKR  LC  C+G G +K
Sbjct: 121 -GSSRGFRAQGSRRSAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEGSKK 179

Query: 161 RAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHG 220
             +      C  C G+G + +  R  P  +      C  C G GT+V   PSD C  CHG
Sbjct: 180 ATS------CYACRGKGMQTQTKRQGP-IMQTWSSTCGTCGGSGTIVK--PSDICNGCHG 230

Query: 221 KCVIVENSILTLYVPRGHRHADTIRIDGQAD----MEAGKE---TGDLVFEIDEITDPDA 273
           +  + E  I  + V +G  +  T+ +  +AD     + G E    GD++  ++++  P  
Sbjct: 231 QGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIILEQL--PHR 288

Query: 274 ELERKGTD---LHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTN 330
            L+R G D   L     + L  +L G T  V      ++L+I +  G++L+PG      +
Sbjct: 289 SLKR-GHDSSLLLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGELLKPGAIKCVQS 347

Query: 331 EGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSH 381
            G P + G  +GDL++K  + FP +   +    ++A     P ++ S+ + 
Sbjct: 348 MGMPKSKGG-YGDLFIKFKVIFPDNLKPDTIQTMQAALDKEPSMQTSATTQ 397

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  158 bits (399), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 113/413 (27%), Positives = 190/413 (46%), Gaps = 43/413 (10%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
           +LY +LG+ ++A+ Q++K+AYR  AL +HPDK        ES+ KF++I  AY+IL DE+
Sbjct: 8   ELYDILGVSASASRQDIKKAYRVNALKHHPDK---NGHSEESKLKFQQICKAYEILKDER 64

Query: 64  KRSEYDHYGRFDEGSF-------------PFGDFDDDYKRGNEDFMNFFRYGAGRYGQYE 110
           KR  YD +G  DE  +               GD    +  G     +FF      +G+ +
Sbjct: 65  KREMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSFFGKRQ 124

Query: 111 DAEQKTSQKT----KDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCM 166
            A    S++      D    LK + +++Y GK  +  LKR  LC KC+G G  K +    
Sbjct: 125 GAHTAPSRRELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGGLKAS---- 180

Query: 167 PMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVE 226
             +C  C GRG +    R  P  +      C +C G+G+ + +   D C+ C+G+  I E
Sbjct: 181 --QCYTCGGRGIRTETKRHGP-MVQTWSSTCSDCAGRGSFMKQ--KDICRDCNGQGCIRE 235

Query: 227 NSILTLYVPRGHRHADTIRIDGQADMEAGKET-------GDLVFEIDEITDPDAELERKG 279
             I  + V +G  +   + + G+AD   G E        GD++  ++++        R  
Sbjct: 236 RRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQLPHKAFWRHRDA 295

Query: 280 TDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGS 339
           + +     + L  +L G    V      +LL+I +  G++L+PG        G P  +G 
Sbjct: 296 SLVLDHCKVDLKTSLCGGPVWVDSHPSGKLLKIDVLPGEILKPGAIKCVEGMGMP-KSGG 354

Query: 340 RFGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTE 392
           RFG+LY++ ++ FP      E  + E ++ +   L     ++ G G+     E
Sbjct: 355 RFGNLYIRFDVAFP------ESLKPETVEALRAALGQEPGANSGAGEPAVAVE 401

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score =  156 bits (394), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 126/415 (30%), Positives = 185/415 (44%), Gaps = 75/415 (18%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           M  +LY +L I SNA  +++K+AYR LAL YHPDK    +   ES+  F++IS AY++L 
Sbjct: 3   MSSELYDILNISSNADAKDIKKAYRVLALKYHPDK---NNHSEESKVMFQKISEAYEVLI 59

Query: 61  DEQKRSEYDHYGRFDEG-----------------------SFPFGD----FDDDYKRGNE 93
           D +KR  YD YG  DE                        S PFG+    F  D      
Sbjct: 60  DVEKRKLYDQYGTVDESVIEQMKERKRKSEFMQQRQGMYPSDPFGNVNPLFGSDLAASAG 119

Query: 94  D-FMNFF---RYGAGRYG--------------QYEDAEQKTSQKTKDFVVPLKLSTKQLY 135
           D F  FF      + R+                +E+      ++  D    L+ S K LY
Sbjct: 120 DLFAQFFGNSNKNSSRFNPFGNMKPNFSNFNNTFENTASVELERGPDIKHTLRCSLKDLY 179

Query: 136 LGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERV 195
            GK  + +L R  LC  C G G  K++      KC  C+G G   +  R+ P  I     
Sbjct: 180 YGKKTKLRLDRTRLCVLCMGQGSMKKS------KCFTCNGLGSLTQTRRMGP-MIQTFSQ 232

Query: 196 PCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQAD---- 251
            C +C G G  V R  SD C+ C G   + E  I  + +  G  +   I + G+AD    
Sbjct: 233 SCPDCQGSGMFVKR--SDTCQSCSGNGYVEERKIFDVEIQPGMVNGQVIILPGEADEVVN 290

Query: 252 MEAGKE---TGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDR 308
              GK+    GD+V  I+++ D + E+      L  + +++L++AL G T  ++      
Sbjct: 291 TSFGKQKVIAGDIVLTINQLKDNNFEVINDCDLLLDNFSVNLSKALCGGTIFISNHPSGN 350

Query: 309 LLRITIPSGKVLRPGNYLKFTNEGWP----------INNGSRFGDLYVKVNIEFP 353
           L++I I  G++L PG      N G P          I N S+ G+LYVK +I+FP
Sbjct: 351 LIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSIINISK-GNLYVKFDIKFP 404

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  147 bits (372), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 119/411 (28%), Positives = 190/411 (46%), Gaps = 45/411 (10%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY VL +   A+  E+++AYR LAL +HPDK    +   ES++KF E++ AY+IL DE+K
Sbjct: 7   LYDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSKFLEVNEAYEILIDEKK 63

Query: 65  RSEYDHYGRFDEGSFPFGDFDDD-----------------YKRGNEDFMNFF-RYGAGRY 106
           RS YD YG  DE +       +D                      + F +FF +  +  +
Sbjct: 64  RSLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMSSPSF 123

Query: 107 GQYEDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCM 166
           G  +   +K+     D    LK +   LY GK  +  L R  +C  C+G G  K      
Sbjct: 124 GGKK--TKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRGSMKVRT--- 178

Query: 167 PMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVE 226
              C  C GRG + R  ++ P   +  +  C +C+G GT  ++D SD C+ C G+  I E
Sbjct: 179 ---CKACRGRGQQSRSRQMGPMMQTWTQT-CSDCNGMGT-FTKD-SDVCRDCEGEGCIRE 232

Query: 227 NSILTLYVPRGHRHADTIRIDGQAD----MEAGKET---GDLVFEIDEITDPDAE-LERK 278
             I  + V  G      I + G+AD       G ET   GD++  I +I DP  + + R 
Sbjct: 233 RKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKDPKFQRVNRN 292

Query: 279 GTDLHC-SITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINN 337
           G DL   +  I L  +L G    +    + +L+ +TI  G++++P ++    N G P   
Sbjct: 293 GCDLMVRNCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNHFKSIENLGMPRYE 352

Query: 338 GSR----FGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGD 384
             R    +G+LY++  +EFP+       ++L+ +    P +K    +   D
Sbjct: 353 EKRAPEGYGNLYIQFQVEFPETLASETVTKLKQVLDEDPNVKKQVTAEDKD 403

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  144 bits (362), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 111/390 (28%), Positives = 170/390 (43%), Gaps = 41/390 (10%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
           +LY  L I  +AT QE+K+AYR  AL  HPDK    +   +S+ KF+EI  AY+IL D +
Sbjct: 8   ELYDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKRKFQEICKAYEILGDAK 64

Query: 64  KRSEYDHYGRFDEGSFPFGDFDDDY-----KRGNEDFMNFFRYGAGRYGQY--------- 109
           K+  YD YG  DE        +  Y         + F  FF  G+               
Sbjct: 65  KKLLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFNDDTMFF 124

Query: 110 --EDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMP 167
             +   Q+   +  D    L+ S ++LY GK  + +L R  LC  C+G G    +A    
Sbjct: 125 TGKKNSQRRVSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTCKGNGGTSSSA---- 180

Query: 168 MKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVEN 227
             C  C+G+GF  +  R  P  +      C +C G GT V R   D C +C G+  I E 
Sbjct: 181 --CRACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSGTFVRR--KDVCSECKGQGCIKER 235

Query: 228 SILTLYVPRGHRHADTIRIDGQAD----MEAGKET---GDLVFEIDEITDPDAELERKGT 280
            I  + V  G  H   I +  +AD       GKE    GD++  + ++  P  ++     
Sbjct: 236 KIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQQVKHPLFQIHNDTD 295

Query: 281 DLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSR 340
            +     + L  +L G   L+        L+I +  G++L+PG      + G P      
Sbjct: 296 LVMNDCHVDLKTSLCGGEVLIENHPCGSALKIEVLPGEILKPGCVKCVESMGMPHPQSQG 355

Query: 341 FGDLYVKVNIEFPKDNWLNEKSELEAIKHI 370
           FG+LY++  ++FP      +K +LE I  +
Sbjct: 356 FGNLYIRFQVDFP------DKLQLETINKV 379

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  140 bits (354), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 175/364 (48%), Gaps = 30/364 (8%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
             +D Y++LG+   A+++++K AYR L+  YHPDK   +    ++  +F E+  AY+ LS
Sbjct: 18  FAQDYYAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGDE---DAHNRFIEVGEAYEALS 74

Query: 61  DEQKRSEYDHYG--------RFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAG-RYGQYED 111
           D +KR  YD +G            G    G F D +    + F   F  GAG R+  +  
Sbjct: 75  DPEKRKIYDQFGAEALKNGGDRAGGGGAGGGFHDPF----DIFDQMFGGGAGSRF--HGG 128

Query: 112 AEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCG 171
             Q+  Q+ +   V  +L+ K+ Y G + +F +  N  C  C+G G +         KCG
Sbjct: 129 GGQRRKQRGQSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSGSQDGKVE----KCG 184

Query: 172 ICDGRGFKERVSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSIL 230
            C GRG   +V  I  GFI+++ +  C +C+G+G V+     + CK CHG  V+ +N   
Sbjct: 185 QCGGRGMVVQV--IRQGFITQQIQQMCQKCEGRGEVIK----NKCKTCHGSKVVKKNKSF 238

Query: 231 TLYVPRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISL 290
            + VP G        I G+A+     E GD+  ++ E    +    R+G DL  +  +SL
Sbjct: 239 HVDVPAGAPRDFVAVIRGEAEKSPDTEPGDIYVKVVESPVQNMGYRRRGPDLFRTEVLSL 298

Query: 291 AEALT-GFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVN 349
            EAL  G+ R +      + + ++   G  ++ G        G P+ +G+++GDLYV   
Sbjct: 299 TEALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLESGTKYGDLYVDYV 358

Query: 350 IEFP 353
           I  P
Sbjct: 359 IVMP 362

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score =  142 bits (358), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 122/429 (28%), Positives = 183/429 (42%), Gaps = 74/429 (17%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY +L + + ATEQE+K+AYR  AL +HPDK    +  AES   F++IS AY+ LS+  K
Sbjct: 7   LYDILEVNTTATEQEIKKAYRKKALKHHPDK---NNHSAESIKLFQDISHAYETLSNSNK 63

Query: 65  RSEYDHYGRFDEG-------------------SFPF-----GDFDDDYKRG--------- 91
           R  YD YG  DEG                   S PF     GD    +  G         
Sbjct: 64  RELYDQYGTVDEGEISEIIAKQNMGNTGSNGNSHPFSAHTAGDLFAQFFGGRGSSGTGAS 123

Query: 92  ---------NEDFMNFFR-YGAGRYGQYEDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQ 141
                    N  F +F   +       +ED               LK +   L+ GK  +
Sbjct: 124 GFGFMRGMVNGPFQSFSHDFNMNSMADFEDDGSHEMASGPGIRHNLKCNLYDLFHGKRAK 183

Query: 142 FKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECD 201
             L R  LC +C+G G +K        +C  C G G      R+ P  +   +  C EC 
Sbjct: 184 LALNRTRLCQRCQGYGGKK------ATQCRGCQGTGLFTTTKRMGP-MVQTWQTTCKECS 236

Query: 202 GKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQAD----MEAGKE 257
           G G  +     D C +C G   I E     + V  G R+ + I + G+AD     E GKE
Sbjct: 237 GTGKYIR--SKDACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPGEADEVINTEYGKE 294

Query: 258 ---TGDLVFEIDEITDPDAELERK----GTDLHC-SITISLAEALTGFTRLVARTFDDRL 309
               GD++  I    + ++ +  K      DL   +  + L  +L G T ++        
Sbjct: 295 RVIPGDVIITIQLTRNEESNMRYKYLVHDHDLILDNFEVDLKTSLCGGTIIIEDHPSGNP 354

Query: 310 LRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFP---KDNWLNEKSEL-- 364
            +I + SG++L+PG      N+G P+++   FG+LY++  ++FP   K + +N+ SE+  
Sbjct: 355 FKIEVLSGELLKPGCIKCVENKGMPVDSNGNFGNLYIRFRVKFPEQLKSDTINKLSEILV 414

Query: 365 --EAIKHIL 371
             E I  IL
Sbjct: 415 QDENISSIL 423

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score =  140 bits (354), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 121/431 (28%), Positives = 196/431 (45%), Gaps = 62/431 (14%)

Query: 1   MGKD--LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDI 58
           M KD  LY+ L I   A++ ++K+AYR  AL YHPDK ++ES+  ES+ KF++IS AY I
Sbjct: 1   MVKDPRLYNALNIPPTASQSDIKKAYRVQALRYHPDK-NNESE--ESKKKFQDISEAYSI 57

Query: 59  LSDEQKRSEYDHYGRFD---------EGSFPFGD-------------FD-DDYKRGNEDF 95
           L DE +R  YD YG  +           + PF D             FD  ++  G  + 
Sbjct: 58  LRDENQRKMYDKYGTVNPTEIQQQNQRTNVPFTDPFGMSAADLFSQFFDTQNHNSGQSNS 117

Query: 96  MNFFRY---------------GAGRYGQYEDAEQKTSQKTKDFVVPLKLSTKQLYLGKTF 140
              F +                 G +G + + + +  QK  D    LK + K LY GK  
Sbjct: 118 SPPFGFPFNSSRNGNGNNNRAADGVFGDFFNTKSRPLQKGPDINHNLKCTIKDLYRGKRS 177

Query: 141 QFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDEC 200
           + +L+R+ LCS C+G G  KR+       C  C G G     +R+ P   +     C+ C
Sbjct: 178 KLRLERSKLCSICKGDGGVKRSM------CNQCHGDGNITETTRLGPMLQTFTHT-CNIC 230

Query: 201 DGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQADMEAGKE--- 257
           +G G V+     + C+ C+G     E  I  + +  G +    I  + + D    K    
Sbjct: 231 NGNGWVIIS--QETCQGCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVNKRRVI 288

Query: 258 TGDLVFEIDEITDPDAELERKGTDL-HCSITISLAEALTGFTRLVARTFDDRLLRITIPS 316
            G+++  I+EI D   +    G DL + +  I L  +L G    +    +++L+++ I  
Sbjct: 289 PGNVIIHINEIEDNKFKRVNDGQDLYYWNYEIDLFTSLCGGVIYIKGHPNNKLIKVDILP 348

Query: 317 GKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKN 376
           G+++  G+     + G P N G+ +G LY++  +++P      EK  +E+IK I   L  
Sbjct: 349 GEIIESGSVKGVESLGMPKNKGNEYGILYIQFQVKYP------EKLNMESIKAIEKILLK 402

Query: 377 SSNSHQGDGDD 387
             N  Q   +D
Sbjct: 403 DENVKQMQKND 413

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  137 bits (344), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 106/360 (29%), Positives = 173/360 (48%), Gaps = 19/360 (5%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           + +D Y++LG+  +A+++E+K +YR L+  +HPDK   +    E+  KF EI  AY++LS
Sbjct: 18  LAQDYYAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGDE---EAHHKFIEIGEAYEVLS 74

Query: 61  DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKT 120
           D +KR  +D YG     +   G         N+ F + F     R G          Q+ 
Sbjct: 75  DPEKRKIFDQYGADALKNGGPGGPGGGGGGFNDPF-DIFEQMFNRGGGGGGGGFGRMQRP 133

Query: 121 K--DFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGF 178
           +  +  V  +LS K+ Y G T +F L  N +C  C+G G    +A     KC  C GRG 
Sbjct: 134 RGHNLKVREQLSLKEYYTGATLEFTLALNDICDHCDGTG----SADGKVAKCSDCQGRGV 189

Query: 179 KERVSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRG 237
             +V R+  G ++++ +  C  C GKG+V+     ++CK CHG  V+ +     + VP G
Sbjct: 190 VIQVIRM--GMMTQQIQQMCGRCGGKGSVIK----NHCKTCHGSKVVKKQKPFHVEVPPG 243

Query: 238 HRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTG- 296
                T    G++D  A  + GD+  E +E T  +    R+G  L+ +  +S  EAL G 
Sbjct: 244 AARHYTETRSGESDKGADFDAGDVFIEFNEKTTNNLGYRRRGPHLYRTEVLSAREALKGD 303

Query: 297 FTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSR-FGDLYVKVNIEFPKD 355
           + R V    + + ++I      V+  G   +    G P  NG   FGDL+++  +  P +
Sbjct: 304 WQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGDLFIEYVVVMPHE 363

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score =  139 bits (350), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 119/424 (28%), Positives = 177/424 (41%), Gaps = 88/424 (20%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY  L + + A+  E+K+AYRN AL YHPDK    +   ES+ KF+EI  AY+ L D   
Sbjct: 7   LYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYETLKDNHL 63

Query: 65  RSEYDHYGRFDE--------------------------------GSFP-----------F 81
           RS YD YG  DE                                 SFP           F
Sbjct: 64  RSLYDQYGTTDEVLIQEQQAQTQSQRQRQQASVFSPSAGFGTGGMSFPDLSPGDLFAQFF 123

Query: 82  GDFDDDYKRGNEDFMNF---------FRYGAG-----------RYGQYEDAEQKTSQKTK 121
                    G++D  NF         F +G+G           RY    + E +   +  
Sbjct: 124 NSSASASSNGSKDNFNFSFDGSTTPNFPFGSGGGMNNLYSPPSRYN--SEGEGRHLNRGP 181

Query: 122 DFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKER 181
           D    LK + K+LY+GKT +  L R  +C  C+G G  K+ A      C  C G+G + +
Sbjct: 182 DIKHNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLKKYA------CKTCKGQGVQTQ 235

Query: 182 VSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHA 241
            +R+ P  +      C +C G G  V  +  D C++C G   + +  IL + V  G  H 
Sbjct: 236 TNRMGP-LVQSWSQTCADCGGAGIFV--ESKDICQQCQGLGFVKQRKILQVAVQPGSCHN 292

Query: 242 DTIRIDGQAD-----MEAGKET---GDLVFEIDEITDPDAELERKGTDLHCSITISLAEA 293
             I + G+ D        G E    GD+V  I  + DP  ++      ++    + L  +
Sbjct: 293 QLIVLTGEGDEVISSKGGGHEKIIPGDVVITILRLKDPRFQIVDDYNLIYKKCKVDLMTS 352

Query: 294 LTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP-INNGSR--FGDLYVKVNI 350
           L G    +      +L+++ I  G+VL+PG +    N G P   NG R  FG +YVK  +
Sbjct: 353 LCGGVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHMYVKFEV 412

Query: 351 EFPK 354
            +P+
Sbjct: 413 TYPR 416

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  137 bits (346), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 110/364 (30%), Positives = 168/364 (46%), Gaps = 41/364 (11%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY VLG+ S+A++ E+K+AYR LAL YHPDK + + +  E+   F++IS AY +L D  +
Sbjct: 4   LYDVLGVASDASQSEIKKAYRKLALRYHPDKNNGDEKCHEA---FQKISHAYGVLGDVAQ 60

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRY---GQYEDAEQKTSQKTK 121
           R  YD  G  +E   P G    D       F +FF  G G Y           +   +  
Sbjct: 61  RQRYDQSGDENESLQPTGSNAADL------FSSFFN-GGGVYPSGSSGGPGPSRGPSRGP 113

Query: 122 DFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKER 181
           + +  LK + + LY GK  +  L+R   C +C  LG    AA+     C  C+G G   R
Sbjct: 114 NIIHELKCTLQDLYRGKVIKLALRRTAPCERC-SLG----AANV----CSSCNGSGNITR 164

Query: 182 VSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHA 241
           + R+ P         C+ C G+G +     S +C +C G   + E  +  ++V  G    
Sbjct: 165 IERVGP-LTQTWSSTCNACQGQGRM-----SVDCSQCGGAQYLNERVVFKVHVKPGMHDG 218

Query: 242 DTIRIDGQADM--------EAGKETGDLVFEIDEITDPD---AELERKGTDLHCSITISL 290
            TI +DG+AD             E+GD+V  I E+ D     + L ++       + + L
Sbjct: 219 QTIVLDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKRENLFVDQVKVDL 278

Query: 291 AEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNE-GWPINNGSRFGDLYVKVN 349
             ALTG   L+       L++I I  G+ L P N +K     G PI++  + GDLY++  
Sbjct: 279 TTALTGGNVLLEDHPSGNLMKINILPGEFL-PENCIKCVEGLGMPIDDTGQRGDLYIRFC 337

Query: 350 IEFP 353
              P
Sbjct: 338 THSP 341

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  134 bits (337), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 100/363 (27%), Positives = 169/363 (46%), Gaps = 37/363 (10%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           + +D Y++LG+  +A+++E+K AYR L+  YHPDK   +    E+  KF E+  AYDIL 
Sbjct: 17  LSQDYYAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGDE---EAHHKFIEVGEAYDILG 73

Query: 61  DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGN--------EDFMNFFRYGAGRYGQYEDA 112
           D +KR  YD +G             D +K G          D  + F    GR G     
Sbjct: 74  DPEKRKTYDVHGA------------DAFKNGGQGQRGGGFHDPFDMFEQMFGRQG----G 117

Query: 113 EQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGI 172
             + +Q+++++ V  ++S K+ Y G   +F++  N +C  C G G    +A      C  
Sbjct: 118 GFRQTQRSQNYQVRNQVSLKEFYSGGEVEFEIPLNDICDSCHGSG----SADGKVKVCPA 173

Query: 173 CDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTL 232
           C GRG   +V R+ P  I+++        G       +P   CK C G  V+ +N     
Sbjct: 174 CQGRGVVVQVIRMGP--ITQQIQQQCGQCGGKGKTIENP---CKTCKGHKVVRKNKPFHF 228

Query: 233 YVPRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAE 292
             P G       +  G++D     E+GD++ E +E    +    R+G +L+ +  I+  E
Sbjct: 229 EFPGGIPRNHIDKKSGESDKSPDMESGDIIIEYNESEKENLGYRRRGNNLYRTEIITANE 288

Query: 293 ALT-GFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIE 351
           A+  G+TR +    + + ++++ P G ++  G+  +    G PI     FGDLY+   + 
Sbjct: 289 AINGGWTREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMGSKNFGDLYIDYVVL 348

Query: 352 FPK 354
            PK
Sbjct: 349 VPK 351

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score =  132 bits (333), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 113/369 (30%), Positives = 175/369 (47%), Gaps = 41/369 (11%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSD 61
            +D Y++L I  +ATE+E+K AYR L+  YHPDK    +   E+  KF E+  AYD+LSD
Sbjct: 21  AQDYYAILEIDKDATEKEIKSAYRQLSKKYHPDK---NAGSEEAHQKFIEVGEAYDVLSD 77

Query: 62  EQKRSEYDHYG------------RFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQY 109
            +K+  YD +G                G+  F D  D ++R          +  G  G  
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFER---------MFQGGHGGPG 128

Query: 110 EDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMK 169
               Q+  Q+     V  KLS KQ Y G + +F L  N  C  C G G    +A     +
Sbjct: 129 GGFGQRQRQRGPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSG----SADGKLAQ 184

Query: 170 CGICDGRGFKERVSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENS 228
           C  C GRG   +V R+  G ++++ +  C  C G G ++     + CK CHGK V  +N 
Sbjct: 185 CPDCQGRGVIIQVLRM--GIMTQQIQQMCGRCGGTGQII----KNECKTCHGKKVTKKNK 238

Query: 229 ILTLYVPRGH-RHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSIT 287
              + VP G  R+    R+ G+A+     + GDLV E  E    +    R+G +L+ +  
Sbjct: 239 FFHVDVPPGAPRNYMDTRV-GEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEV 297

Query: 288 ISLAEAL-TGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSR-FGDLY 345
           +S AEAL  G+ R +    +++ ++++ P+  V+  G        G P   GS+ +GDLY
Sbjct: 298 LSAAEALYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMP--KGSKGYGDLY 355

Query: 346 VKVNIEFPK 354
           +   +  PK
Sbjct: 356 IDYVVVMPK 364

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  134 bits (337), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 109/381 (28%), Positives = 174/381 (45%), Gaps = 44/381 (11%)

Query: 1   MGKD--LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDI 58
           M KD  LY VLG++   +  E+K++Y+  AL YHPDK         S+ +F++I+ AY +
Sbjct: 1   MVKDTRLYDVLGVQPGVSAAELKKSYKLAALRYHPDK---NGHSEASKQRFQQIADAYRV 57

Query: 59  LSDEQKRSEYDHYGRFDEGSFPFGDFDDDYKRG----NEDFMNFFRYGAGR-----YGQY 109
           L DE+ R  YD YG  DEG        +    G     + F +FF  G G      +G+ 
Sbjct: 58  LGDERLRKIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLGSFAIFGES 117

Query: 110 EDAEQKTSQKTK--DFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMP 167
             +  + S+ ++  D    L+ + ++LY GK  +  L R  LC+ C G G  + +     
Sbjct: 118 GASSARCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGGSRAST---- 173

Query: 168 MKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVEN 227
             C  C G+G   +  R     +      C  C G GT+V     D C  C G   + E 
Sbjct: 174 --CTACSGQGICSQTKR-QGSLVQTWSSTCRVCSGSGTIVK--DCDTCTSCGGAGYLRER 228

Query: 228 SILTLYVPRGHRHADTIRIDGQAD----MEAGKET---GDLVFEIDEITDPDAELERKG- 279
            +  + +  G R    +   G+AD       GKE    GDL   I+E T P    + +G 
Sbjct: 229 KVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEAT-PATRYQCRGD 287

Query: 280 -----TDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP 334
                T+LH    + L  +L G T  +      +L+++ I  G++L PG      + G P
Sbjct: 288 ANLLLTELH----VDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMP 343

Query: 335 -INNGSRFGDLYVKVNIEFPK 354
             ++ S++G L++K +++FPK
Sbjct: 344 HPDDPSQYGHLFIKFHVDFPK 364

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  132 bits (332), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 103/366 (28%), Positives = 169/366 (46%), Gaps = 29/366 (7%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSD 61
            +D Y +LG+  +A ++E+K AYR L+  YHPDK   +    E+  KF E+  AYD+LSD
Sbjct: 20  AQDYYKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGDE---EAHNKFIEVGEAYDVLSD 76

Query: 62  EQKRSEYDHYG--------RFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAE 113
            +KR+ YD YG                   F D +    E F   F              
Sbjct: 77  SEKRNIYDQYGADAIKNGGNGQRPGGGGSPFHDPF----EMFEKMFNGNPFGGAARGGPG 132

Query: 114 QKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGIC 173
            +   + ++ ++  ++S    Y G+ F++ L+ N  C KC G G +         +C  C
Sbjct: 133 GRGRPRGQNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTGSKDGKV----TRCPDC 188

Query: 174 DGRGFKERVSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTL 232
            GRG   +V  I  G ++++ +  CD C G G ++ ++P   C  CHG  V   +   T+
Sbjct: 189 QGRGVIVQV--IQMGIMTQQIQHVCDRCSGSGEII-KNP---CPHCHGHKVAKMDKEFTV 242

Query: 233 YVPRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAE 292
            +P G +        G+A+  A  + GDL+FE  E +  +    R+G  L+ +  +S+ E
Sbjct: 243 KLPNGAQRNYVDIKHGEAEKGADFDAGDLMFEFRENSMNNMGYRRRGDHLYRTEVLSVQE 302

Query: 293 ALTGFTRLVARTFD-DRLLRITIPSGKVLRPGNYLKFTNEGWPINN--GSRFGDLYVKVN 349
           AL G        FD D+ +++   + +V+  G        G PI N  G +FGDL++   
Sbjct: 303 ALKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLFIDYV 362

Query: 350 IEFPKD 355
           I  P++
Sbjct: 363 ILMPQE 368

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  130 bits (328), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/355 (28%), Positives = 154/355 (43%), Gaps = 19/355 (5%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           + +D Y++LG+   A+E+E+K AYR L+  YHPDK        E+   F E+  AYD+LS
Sbjct: 17  IAQDYYAILGVDKQASEKEIKSAYRQLSKKYHPDK---NPGNDEAHHHFIEVGEAYDVLS 73

Query: 61  DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKT 120
           D +KR  YD +     G+    +       G   F + F      +G       +   + 
Sbjct: 74  DPEKRQIYDRH-----GADALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMYNRARGKPRG 128

Query: 121 KDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKE 180
           ++  V   +S K  YLG  F+F L  N +C  C+G G            C  C G G   
Sbjct: 129 QNLQVNHDISLKTFYLGTEFEFTLNLNDICDACDGSGSEDGKTET----CPDCGGSGQIM 184

Query: 181 RVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRH 240
           +V R  P    R R PC  C G+G ++       CKKC G  V+ ++ + T  V  G   
Sbjct: 185 KVFRAGP-IEQRVRQPCSRCQGRGQLIKH----VCKKCKGVKVVQKSKVFTAKVEPGMER 239

Query: 241 ADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRL 300
                + GQ++     E GDL     E         R+G  L+ +  +S  EAL G    
Sbjct: 240 NHIHVMQGQSEKHPDIEPGDLYQYFRESEKDSMGYRRRGNTLYRTEILSFKEALQGGWER 299

Query: 301 VARTFD-DRLLRITIPSGKVLRPGNYLKFTNEGWPINNGS-RFGDLYVKVNIEFP 353
               FD ++ L ++ P G  ++ G      + G PI + + +FGDL +   I  P
Sbjct: 300 NIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFGDLIIDYVILLP 354

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  130 bits (326), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 103/367 (28%), Positives = 158/367 (43%), Gaps = 25/367 (6%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSD 61
           GKD Y +LGI   A+E+ +K AYR L+  YHPDK  ++    E+   F EI  AY++LSD
Sbjct: 27  GKDYYKILGIPKEASEKAIKSAYRQLSKKYHPDKNQNDE---EAHNHFIEIGEAYEVLSD 83

Query: 62  EQKRSEYDHYG-----------RFDEGSFPFGDFDDDYKRGNE-DFMNFFRYGAGRYGQY 109
            +KR  YD +G               G    G F D +   N+    N   +G       
Sbjct: 84  PEKRRTYDQFGSDAFQNGGQGQGGPGGPGGPGGFHDPFDLFNQMFGGNKGNFGGFGGFGG 143

Query: 110 EDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMK 169
                   +K +   V   LS ++ + G    F++     C  C+G G           K
Sbjct: 144 GGFADDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSGSEDGKVD----K 199

Query: 170 CGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSI 229
           C  C G GF  +V R+ P    +    C +C G G+ +     ++CKKCHG+ ++ ++  
Sbjct: 200 CKECGGNGFVVQVIRMGP-VTQQMHTQCPKCHGAGSTI----KNHCKKCHGQKLVTKSKE 254

Query: 230 LTLYVPRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITIS 289
           + + VP G        ++   D E   E GDL+ +  EI   +    R+G DL  +  + 
Sbjct: 255 INVKVPAGAPRDFLKIVENGGDKELNAEAGDLLVQFQEIAQNNLGYRRRGNDLFRTEALV 314

Query: 290 LAEALTGFTRLVARTFD-DRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKV 348
             +A+ G        FD  R ++I+   G  +      K    G PI    RFGDLY+  
Sbjct: 315 FKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPIQGSDRFGDLYIDY 374

Query: 349 NIEFPKD 355
            I  P++
Sbjct: 375 VIIVPQN 381

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  129 bits (325), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 110/357 (30%), Positives = 170/357 (47%), Gaps = 19/357 (5%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSD 61
            +D Y++L I  +A+E+E+K AYR L+  YHPDK    +   E+  KF EI  AY++LSD
Sbjct: 21  AQDYYAILDIGKDASEKEIKSAYRQLSKKYHPDK---NAGSDEAHHKFIEIGEAYEVLSD 77

Query: 62  EQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFR-YGAGRYGQYEDAEQKTSQKT 120
            +K+  YD +G     +   G         ++ F  F R +  G+ G      Q+  Q+ 
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGAGGPGGGGFHDPFDIFERMFQGGQGGPGGGFGQRQRQRG 137

Query: 121 KDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKE 180
               V   LS KQ Y G + +F L  N  C  C G G    +A     +C  C GRG   
Sbjct: 138 PTIKVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSG----SADGKLAQCPDCQGRGIIV 193

Query: 181 RVSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHR 239
           +V R+  G ++++ +  C  C G G V+     + CK CHGK V  +N    + VP G  
Sbjct: 194 QVVRM--GIMTQQIQQICGRCAGTGQVI----KNQCKTCHGKKVTKKNKFFHVDVPPGAP 247

Query: 240 HADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEAL-TGFT 298
                   G+A+     + GDLV E  E+   +    R+G +L+ +  +S AEAL  G+ 
Sbjct: 248 RNYMDTRAGEAEKGPDFDAGDLVIEFREMDTENMGYRRRGHNLYRTEVLSAAEALYGGWE 307

Query: 299 RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSR-FGDLYVKVNIEFPK 354
           R +    +++ ++++ P+  V+  G        G P   GSR  GDLY+   +  PK
Sbjct: 308 RTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMP--KGSRDHGDLYIDYVVVMPK 362

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score =  129 bits (324), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 110/364 (30%), Positives = 168/364 (46%), Gaps = 32/364 (8%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSD 61
            +D Y++L +  +A+E+E+K AYR L+  YHPDK    S   E+  KF E+  AYD+LSD
Sbjct: 21  AQDYYAILEVDKDASEKEIKSAYRQLSKKYHPDK---NSGSEEAHHKFIEVGEAYDVLSD 77

Query: 62  EQKRSEYDHYG----------RFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYED 111
            +K+  YD +G              G    G F D +    + F + F+   G  G    
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGGGGAGGPGGGGFHDPF----DIFEHMFQ--GGHGGPGGG 131

Query: 112 AEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCG 171
             Q+  Q+     V  KLS KQ Y G + +F L  N  C  C G G    +A     +C 
Sbjct: 132 FGQRQRQRGPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSG----SADGKLAQCP 187

Query: 172 ICDGRGFKERVSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSIL 230
            C GRG   +V R+  G ++++ +  C  C G G ++     + CK CHGK VI +N   
Sbjct: 188 DCQGRGVIIQVLRM--GIMTQQIQQMCGRCGGTGQII----KNQCKTCHGKKVIKKNKFF 241

Query: 231 TLYVPRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISL 290
            + VP G          G+A+     + GDLV E  E    +    R+G +L+ +  +S 
Sbjct: 242 HVDVPPGAPRNYLDTRAGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSA 301

Query: 291 AEALTGFTRLVARTFDD-RLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVN 349
            EAL G  +     FD+ + ++++ P+  V+  G        G P  +G   GDLY+   
Sbjct: 302 EEALYGGWQRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMP-KSGKGHGDLYIDYV 360

Query: 350 IEFP 353
           +  P
Sbjct: 361 VIMP 364

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score =  130 bits (327), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 115/437 (26%), Positives = 182/437 (41%), Gaps = 60/437 (13%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY +L ++ +A++  +K+A+   AL  HPDK    +   ES+ +F+EIS AY++LSD + 
Sbjct: 7   LYDLLNVECDASQVTIKKAFHAAALRCHPDK---NNHSEESKKQFQEISKAYEVLSDPKS 63

Query: 65  RSEYDHYGRFDEGSF----PFGDFDDDYKRGN----------EDFMNFFRY--------- 101
           R  YD YG  DE +     PFG+    Y  GN          + F  FF           
Sbjct: 64  REMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGTSAGDLFAQFFNSSGDAGPSFG 123

Query: 102 ------GAGRYGQYEDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEG 155
                 G G   Q   A     +   D    LK +   LY GK  +  L R  +CS C+G
Sbjct: 124 FGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRMRVCSSCDG 183

Query: 156 LGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNC 215
            G  + A+      C  C G+G   +  R+ P  +      C+ C G GT +    SD C
Sbjct: 184 KGGMRVAS------CRTCKGQGEVVKTRRVGP-MVQTMSSTCNSCHGTGTFIKD--SDLC 234

Query: 216 KKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQAD--MEAGK-----ETGDLVFEIDEI 268
             C G  V  E  I  + V  G  H   I + G+AD  +E        + GD+V  ID +
Sbjct: 235 FVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKVQPGDVVIVIDLV 294

Query: 269 TDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKF 328
            +   ++      +  +  + L   L G   ++      ++++++I   ++L+P  +   
Sbjct: 295 KNTQFQVVNDHDLVLKNCEVPLKTCLCGGEIMIEGHPSGKIIKLSIIPNELLKPSCFKTV 354

Query: 329 TNEGWP--INNGSR----------FGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKN 376
              G P  I N             +G+LYV+  ++FP+       ++L+ I    P +K 
Sbjct: 355 EGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFPERLEDTTITKLQEILEQDPNVKK 414

Query: 377 SSNSHQGDGDDPANTED 393
              S Q   DD     D
Sbjct: 415 EDESDQKRIDDAVTNSD 431

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score =  127 bits (318), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 100/362 (27%), Positives = 170/362 (46%), Gaps = 25/362 (6%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
             +D Y +L +  +AT+++++ AYR L+  YHPDK  ++    ++  KF E+  AY+ILS
Sbjct: 19  FAQDYYKILELDKDATDKDIRSAYRQLSKKYHPDKNPNDE---DAHHKFIEVGQAYEILS 75

Query: 61  DEQKRSEYDHYG-----RFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQK 115
           D +KR  YD +G       + G      F D +    + F   F  G G  G   +  Q+
Sbjct: 76  DPEKRQRYDQFGPEGVNGQNGGGPGGAGFHDPF----DIFEQMFGGGGGMGGHGGNPFQQ 131

Query: 116 TSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDG 175
             Q+ ++ V     S K  Y G   +F +  N +C  C G G     +     KC  C G
Sbjct: 132 QRQRGQNVVARESTSLKNYYNGYVLKFSINLNDICDHCHGSGSNDGKS----TKCPDCQG 187

Query: 176 RGFKERVSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYV 234
           RG   +V R+  G ++++ +  C +C GKG ++ ++P   CK CHG  V+ +     + +
Sbjct: 188 RGVTVQVIRM--GMMTQQIQQVCGKCGGKGQII-KNP---CKTCHGSKVVQKPKDFEIEL 241

Query: 235 PRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEAL 294
           P G          G AD     ++GD+  E  E    +    R+G  L+ +  ++  EAL
Sbjct: 242 PAGAPRKFVHAEHGAADKHPDYDSGDVYIEFTENDKDNMGYRRRGPHLYRTEVLNATEAL 301

Query: 295 T-GFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSR-FGDLYVKVNIEF 352
             G+ R +A     +++ I     K+++ G   +    G P+ NG + FGDL++   +  
Sbjct: 302 YGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDYVVVM 361

Query: 353 PK 354
           P+
Sbjct: 362 PE 363

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  126 bits (317), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 105/356 (29%), Positives = 164/356 (46%), Gaps = 17/356 (4%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSD 61
            +D Y++L I   A+E+E+K AYR L+  +HPDK    +   E+  KF E+  AYD+LSD
Sbjct: 21  AQDYYAILEIDKGASEKEIKSAYRQLSKKFHPDK---NAGSEEAHQKFIEVGEAYDVLSD 77

Query: 62  EQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFR-YGAGRYGQYEDAEQKTSQKT 120
            +K+  YD +G     +   G         ++ F  F R +  G  G      Q+  Q+ 
Sbjct: 78  PEKKKIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQRQRQRG 137

Query: 121 KDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKE 180
               V  KLS KQ Y G + +F L  N  C  C G G    +A     +C  C GRG   
Sbjct: 138 PMIKVQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSG----SADGKLAQCPDCQGRGVII 193

Query: 181 RVSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHR 239
           +V R+  G ++++ +  C  C G G V+     + CK CHG  V   N    + VP G  
Sbjct: 194 QVLRM--GIMTQQIQQMCGRCGGTGQVI----KNECKTCHGNKVTKRNKFFHVDVPPGAP 247

Query: 240 HADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEAL-TGFT 298
                   G+A+     + GDLV E  E    +    R+G +L+ +  +S+ EAL  G+ 
Sbjct: 248 RNYMDTRAGEAEKGPDFDAGDLVIEFKEKDSENMGYRRRGDNLYRTEVLSIEEALYGGWE 307

Query: 299 RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPK 354
           R +    +++ ++++ P+   +  G        G P   G  +GDLY+   +  PK
Sbjct: 308 RTIEFLDENKPVKLSRPAYVGVSNGEIEVMKGFGMP-KGGKGYGDLYIDYVVIMPK 362

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  124 bits (310), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 103/363 (28%), Positives = 166/363 (45%), Gaps = 24/363 (6%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSD 61
            +D Y +LGI  +AT++E+K AYR L+  +HPDK        ++  KF E+  AY++LSD
Sbjct: 19  AQDYYQILGIAKDATDKEIKSAYRQLSKKFHPDK---NPGNEDAHQKFIEVGEAYEVLSD 75

Query: 62  EQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTK 121
            QKR  +D +G   +     G           D  + F    G  G   +      QK +
Sbjct: 76  PQKRQTFDQFGA--DAVKNGGQGQPGGGAQFHDPFDIFEQMFGGQGGGGNPFGGQRQKPR 133

Query: 122 --DFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFK 179
             + +   ++S K  Y G    F L  N LC  C G G         P  C  C GRG  
Sbjct: 134 GPNIMAREEISLKDYYTGYELNFTLNVNDLCDHCHGTG--SDDGKLTP--CPDCQGRGVI 189

Query: 180 ERVSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRG- 237
            ++ R+  G ++++ +  C  C GKG +  +     C+KCHG  V+ +     + +P+G 
Sbjct: 190 IQLIRM--GMMTQQIQQMCGRCGGKGQLFKK----QCRKCHGNKVMPQKKEFQVKLPKGA 243

Query: 238 HRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEAL-TG 296
            RH   ++  G+AD     E GDL+ E +E    +    R+G +L+ +  +++ EAL  G
Sbjct: 244 KRHYMDVK-HGEADKNPDLEAGDLLIEFNENDKSNMGYRRRGQNLYRTEVLNVTEALYGG 302

Query: 297 FTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSR--FGDLYVKVNIEFPK 354
           + R +      + L++   S  V+  G   +    G P   G +  FGDL++   +  PK
Sbjct: 303 WQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLFIDYVVIMPK 362

Query: 355 DNW 357
             W
Sbjct: 363 -QW 364

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  123 bits (308), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 106/366 (28%), Positives = 163/366 (44%), Gaps = 31/366 (8%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDK-ISDESQRAESEAKFKEISAAYDIL 59
           + +D YS+LG+  +A++++VK AYR L+  YHPDK   DES    +  +F E+  AY++L
Sbjct: 16  LAQDYYSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGDES----AHQRFIEVGEAYEVL 71

Query: 60  SDEQKRSEYDHYG---------RFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYE 110
           SD +KR  +D YG                 FG F D +    + F   F  G G  G   
Sbjct: 72  SDPEKRGIFDQYGADGLKNGAGGGGGPGGGFGGFHDPF----DIFEQMFNRGGGGGGFGG 127

Query: 111 DAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKC 170
                   K     V  +LS K  Y G   +F+L  N +C  CEG G            C
Sbjct: 128 GFGGMHRGKGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSGSEDGKVET----C 183

Query: 171 GICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSIL 230
             C G+G   ++ R+      R + PC  C G+G ++     + CK C G  V+ +    
Sbjct: 184 PDCGGQGILIQIIRMGI-MTQRIQQPCGRCSGRGHII----KNQCKACGGHKVVKKPKSF 238

Query: 231 TLYVPRGHRHADTIRIDGQ-ADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITIS 289
            + VP G    D + +  Q AD     E GD+  E  E    +    R+G  L  +  +S
Sbjct: 239 QVEVPAGAPR-DHVEVRHQEADQSTDMEAGDIFVEFTESDKNNMGYRRRGDHLFRTEVLS 297

Query: 290 LAEALT-GFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPI-NNGSRFGDLYVK 347
             EAL  G++R +    D + +++  P G ++  G   +    G P  ++G  FGDL+V+
Sbjct: 298 AREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFGDLFVE 357

Query: 348 VNIEFP 353
             +  P
Sbjct: 358 YAVVMP 363

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 97/360 (26%), Positives = 163/360 (45%), Gaps = 24/360 (6%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDK-ISDESQRAESEAKFKEISAAYDIL 59
           + +D Y++LG+  +A+E+E+K AYR L+  YHPDK   DE+    +  KF E+  AY++L
Sbjct: 21  VAQDYYAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGDET----AHHKFIEVGEAYEVL 76

Query: 60  SDEQKRSEYDHYG-----RFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQ 114
           SD+QKR  Y+ YG         G          +  G  D M+ F      +G       
Sbjct: 77  SDDQKRQIYNQYGAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQ---MFGAQRGGGG 133

Query: 115 KTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICD 174
           +   +  +     +++ K+ Y G +  F L  N  C  C+G G +         +C  C 
Sbjct: 134 RGRPRGHNLEAREEITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQDGKT----TRCSDCQ 189

Query: 175 GRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYV 234
           G+G   ++ R+ P    + +  C  C GKG ++     + CK+CHG  V  +     + V
Sbjct: 190 GQGVVIQIIRMGP-ITQQIQQMCGACQGKGQII----KNKCKQCHGAKVERKTKHFHVDV 244

Query: 235 PRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEAL 294
           P G         +G+AD     + GD+  +  E +  +    R+G  LH +  ++L EAL
Sbjct: 245 PAGAPRDFVDVKNGEADKGPDFDAGDVYIKFSESSRDNMGYRRRGVHLHRTEVLTLKEAL 304

Query: 295 T-GFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFP 353
             G+ R +      + +++   +G  +R G   +    G P  +G  FGDL+V   +  P
Sbjct: 305 QGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMP-KDGRHFGDLFVDYVVLTP 363

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score =  121 bits (303), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 100/358 (27%), Positives = 162/358 (45%), Gaps = 21/358 (5%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSD 61
            +D Y +LG+  +A+++E+K AYR L+  +HPDK   +    ++  KF E+  AY++LSD
Sbjct: 23  AQDYYGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGDE---DAHHKFIEVGEAYEVLSD 79

Query: 62  EQKRSEYDHYGR---FDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQ 118
           +QKR  YD +G     + G    G     +  G  D M+ F      +G +     +   
Sbjct: 80  DQKRQIYDQHGAEALKNGGPGGPGGPGGGFGGGFHDPMDIFEQ---MFGGHRGGGGRGRP 136

Query: 119 KTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRK-RAAHCMPMKCGICDGRG 177
           +  +     +L+ KQ Y G +  F L  N  C  C G G +  +  HC       C G+G
Sbjct: 137 RGHNLEAREELTLKQYYQGTSLDFTLNLNDFCENCHGSGSQDGKTTHCSE-----CRGQG 191

Query: 178 FKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRG 237
              +V R+ P    + +  C  C GKG V+     + CK+CHG  V  +     + VP G
Sbjct: 192 VVIQVVRMGP-LTQKIQQMCGACQGKGQVI----KNKCKRCHGAKVERKAKHFHVDVPAG 246

Query: 238 HRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGF 297
                     G+AD     ++GD+  +  E +  +    R+G  L+ +  +SL EAL G 
Sbjct: 247 APRDFVDVKAGEADKGPDFDSGDVFIKFSESSRDNMGYRRRGPHLYRTEVLSLKEALLGG 306

Query: 298 TRLVARTFD-DRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPK 354
            +     FD ++ L++    G  +R G   +    G P     + GDL+V   +  PK
Sbjct: 307 WKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHGKHGDLFVDYVVVIPK 364

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  119 bits (299), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 103/365 (28%), Positives = 162/365 (44%), Gaps = 33/365 (9%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           + +D YS+LG+   A ++++K AYR L+  YHPDK  D+     +  KF E+  AY++LS
Sbjct: 17  LAQDYYSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDDDS---AHNKFIEVGEAYEVLS 73

Query: 61  DEQKRSEYDHYG---------RFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYED 111
           D +KR  YD YG         +        G F D +    + F   F  G G   Q   
Sbjct: 74  DPEKRKIYDQYGAEALKNNGGQGGGQGPRGGGFHDPF----DIFEQMFGGGGGGQRQRRR 129

Query: 112 AEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCG 171
           A     +  ++      L+ K+ Y G +  F L  N  C  CEG G +         KC 
Sbjct: 130 ARGHNLETREE------LTLKEYYRGTSIDFNLNLNDFCEHCEGSGSQDGKV----TKCP 179

Query: 172 ICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILT 231
            C G G   ++ R+ P     +++ C +C G+G+ +     + CK CHG+ V+ +     
Sbjct: 180 DCKGHGVVVQIVRMGPVTQQIQQM-CGKCQGRGSTI----KNKCKHCHGEKVVRKPKSFH 234

Query: 232 LYVPRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLA 291
           + VP G          G++D     + GDL  +  E +  +    R+G DL  +  +SL 
Sbjct: 235 VDVPPGAPRNFVEVKQGESDKGPDFDAGDLFIKFSETSRDNLGYRRRGDDLFRTEALSLR 294

Query: 292 EALT-GFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNI 350
           EAL  G+ R +      R ++I   S  V   G   +    G P  + ++FGDLY+   +
Sbjct: 295 EALKGGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMPKEH-NKFGDLYIDYVV 353

Query: 351 EFPKD 355
             P D
Sbjct: 354 IVPDD 358

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score =  121 bits (303), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 122/457 (26%), Positives = 191/457 (41%), Gaps = 67/457 (14%)

Query: 1   MGKD--LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDI 58
           M KD   Y +L +    + QE+K++Y+  AL YHPDK         ++  F++I+ AY I
Sbjct: 1   MVKDTRFYDLLNVSPTVSPQELKKSYKLAALRYHPDK---NGHSESAKQAFQQITEAYGI 57

Query: 59  LSDEQKRSEYDHYGRFDEGSFPF--------------------------GDF---DDDYK 89
           LSDE+KR  YD YG  DE                               GD         
Sbjct: 58  LSDERKRKIYDRYGVSDENEIVAILASQKRAAAAAAPAATAARNMEMTPGDLFAHFFGDG 117

Query: 90  RGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTK----DFVVPLKLSTKQLYLGKTFQFKLK 145
            G     +F +   G + ++  A +  ++  K    D    LK   K+LY GK  +  L 
Sbjct: 118 FGAGGEFSFLQGNLGGHCRFNSAAKDKARDGKSRGPDIKHNLKCELKELYSGKVAKLGLT 177

Query: 146 RNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGT 205
           R  LC +C G G    +       CG C G+G   +  R  P  +      C  C G GT
Sbjct: 178 RTRLCHRCSGHGSMTSSV------CGECRGQGVYSQTRRHGP-LVQTWSSSCRNCSGAGT 230

Query: 206 VVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQADMEA----GKET--- 258
            V  +  D C+ C G   I E  I  + +  G  +   I + G+AD       GK+    
Sbjct: 231 FVKSN--DVCQTCRGTGYIRERKIFEVEIKPGLSNKSEIILPGEADQVISTVYGKQQVIP 288

Query: 259 GDLVFEIDEITDPDAELERKGTDLHCS-ITISLAEALTGFTRLVARTFDDRLLRITIPSG 317
           GD++  + E          + +DL  +   + L  +L G +  +      R +++ +  G
Sbjct: 289 GDVIIIVQEQCSTGRYRRFRESDLVLTRCVVDLRTSLCGGSIYIDDHPSGRPIKLEVIPG 348

Query: 318 KVLRPGNYLKFTNEGWPI-NNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKN 376
           ++L PG+     N G P  +N S++GDLY+K  + FP      E+ E E +  I   L +
Sbjct: 349 ELLNPGSIKCVENLGMPKRDNPSQYGDLYIKFCVNFP------ERLEPETMNVISSALAS 402

Query: 377 SSN-SHQGDGDDP--ANTEDINSY--YVIQDSSRLPD 408
            SN   Q +  +P  A T + + Y  +V  + + +PD
Sbjct: 403 DSNIIRQENITEPSSAQTRNPDCYEEHVFSNFNEIPD 439

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  117 bits (294), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 100/361 (27%), Positives = 161/361 (44%), Gaps = 21/361 (5%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSD 61
            +D Y++LG+  +A+E+++K AYR ++  +HPDK + +    E+  KF EI  AY++LSD
Sbjct: 17  AQDYYAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGDD---EAHHKFIEIGEAYEVLSD 73

Query: 62  EQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTK 121
            +KR+ YD +G     +   G        G   F + F      +G      Q   +K  
Sbjct: 74  SEKRATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGGQNV-RKGS 132

Query: 122 DFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKER 181
           + +V   ++    Y G      L  N  C  C G G    A       C  C GRG   +
Sbjct: 133 NLIVKDSVTLNGFYHGFYANLTLDLNDDCEHCHGSG----AEDNQFATCETCQGRGVIIQ 188

Query: 182 VSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRH 240
           V  I  GF++++ +  C  C GKG  +       CK C G  V+       + VP G + 
Sbjct: 189 V--IQMGFMTQQIQQVCGACQGKGKTIKH----VCKICRGARVVKTPKTFEISVPAGAQR 242

Query: 241 ADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALT-GFTR 299
              +   GQA+     ++GDLVF  +E +  +    R+G  L+ +  +   EAL  G+ R
Sbjct: 243 NYNVVKSGQAEKVPDMQSGDLVFVFEENSHENLGYRRRGDHLYRTEVLHWKEALLGGWER 302

Query: 300 LVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNG-----SRFGDLYVKVNIEFPK 354
            +A   D + + +      V  PG   +  N G P  N      + +GDL+++  I  PK
Sbjct: 303 RIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGDLFIEYVIVSPK 362

Query: 355 D 355
           +
Sbjct: 363 E 363

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score =  119 bits (297), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 127/444 (28%), Positives = 185/444 (41%), Gaps = 89/444 (20%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDK--ISDESQRAESEA-------KFKEISAA 55
           LY  L + + A+  E+K+AYRN AL YHPDK   ++ES+R   E        K   + + 
Sbjct: 7   LYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEVLKDNHLRSL 66

Query: 56  YD-------ILSDEQKRSE--------------YDHYGRFD-EG-SFP-----------F 81
           YD        L  EQ + +              ++    FD EG SFP           F
Sbjct: 67  YDQYGTTDEALIQEQYQQQAYPQTQTQRQQSSVFNPSAGFDTEGMSFPDLSPGDLFAQFF 126

Query: 82  GDFDDDYKRGNEDFMNF-----------FRYGAGRYGQYEDA-------EQKTSQKTKDF 123
                    G ++  NF           F  G+G    Y  +       E+    +  D 
Sbjct: 127 SSSASSSSNGAKNSFNFSFNGSSTPNFPFGNGSGMNSLYSPSSKYNTTGEEHHLNRGPDI 186

Query: 124 VVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGL-GLRKRAAHCMPMKCGICDGRGFKERV 182
              LK + K+LY+GKT +  L R  +C  C+G  GLRK         C  C G+G + + 
Sbjct: 187 KHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGGLRKYT-------CKPCKGQGIQTQT 239

Query: 183 SRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHAD 242
            R+ P  +      C +C G GT V     D C++C G   I +  IL + V  G  H  
Sbjct: 240 KRMGP-LVQSWSQTCADCGGAGTFVKN--KDICEQCQGLGFIKQRKILQVTVQPGSCHNQ 296

Query: 243 TIRIDGQAD-----MEAGKE---TGDLVFEIDEITDPDAELERKGTDLHC-SITISLAEA 293
            I + G+ D        G+E    GD+V  I  + DP  ++     DL C    + L  +
Sbjct: 297 LIVLTGEGDEVISTKGGGREKVIPGDVVITILRLKDPKFQI-TDNCDLICKKCEVDLMTS 355

Query: 294 LTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP-INNGSR--FGDLYVKVNI 350
           L G    +      +L++I I  G+VL+PG +    N G P   NG R  FG LYVK ++
Sbjct: 356 LCGGIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHLYVKFDV 415

Query: 351 EFPK----DNWLNEKSELEAIKHI 370
            +P+    +N    KS L   K+I
Sbjct: 416 TYPERLEPENAAKVKSILANDKYI 439

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score =  117 bits (292), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 127/512 (24%), Positives = 194/512 (37%), Gaps = 104/512 (20%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LYS+L + + AT  E+K AY+ LAL YHPDK    +   ES+ KF+EI  AY++L D+ K
Sbjct: 14  LYSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESKLKFQEICKAYEVLHDKDK 70

Query: 65  RSEYDHYGRFDEGSF--------PFGDFDDDYKRGNEDFMNFF----------------- 99
           +  YD YG  DE              DFD       + F  FF                 
Sbjct: 71  KLLYDTYGTLDESLIDKQRGNNDQKDDFDTTELSPGDLFAKFFDKSSRVNNNNYNSNSSP 130

Query: 100 ----------RYGAGRYGQYEDAEQKTSQKT---------KDFVVPLKLSTKQLYLGKTF 140
                        AG     +     ++  T          D    L  + K+LY GK  
Sbjct: 131 FNNVPSTNTNTNSAGNRFMTQALNSPSTTGTLFEKGLSRGPDIKHVLNCTLKELYQGKKC 190

Query: 141 QFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDEC 200
           +  L R   C  C G+G            C  C G+G       + P  +      C  C
Sbjct: 191 KLGLNRTRSCHSCNGMGGMNTII------CNECQGKGINTETKMLGP-MVQSWSSTCFNC 243

Query: 201 DGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQAD--MEAGKET 258
            G G  +  D    CK+C G+  + E +I T+ V  G R+   I + G+AD  M  GK  
Sbjct: 244 SGMGYFI--DSQSGCKECQGEGYLRERTIFTVTVKPGMRNNQKIVLKGEADQVMLVGKLN 301

Query: 259 ------GDLVFEIDEI------TDPDAELERKGTDLHCSIT-----------ISLAEALT 295
                 GD++  I++I       D + +        H  I            I L  +L 
Sbjct: 302 KEKVIPGDVIIVINQIEGKSWKNDSNIDQGENKNKFHFEIINEKDLLLRNCQIDLITSLC 361

Query: 296 GFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP------INNGSRF---GDLYV 346
           G    +      +L+++ I   ++L+P       N G P       NNG  +   GDLY+
Sbjct: 362 GGEIYIKNHPSGKLIKLDIIPSEILKPDCLKCVENLGMPRYIEDETNNGEEYLPNGDLYI 421

Query: 347 KVNIEFPKDNWLNEKSELEAIKHILPGLKNSSNSHQGDG-------DDPANTEDINSYYV 399
           +  +++P      E   ++ ++ IL    +  N  Q +        DD    E+    +V
Sbjct: 422 QFKVKYPTK---LENETIDKLRSILSEDIHMKNELQKEKVIIDQQLDDCIEVEE----HV 474

Query: 400 IQDSSRLPDYLAQEGQQRSNQQYGERNTASEC 431
           +   +   D L Q G +  +Q++   NT   C
Sbjct: 475 LSSFAPDLDRLRQAGIKSRSQRWQSDNTEDSC 506

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
           YFL016C
          Length = 500

 Score =  112 bits (280), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 128/434 (29%), Positives = 185/434 (42%), Gaps = 100/434 (23%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y VLG+KS+A++ E+K+AY  LA  YHPD I+ E   A +E KF ++  AY+ILSDE
Sbjct: 34  KDPYGVLGVKSSASQGEIKKAYYKLAKQYHPD-INKE---AGAEKKFHDLQNAYEILSDE 89

Query: 63  QKRSEYDHYGR---------------FDEG-------------SFPFGDFDDDYKRGNED 94
            KR ++D +G                + +G             S PFGDF      G  +
Sbjct: 90  SKRKQFDQFGPAAFGAGAGAGGPGSGYPQGQGFNPFASYTSSSSSPFGDF------GGIN 143

Query: 95  FMNFFR-----------------------YGAGRYGQYEDAEQKTSQKTKDFVVPLKLST 131
           F + F                        + +  Y QY         K     V   +S 
Sbjct: 144 FEDLFGAAFSGSGGAGGAKAGGAGASRNPFSSSGYRQY---------KGDSVHVSYNMSF 194

Query: 132 KQLYLGKTFQFKLKRNVL--CSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGF 189
           K    GK+   KLK NV   C  C G G++K A+     +C  C G G K  V     GF
Sbjct: 195 KDAVFGKS-GVKLKFNVFDPCDTCSGSGIKKGASR---HQCPGCQGSGTKIHVRG---GF 247

Query: 190 ISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSI-LTLYVPRGHRHADTIRIDG 248
             +    C+EC G+GT V  + SD C  CHG+ V       +T+ +P G +  D IRI G
Sbjct: 248 --QMMSTCNECQGEGTTV--NSSDLCGACHGEGVHFHRGKEITVDLPHGLQDGDVIRIPG 303

Query: 249 QADME--------AGK---ETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGF 297
           Q            AG      GD++  +    DP   +  K +D+  ++ I +  A  G 
Sbjct: 304 QGSYPEVALDPSLAGSVKLTRGDVLVNVRVEEDPTFTIRDK-SDIWYTMEIPITTAALGG 362

Query: 298 TRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRF-GDLYVKVNIEFPKDN 356
           T  V  T D   +R+ +  G   + G+ +   N G P +N +R  G + V+  I   K +
Sbjct: 363 TVQVP-TVDGSHIRLKVAPG--TQSGDVITVPNMGVPRSNLTRSRGAMKVQYRIVIKKPS 419

Query: 357 WLNEKSELEAIKHI 370
              EK   EA+  +
Sbjct: 420 SEVEKCLWEALADV 433

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score =  110 bits (275), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 105/371 (28%), Positives = 158/371 (42%), Gaps = 39/371 (10%)

Query: 4   DLYSVLGIKSN-ATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           D Y +LGI  N   E+E+K AYR L+  YHPDK  ++    +++  F ++  AYD+L D 
Sbjct: 24  DYYKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDK---DAQQNFIKVGEAYDVLGDP 80

Query: 63  QKRSEYDHYGR----------FDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDA 112
            K+ +YD  G             EG      F D +    + F      G   +G     
Sbjct: 81  DKKRQYDQMGHDAFVNNAQHGGPEGGPGGQPFHDPFDMFEKMFHGGGPGGGNPFGGNPFG 140

Query: 113 EQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGI 172
                ++     V  +LS KQ Y G  FQF L  +  C  C G G            C  
Sbjct: 141 GGGGQRRGPSLKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTGSEDGKTKV----CPD 196

Query: 173 CDGRGFKERVSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILT 231
           C G G   ++ R+  G ++++ + PC  C G+G ++     + CK C+G  V  +     
Sbjct: 197 CKGSGIIIQIIRM--GMMTQQIQQPCGRCRGQGHLI----KNFCKVCNGAKVQQKLKDFK 250

Query: 232 LYVPRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLA 291
           +YVP G          GQA+     E GD++ E +E+   +    R+G +L  +  ISL 
Sbjct: 251 VYVPPGSPRNHVEVKAGQAEKNPNYEPGDVIIEFNELPLDNLGYRRRGNNLFRTEYISLN 310

Query: 292 EALTG-------FTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPI-NNGSRFGD 343
           EAL G       F     R    R   +TI  G++     +      G PI N  ++FGD
Sbjct: 311 EALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGF------GMPIPNKKNKFGD 364

Query: 344 LYVKVNIEFPK 354
           LY+   +  PK
Sbjct: 365 LYIDYKVIIPK 375

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score =  110 bits (276), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 119/472 (25%), Positives = 196/472 (41%), Gaps = 64/472 (13%)

Query: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           LY  L +   AT  ++K+AY+ LAL YHPDK    +   +S+ KF+ +  AY+IL+D+Q 
Sbjct: 7   LYETLNVPITATTLDIKKAYKKLALKYHPDK---NNHSEDSKTKFQAVCQAYEILNDKQS 63

Query: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAG---RYGQYED----AEQKTS 117
           R+ YD  G  DE            +   +  M F   G      + Q+ D    A ++ S
Sbjct: 64  RAIYDALGITDEALIEQQKKQQQQQHQQQGGMEFPPMGMSPGDLFAQFFDNNNNAAKQPS 123

Query: 118 Q-------------------------KTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSK 152
           Q                         +  D    LK + ++LY GK  +  L R  LC  
Sbjct: 124 QSQMHAYPNFKSESHVTNGKADHPLHRGPDIKHVLKCTLRELYNGKMAKLALNRTRLCLP 183

Query: 153 CEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPS 212
           C G G  +R        C  C G GF+ +  R+ P  +      C  CDG G  +   P+
Sbjct: 184 CNGFGGLQRTT------CESCQGDGFQTQTRRMGP-MVQTWTQTCASCDGAGCFIK--PN 234

Query: 213 DNCKKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQAD-------MEAGKETGDLVFEI 265
           D C  CHG+  I E  I  + V  G +    + + G+AD       ++     GD+V  I
Sbjct: 235 DVCPHCHGEGFIRERKIFHVEVKPGFQDGKDVIMQGEADEIMLNNLVKEKVIPGDVVITI 294

Query: 266 DEITDPDAELERKGTD--LHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPG 323
            +  D +   +       L     + L  +L G    +      +L+++ I  G++L+P 
Sbjct: 295 KQSRDENNCFQMINNKDLLMNGCPVDLVTSLCGGEVYIDNHPSGKLIKLDIIPGEILKPN 354

Query: 324 NYLKFTNEGWP-INNGS-----RFGDLYVKVNIEFPK----DNWLNEKSELEAIKHILPG 373
            +      G P + +G      R GDLY++  I++P+    +     K++L   K++   
Sbjct: 355 CFKIIEGLGMPYLEDGKDDTMLRRGDLYIQFKIQYPEQLENETMTQLKAQLNKDKYVKED 414

Query: 374 LKNSSNSHQGDGDDPANTED-INSYYVIQDSSRLPDYLAQEGQQRSNQQYGE 424
           L+    +     DD    E+ + S ++  D+  L  Y A   ++R+  Q  E
Sbjct: 415 LRREKEAIDQRLDDCVEVEECVLSSFIAPDAETLRKYKADYRRRRNAMQEDE 466

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score =  108 bits (270), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 99/362 (27%), Positives = 159/362 (43%), Gaps = 29/362 (8%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           + +D Y +LG+  N  E+E+K AYR L+  +HPDK  ++    ++  KF EI  AY++LS
Sbjct: 20  LAQDYYKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPNDE---DAHNKFIEIGEAYEVLS 76

Query: 61  DEQKRSEYDHYG------------RFDEGSFPFGD-FDDDYKRGNEDFMNFFRYGAGRYG 107
           D +KR  YD +G                G   F D FD   +         F    G  G
Sbjct: 77  DPEKRRMYDQFGADAVKNGGPGGPGGPGGPGGFHDPFDLFEQMFGGGHGGGFGGFGGFGG 136

Query: 108 QYEDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMP 167
                + +  Q+ +   V   L+ K  Y G +  F L  N  C  C G G          
Sbjct: 137 FGGGQQHQGKQRGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSGSEDGKVK--- 193

Query: 168 MKCGICDGRGFKERVSRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVE 226
            KC  C GRG   +V R+  G ++++ +  C+ C G G ++     + CK C G  V  +
Sbjct: 194 -KCPDCGGRGVVIQVIRM--GIVTQQVQQRCNRCAGSGEII----QNKCKVCSGAKVQKK 246

Query: 227 NSILTLYVPRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSI 286
              +++    G          G+A+   G E GDL+ E  E+ + +    R+G DL  + 
Sbjct: 247 EKDISVSFDSGIERNHISVQQGEAEKGPGIEPGDLIVEFFEVPEANMGYRRRGKDLFRTE 306

Query: 287 TISLAEALTG-FTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPI-NNGSRFGDL 344
            ++L EA+ G ++R +      + L++      ++  G   K    G PI  +  +FGDL
Sbjct: 307 VLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGSKGKFGDL 366

Query: 345 YV 346
           Y+
Sbjct: 367 YI 368

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score =  102 bits (254), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 109/407 (26%), Positives = 168/407 (41%), Gaps = 65/407 (15%)

Query: 1   MGKD--LYSVLGIKSNATEQEVKRAYRNLALMYHPDK---ISDESQRAESEAKFKEISAA 55
           M +D  LY  L +  +AT  E+KRAY+ +AL YHPDK     D   + +   K  EI A 
Sbjct: 1   MARDTRLYDTLKVSPDATISEIKRAYKVMALKYHPDKNHHSEDAKNKFQEVCKAYEILAD 60

Query: 56  YD--ILSD-----------EQKRSE-----------------------YDHY-GRFDEGS 78
            D  ++ D           EQ+ S+                       +D++ G    G 
Sbjct: 61  EDKRVMYDRYGTVDEYALQEQEESQGAPTTSSSFFGSSMSPGDLFAQFFDNFPGHSSFGR 120

Query: 79  FPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKDFVVPLKLSTKQLYLGK 138
            PFG            F     +     G           +  D    LK +  +LY GK
Sbjct: 121 SPFGSAFGGGSPFGGGFPFGSSFSHHSGGGRSSYGGGRPSRGPDIKHNLKCTLAELYDGK 180

Query: 139 TFQFKLKRNVLCSKCEGLG-LRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPC 197
             +  L R  +C  C+G G LR+R        C  C G+G +    R  P  +      C
Sbjct: 181 ITKLGLNRRRMCQSCQGQGSLRRRT-------CKTCRGQGQQTETRRTGP-MVQTWTQTC 232

Query: 198 DECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQAD----ME 253
            +C+G GT   +  +D C +C G+  I E  I  + V +G  H  TI + G+AD      
Sbjct: 233 PDCNGLGTYTKQ--ADVCHECRGESYIKERKIFDVEVSKGMCHGQTIVLPGEADELIKTS 290

Query: 254 AGKET---GDLVFEIDEITDPD-AELERKGTDL-HCSITISLAEALTGFTRLVARTFDDR 308
            G E    GD+V  ID++ D     + R G DL   S +I L+ +L G    +      +
Sbjct: 291 FGVEKVIPGDVVITIDQVKDSKFHRVNRYGCDLVMGSCSIDLSTSLCGGDIYIDGHPSGK 350

Query: 309 LLRITIPSGKVLRPGNYLKFTNEGWPI--NNGSRFGDLYVKVNIEFP 353
           LL+++I  G+++ P         G P   ++G + G+LY++  +E+P
Sbjct: 351 LLKVSIVPGELIGPNCLKSIEGMGMPKYGHDGGK-GNLYIQFQLEYP 396

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score =  102 bits (253), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 112/393 (28%), Positives = 161/393 (40%), Gaps = 58/393 (14%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y  LG+  +A+  ++KRAY  LA  YHPD     ++   ++  F  +  AY+ILSDE
Sbjct: 47  KDPYKTLGVSRDASPSDIKRAYYKLAKKYHPDI----NKEPGADKTFHNLQNAYEILSDE 102

Query: 63  QKRSEYDHYGR--FDE-------GSF-PFG------DFDDDYKRGNEDFMNFFRYGAGRY 106
           +K+ +YD YG   FD+       G F PFG       F D    G  +F + F    GR 
Sbjct: 103 KKKLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFAD---FGGLNFEDLFGAAFGRS 159

Query: 107 GQYEDAEQKTSQKTKDFV---------VPLKLSTKQLYLG-KTFQFKLKRNVLCSKCEGL 156
           G     +        + V         +   +S K    G      K K    C  C G 
Sbjct: 160 GFRNGGDAGGFNGRANIVREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDPCGTCHGS 219

Query: 157 GLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCK 216
           GL+    H     C  C+G G +  V     GF  +    C  C G+GT ++R+  D C 
Sbjct: 220 GLKNGEQHKRKT-CSYCNGTGTQVHV---KSGF--QMASTCMHCHGEGTTIARE--DTCS 271

Query: 217 KCHGKCV-IVENSILTLYVPRGHRHADTIRIDGQA----------DMEAGKETGDLVFEI 265
            C G  V I     L +  P G    D IRI G+           D       GDL+  I
Sbjct: 272 ACDGDGVKINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVRI 331

Query: 266 DEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNY 325
              +DP   ++ K  D+     I +  A  G T  +  T D + +R+ + SG   +    
Sbjct: 332 RVKSDPKFFVKNK-YDIWTIKEIPITTAALGGTVEI-ETVDGKNIRLKVISG--TQHDQV 387

Query: 326 LKFTNEGWPINNGSRFGDLYV--KVNIEFPKDN 356
               N G P  NG+  G++ V  K+ I+ P+ N
Sbjct: 388 TSIPNMGIPYRNGTGRGNMNVQYKIVIKKPQSN 420

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score =  100 bits (248), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 126/288 (43%), Gaps = 22/288 (7%)

Query: 78  SFPF-GDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKDFVVPLKLSTKQLYL 136
           SF F G    ++  GN   MN  +    +YG   D ++    +  D    LK + ++LY+
Sbjct: 146 SFSFNGSSTPNFPFGNGGGMNNLQSPPSKYG--SDDDEHHLNRGPDIKHTLKCTLRELYM 203

Query: 137 GKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVP 196
           GKT +  L R  +C  CEG G  ++        C  C G+G + +   + P  +      
Sbjct: 204 GKTAKLGLNRTRICHVCEGHGGLQKYT------CKTCKGQGVQTQTKCMGP-LVQSWSQT 256

Query: 197 CDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQADMEAGK 256
           C +C G G  V  +  D C++C G   I +  IL + V  G  H   I + G+ D    K
Sbjct: 257 CADCGGAGIFV--ESKDICQQCQGLGFIKQRKILQVTVQPGTSHNQLIVLTGEGDEVISK 314

Query: 257 E-------TGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRL 309
                    GD+V  I  + DP  ++    + ++    + L  +L G    +      +L
Sbjct: 315 GGGHEKVIPGDVVITILRLKDPKFQVTDNCSLIYKKCKVDLMTSLCGGIVYIEGHPSGKL 374

Query: 310 LRITIPSGKVLRPGNYLKFTNEGWP-INNGSR--FGDLYVKVNIEFPK 354
           +++ I  G+VL+P  +      G P   NG R  FG LYVK ++ +P+
Sbjct: 375 IKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRSGFGHLYVKFDVSYPE 422

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/72 (48%), Positives = 45/72 (62%), Gaps = 3/72 (4%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY  L + + A+  E+K+AYRN AL YHPDK    +   ES+ KF+EI  AY++L D   
Sbjct: 7  LYDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKRKFQEICQAYEVLKDNHL 63

Query: 65 RSEYDHYGRFDE 76
          RS YD YG  DE
Sbjct: 64 RSLYDQYGTTDE 75

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score = 99.8 bits (247), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 77/261 (29%), Positives = 116/261 (44%), Gaps = 26/261 (9%)

Query: 127 LKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRIS 186
           LK + K+LY+GKT +  L R  +CS C+G G  K+        C  C G+G + +  R+ 
Sbjct: 183 LKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKKCT------CKTCKGQGIQTQTRRMG 236

Query: 187 PGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHADTIRI 246
           P  +      C +C G G  V     D C++C G   I E  IL + V  G  H   I +
Sbjct: 237 P-LVQSWSQTCADCGGAGVFVKN--KDICQQCQGLGFIKERKILQVTVQPGSCHNQLIVL 293

Query: 247 DGQAD-----MEAGKET---GDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFT 298
            G+ D        G E    GD+V  I  + DP+ ++      +     I    +L G  
Sbjct: 294 TGEGDEVISTKGGGHEKVIPGDVVITILRLKDPNFQVINYSNLICKKCKIDFMTSLCGGV 353

Query: 299 RLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP-INNGSR--FGDLYVKVNIEFPKD 355
             +      +L+++ I  G++L+PG +    + G P   NG R  FG LYVK ++ +P  
Sbjct: 354 VYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSGFGHLYVKFDVTYP-- 411

Query: 356 NWLNEKSELEAIKHILPGLKN 376
               E+ E E  K I   L N
Sbjct: 412 ----ERLEPENAKKIQNILAN 428

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 97.8 bits (242), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 94/353 (26%), Positives = 154/353 (43%), Gaps = 18/353 (5%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           +D Y++LG+   ATE+++K AYR L+  YHPDK   ++    +   F E+  AY+ LSD 
Sbjct: 20  QDYYAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDT---TAHHNFIEVGEAYEALSDP 76

Query: 63  QKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKD 122
           +KR  YD YG     +   G   +    G  D  + F       G      Q+  Q+++ 
Sbjct: 77  EKRRIYDQYG---AEALKNGGGAEGGHGGFHDPFDIFEQ-MFGGGARFGGGQRRRQRSQS 132

Query: 123 FVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERV 182
             V  +L+ +Q Y G   +F L  N  C  C   G +         +C  C  RG   +V
Sbjct: 133 LQVQEELTLRQYYHGTAVEFTLSLNDHCDHCGATGSQDGKVE----RCTQCSVRGVIVQV 188

Query: 183 SRISPGFISRE-RVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLYVPRGHRHA 241
            R   GF++++ +  C    G      +     CK C G   I +N    + VP G    
Sbjct: 189 GR--QGFMTQQFQQVCPRLLGPW---PKALPKKCKVCQGHKAIKKNKSFRVEVPPGAPRD 243

Query: 242 DTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTG-FTRL 300
                 G+A+     + GD+  ++ E T  +    R+G +L  +  +SL EAL G + R 
Sbjct: 244 FVAVQQGEAEKVPDMDPGDIYVKVFENTRDNMGYRRQGANLFRTEVLSLKEALHGDWKRE 303

Query: 301 VARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFP 353
           +      + +  +   G+ ++ G   +    G P+ + + FGDLYV   +  P
Sbjct: 304 LEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDSAGFGDLYVDYVVILP 356

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 113/407 (27%), Positives = 169/407 (41%), Gaps = 58/407 (14%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y  LG+K +AT  E+K+AY  LA  YHPD     ++  ++E KF ++  AY+ILSDE
Sbjct: 60  KDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDI----NKEPDAEKKFHDLQNAYEILSDE 115

Query: 63  QKRSEYDHYGRFDEGSFPFGDFDDDYKRGN-----EDFMNFFRYGAGRYG--QYEDAEQK 115
            KR +YD +G    G                     DF  F   G   +G   +ED    
Sbjct: 116 TKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQFHDFSGFTSAGGSPFGGINFEDLFGA 175

Query: 116 TSQKTKD-------------------FVVPLKLSTKQLYLG-KTFQFKLKRNVLCSKCEG 155
                                       +  K+S K    G K  Q +      CS C G
Sbjct: 176 AFGGGGRGSGGASRSSSMFRQYRGDPIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSG 235

Query: 156 LGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNC 215
            G++    +   + C  C G G       I  GF  +    C  C+G+GT+  + P DNC
Sbjct: 236 TGMK---PNTHKVSCSTCHGTG---TTVHIRGGF--QMMSTCPTCNGEGTM--KRPQDNC 285

Query: 216 KKCHGKCVIVENS-ILTLYVPRGHRHADTIRIDGQ---------ADMEAGKET--GDLVF 263
            KCHG+ V V  +  +T+ +P G +  D +RI GQ         AD++   +   GD++ 
Sbjct: 286 TKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILV 345

Query: 264 EIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPG 323
            I    DP+  ++ K  D+     I +  A  G T  +  T + + +RI +  G   +  
Sbjct: 346 RIRVDKDPNFSIKNK-YDIWYDKEIPITTAALGGTVTIP-TVEGQKIRIKVAPG--TQYN 401

Query: 324 NYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHI 370
             +   N G P  +  R GD+ V+  I   K   L EK   EA+  +
Sbjct: 402 QVISIPNMGVPKTSTIR-GDMKVQYKIVVKKPQSLAEKCLWEALADV 447

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 93.6 bits (231), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 117/422 (27%), Positives = 179/422 (42%), Gaps = 84/422 (19%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y  LGI SNA++ ++K+AY  LA  YHPD   +E+    +EAKF ++  AY+ILSDE
Sbjct: 46  KDPYKTLGINSNASQSDIKKAYYKLAKKYHPDINKEEN----AEAKFHDLQNAYEILSDE 101

Query: 63  QKRSEYDHYG---------------RFDEGSFPFGDFDDDYKRGNEDF--MNFFRYGAGR 105
           QKR +YD +G                F    F FG  ++ +     DF  +NF       
Sbjct: 102 QKRKQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPF----SDFGGINFEDLFGNA 157

Query: 106 YGQYEDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKL--KRNV--------LCSKCEG 155
           + Q        S +   F    K  T  L     F+  +  K+NV         C+ C G
Sbjct: 158 FKQQHSNNTSNSNRN--FFREFKGDTIHLNYNLNFKDSVFGKKNVKLNFNSFDPCNTCNG 215

Query: 156 LGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNC 215
            GL+  A       C  C+G G   RV  I  GF  +    C++C+G+GT +  DP+D C
Sbjct: 216 SGLKHNAHKST---CQTCNGTG--TRV-HIRGGF--QMMSTCNDCNGEGTKI--DPNDYC 265

Query: 216 KKCHGKCV-IVENSILTLYVPRGHRHADTIRIDGQA-------------DMEAGKETGDL 261
             CHG  V    N  +T+ +P   +  D IR+  +              +       GD+
Sbjct: 266 NHCHGDGVEFKRNKEITVDLPNALQDGDVIRVSNKGSYPQMAMDPDLINNNNVRMTRGDI 325

Query: 262 VFEIDEITDPDAELERKGTDLHCSITISLAEALTGFT-------------RLVARTFDDR 308
           + +I+ I D   ++ R   D+  ++ I +  A  G               R+   T +D+
Sbjct: 326 LIKINVINDTKFKI-RDKYDIWYTMEIPITTAALGGIVTIPSIDGTNVRLRVSPGTQNDQ 384

Query: 309 LLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIK 368
           +  I+IP+  V R   + + TN        +  G++ V+  I   K     EK   EA+ 
Sbjct: 385 I--ISIPNMGVPRSNIFSRSTNT-------TNRGNMKVQYKIIIKKPQSQAEKCLWEALA 435

Query: 369 HI 370
            I
Sbjct: 436 DI 437

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 115/406 (28%), Positives = 173/406 (42%), Gaps = 57/406 (14%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y  LG+K +AT  E+K+AY  LA  YHPD     ++  ++E KF ++  AY+ILSDE
Sbjct: 60  KDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDI----NKEVDAEKKFHDLQNAYEILSDE 115

Query: 63  QKRSEYDHYGRFDEGSFP---------------FGDFDDDYKRGNEDF--MNFFRYGAGR 105
            KR +YD +G    G                  F DF      G   F  +NF       
Sbjct: 116 NKRQQYDQFGPAAFGGGGAAGGPGSGGSPFGSQFHDFSGFTNAGGSPFGGINFEDLFGAA 175

Query: 106 YGQYEDAEQKTSQKTKDF--------VVPLKLSTKQLYLG-KTFQFKLKRNVLCSKCEGL 156
           +G    +     + +  F         +  K+S K    G    Q K      CS C G 
Sbjct: 176 FGGAGRSSGGGPRSSSMFRQYRGDPIEIVHKVSFKDAVFGSNNVQLKFSALDPCSTCSGT 235

Query: 157 GLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCK 216
           G++    +   + C  C G G       I  GF  +    C  C+G+GT+  + P D+C 
Sbjct: 236 GMK---PNTHKVNCSTCHGTG---TTVHIRGGF--QMMSTCPTCNGEGTM--KRPQDSCT 285

Query: 217 KCHGKCVIVENS-ILTLYVPRGHRHADTIRIDGQAD-----MEAG-KET-----GDLVFE 264
           KCHG+ V V  +  +T+ +P G +  D +RI GQ       +EA  K+T     GD++  
Sbjct: 286 KCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDTVKLSRGDILVR 345

Query: 265 IDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGN 324
           I    DP+  ++ K  D+     I +  A  G T  +  T + + +RI +  G   +   
Sbjct: 346 IRVDKDPNFSIKNK-YDIWYDKEIPITTAALGGTVTIP-TVEGQKIRIKVAPG--TQYNQ 401

Query: 325 YLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHI 370
            +   N G P     R GD+ ++  I   K   L EK   EA+  +
Sbjct: 402 VISIPNMGVPKTTTIR-GDMKIQYKIVVKKPQSLAEKCLWEALADV 446

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 114/421 (27%), Positives = 180/421 (42%), Gaps = 77/421 (18%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD YSVLG+ ++A+  E+K+AY  LA  YHPD     +++ ++E KF ++  AY+ILSDE
Sbjct: 78  KDPYSVLGVNNSASTSEIKKAYYKLAKKYHPDI----NKQPDAEKKFHDLQNAYEILSDE 133

Query: 63  QKRSEYDHYG-----------------------------RFDEGS-FPFGDFDDDYKRGN 92
            KR +YD +G                             +   GS  PF DF  ++    
Sbjct: 134 NKRKQYDTFGPSAFQDAQQGGAGGPGGGPGGFPGGYPFGQTSSGSGNPFADFGINF---- 189

Query: 93  EDFMNFFRYGAGRYGQYEDAEQKTSQKTKDFVV-PLKLSTKQLYLGKTF---QFKLKRNV 148
           ED      +G G +       ++ S   ++F   P+++     +    F      LK N 
Sbjct: 190 EDLFG-AAFGNGPHATGGGRARRQSNIYREFKGDPIEIVHNLNFKDAVFGVQNVNLKFNS 248

Query: 149 L--CSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTV 206
           +  C+KC G GL + A       C  C G G K     I  GF  +    C+ C G+GT+
Sbjct: 249 MDPCNKCSGSGLNRNAKRTT---CPSCHGSGQK---VHIRSGF--QMVSTCNHCHGEGTI 300

Query: 207 VSRDPSDNCKKCHGKCV-IVENSILTLYVPRGHRHADTIRIDGQAD------------ME 253
           +  D  D C  CHG  V +  N  + + +P G +  D IR+ GQ +            M 
Sbjct: 301 I--DSKDICSSCHGDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGNYPQTGASIDPAMMN 358

Query: 254 AGKET-GDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRI 312
           + K + GDL+  +    DP+  + R   D+  +  I +  A+ G    +  T D   +R+
Sbjct: 359 SIKLSRGDLLVRVRVNKDPNFSI-RDKYDIWFTKQIPITTAILGGVVKIP-TVDGTQIRL 416

Query: 313 TIPSGKVLRPGNYLKFTNEGWP---INNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKH 369
            +  G   +    +   N G P   IN  +R G++ V+  I         EK   EA+  
Sbjct: 417 KVSPG--TKHDQIISIPNLGVPRSSINKDNR-GNMKVQYKIIMKTPQSQAEKCLWEALAD 473

Query: 370 I 370
           +
Sbjct: 474 V 474

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 125/478 (26%), Positives = 200/478 (41%), Gaps = 83/478 (17%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y  LG+K ++++ ++K+AY  LA  YHPD     ++ A +E KF ++  AY+ILSDE
Sbjct: 46  KDPYETLGVKKSSSQSDIKKAYYKLAKKYHPDI----NKEAGAEKKFHDLQNAYEILSDE 101

Query: 63  QKRSEYDHYGRFDEGSF----------------PFGD-FDDDYKRGNE---------DFM 96
            KR +YD +G                       PFG+ F  D+  G           +F 
Sbjct: 102 SKRKQYDQFGAAAFSGGAGAGPGGPGAGPGGFNPFGNGFGFDFSGGQAGGAGGFGGINFE 161

Query: 97  NFF--RYGAGRYGQYEDAEQKTSQKTKDFV-----VPLKLSTKQLYLG-KTFQFKLKRNV 148
           + F   +G G +G   ++ +++S   +++      V   L  K    G K    K +   
Sbjct: 162 DLFGTAFGGGPFGSSSNSGRRSSSMFREYKGDTIEVIQNLDFKDAVFGKKNVSIKFRALD 221

Query: 149 LCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVS 208
            C  C G GL+  A+      C  C G G       +  GF  +    C  C G+GT V 
Sbjct: 222 PCGTCNGSGLKSGASKTT---CPSCHGSG---TTVHVRAGF--QMMSTCQTCGGEGTTV- 272

Query: 209 RDPSDNCKKCHGKCVIVENS-ILTLYVPRGHRHADTIRIDGQA---DMEAGKET------ 258
            + SD CK CHG+ V V     +T+ +P G +  D +RI GQ    D+   KE       
Sbjct: 273 -NASDFCKSCHGEGVNVNTQKTITVDLPHGLQDGDVVRIPGQGSYPDIAVDKEMAKSVKL 331

Query: 259 --GDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPS 316
             GD++  I    DP   ++ K  D+  +  I +  A  G T  +  T +   +RI +P+
Sbjct: 332 SRGDILVRIRVNKDPHFSIKNK-YDIWYTKEIPITTAALGGTVSIP-TIEGTKIRIKVPA 389

Query: 317 GKVLRPGNYLKFTNEGWPINNGSRF------GDLYV--KVNIEFPKDN-----W------ 357
           G    P   +   N G P ++  R       GD+ +  KV I  P+       W      
Sbjct: 390 GTA--PEQVISIPNMGVPKSSPYRNSAVQARGDMKIQYKVVIRKPQSKAEQCLWEALADV 447

Query: 358 LNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQEGQ 415
            N+ +    ++     ++ S      D D+  +     +Y   +D+S  PD  +  G+
Sbjct: 448 TNDTNAKRTMESFASSVEKSVEDKLSDNDNKTSNNSKETYNTTEDNSMNPDAPSTLGR 505

>Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON}
           (23785..25272) [1488 nt, 496 aa]
          Length = 495

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 107/405 (26%), Positives = 169/405 (41%), Gaps = 57/405 (14%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y  LG+  +A++ E+K+AY  LA  YHPD     ++  ++E  F  +  AY+ILSDE
Sbjct: 55  KDPYKTLGVARSASQSEIKKAYYKLAKKYHPDI----NKEPDAEKTFHNLQNAYEILSDE 110

Query: 63  QKRSEYDHYG--RFDEGSFPFG---------------------DFDDDYKRGNEDFMNFF 99
            KR+++D +G   F + + P G                        +D            
Sbjct: 111 DKRAQFDQFGASAFSQNAGPSGGSGGFNPFANGNGGGFGDFGGLNFEDLFGAAFGGGASG 170

Query: 100 RYGAGRYGQYEDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVL--CSKCEGLG 157
           R   G +G   +  ++    T + +    LS K    G      L  N L  C  C G G
Sbjct: 171 RSNGG-FGSRVNMVREYKGDTIEII--HNLSFKDAVFGVN-NVSLTFNALDPCDTCHGSG 226

Query: 158 LRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKK 217
           L+K   H     C  C+G G +  V     GF  +    C+ C G+GT+++ +  D C K
Sbjct: 227 LKKGENH-KRRSCSYCNGTGTQIHVRS---GF--QMASTCNHCHGEGTIIAFE--DMCTK 278

Query: 218 CHGKCVIVE-NSILTLYVPRGHRHADTIRIDGQADM------EAGKE-----TGDLVFEI 265
           CHG  V ++    + + +P      D IRI G+         E  K+      GDL+  I
Sbjct: 279 CHGDGVKLDAQKKINVNLPSSLSDGDVIRIPGEGSFPNIAVPEEDKDRVKLSRGDLLVRI 338

Query: 266 DEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNY 325
               DPD  ++ K  D+     I +  A  G T +  +T DD+ +R+ + +G   +    
Sbjct: 339 RVKPDPDYTIKNK-YDIWSVKEIPITTAALGGT-ITIKTIDDKQIRLKVMAG--TQHDQV 394

Query: 326 LKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHI 370
               N G P  NG   GD+ ++  +   K +   E    EA+  +
Sbjct: 395 TSIPNMGVPRRNGLGRGDMKIQYKVVIRKPSTEVETCLWEALADV 439

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 84.3 bits (207), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 109/411 (26%), Positives = 165/411 (40%), Gaps = 62/411 (15%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y  LG+K +AT  E+K+AY  LA  YHPD     ++  ++E KF ++  AY+ILSD+
Sbjct: 60  KDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDI----NKEPDAEKKFHDLQNAYEILSDD 115

Query: 63  QKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRY----GAGRYG--QYEDAEQKT 116
            KR ++D +G    G    G            F +F  +    G   +G   +ED     
Sbjct: 116 TKRQQFDQFGPAAFGGGGGGGAGGAGSPFGSQFHDFSGFTNASGGSPFGGINFEDLFGAA 175

Query: 117 SQ------------------------KTKDFVVPLKLSTKQLYLG-KTFQFKLKRNVLCS 151
                                     +     +  K+S K    G K  Q K      C 
Sbjct: 176 FGGGGAGAGAGRGGSGGRSSPMYRQYRGDPIEIVHKVSFKDAVFGAKNVQLKFSALDPCG 235

Query: 152 KCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDP 211
            C G G++    +   + C  C G G       +  GF  +    C  C+G+GT+  + P
Sbjct: 236 TCSGTGMK---PNTHKVSCTTCHGSG---STVHVRGGF--QMMSTCPTCNGEGTM--KRP 285

Query: 212 SDNCKKCHGKCVIVE-NSILTLYVPRGHRHADTIRIDGQ---------ADMEAGKET--G 259
            DNC  CHG+ V       +T+ +P G +  D +RI GQ         AD++   +   G
Sbjct: 286 QDNCTSCHGEGVQANRGKSITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLQDSIKLSRG 345

Query: 260 DLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKV 319
           D++  I    DP   +  K  D+     I +  A  G T +   T D + +RI +  G  
Sbjct: 346 DILVRIRVDKDPSFSIRNK-YDIWYDKEIPITTAALGGT-ITIPTVDGQKIRIKVAPG-- 401

Query: 320 LRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHI 370
            +    +   N G P     R GD+ V+  I   K   L EK   EA+  +
Sbjct: 402 TQYNQVISIPNMGVPRTATLR-GDMKVQYKIVVKKPQSLAEKCLWEALADV 451

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 118/426 (27%), Positives = 177/426 (41%), Gaps = 91/426 (21%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y VLGI  +AT  E+K+AY  LA  YHPD     ++   +E KF ++  AY+ILSDE
Sbjct: 50  KDPYKVLGINKSATSSEIKKAYYKLAKKYHPDI----NKEPTAEKKFHDLQNAYEILSDE 105

Query: 63  QKRSEYDHYGR--FDE-GS----------------------FPFGDFDDDYKRGNEDFMN 97
            K+S+YD +G   F++ GS                       PF DF  ++    ED   
Sbjct: 106 TKKSQYDTFGSAAFNQDGSGGASSANNPFAGGFSSSGGPGGNPFTDFGINF----EDLFG 161

Query: 98  FFRY-------------GAGRYGQYEDAEQKTSQKTKDFVVPLKLSTKQLYLGKTF---Q 141
                            GA R   Y + +            PL+++ +  +    F    
Sbjct: 162 AAFGGGAGTGPGGARSGGARRSNMYREFKGD----------PLEITHRIPFKDAVFGLAN 211

Query: 142 FKLKRNVL--CSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDE 199
             LK NV+  C  C G G+++ A      +C  C G G K     I  GF  +    C+E
Sbjct: 212 VSLKYNVMDPCHTCHGSGIKQGA---QKHQCPSCHGSGQK---VHIRSGF--QMVSTCNE 263

Query: 200 CDGKGTVVSRDPSDNCKKCHGKCV-IVENSILTLYVPRGHRHADTIRIDGQAD---MEAG 255
           C G+GT++  + SD C  CHG  V    +  + + +P G +  D IRI GQ +   M   
Sbjct: 264 CHGEGTIL--NASDYCGTCHGDAVEFTRDHSINVNLPNGLQDGDVIRIPGQGNYPQMALD 321

Query: 256 KET--------GDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDD 307
            E         GD++  I    D    ++ K  D+  +  I +  A  G    +  T D 
Sbjct: 322 PELKNSVKLTRGDVLVRIRVDKDNRFSIKDK-YDIWFTKDIPITTAALGGIVTIP-TVDG 379

Query: 308 RLLRITIPSGKVLRPGNYLKFTNEGWP---INNGSRFGDLYVKVNIEFPKDNWLNEKSEL 364
             LR+ + +G   +    +   N G P   IN  +R G++ V+  I   K     EK   
Sbjct: 380 TTLRLKVQAG--TQHDQVISIPNLGVPRSSINKENR-GNMKVQYRIVIRKPQSQAEKCLW 436

Query: 365 EAIKHI 370
           EA+  +
Sbjct: 437 EALADV 442

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 102/230 (44%), Gaps = 16/230 (6%)

Query: 112 AEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCG 171
           ++ K  ++  D    LK +   LY GK  + +L+R   C KC+G G     +      C 
Sbjct: 222 SDDKNLKRGPDIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIKS------CS 275

Query: 172 ICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILT 231
            C+GRG   +  +  P   +  +  CD C G GT    D  D C +C G+  + E  I  
Sbjct: 276 KCNGRGSLTQTKKFGPMTQTFTQT-CDGCGGNGTFA--DAQDICNECQGEGFLNEKKIFE 332

Query: 232 LYVPRGHRHADTIRIDGQAD----MEAGKE---TGDLVFEIDEITDPDAELERKGTDLHC 284
           + +  G      I + G+AD       GKE    GD++  I+ + DP  ++ +    L+ 
Sbjct: 333 VEITPGMTDGQLIILTGEADEVISTNLGKERVIPGDIILTINLLPDPTFKVVQGADLLYA 392

Query: 285 SITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP 334
           +  I+L  +L G +  +     + L++I I  G++++ G      N G P
Sbjct: 393 NYKINLLTSLCGGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMP 442

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +L ++ ++ E  +K+AYR LAL YHPDK    +   ES+  F++IS AY +LS++ K
Sbjct: 7  LYDILQVRYDSDESVIKKAYRTLALKYHPDK---NNLSEESKQMFQKISEAYVVLSNKDK 63

Query: 65 RSEYDHYGRFD 75
          R  YD YG  D
Sbjct: 64 RQMYDKYGTVD 74

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LGI  +A EQE+K+ YR  AL YHPDK + +++      KFKEIS A++ILSD QK
Sbjct: 7  LYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REVYDQYG 68

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 261 LVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKV- 319
           L F I E   P     R G DL  ++ ++  E+L GF + + +T D R    T+P  ++ 
Sbjct: 246 LQFIIQEKKHP--FFTRDGNDLIYTLPLTFKESLLGFNKTI-QTIDGR----TLPVSRIQ 298

Query: 320 -LRPGNYLKFTNEGWPI--NNGSRFGDLYVKVNIEFP 353
            ++P     +  +G PI    G R GD+ V   +++P
Sbjct: 299 PIQPSEKSTYPGQGMPIPKTPGQR-GDMIVNYKVDYP 334

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q752R6 Ashbya gossypii AFR507W
           AFR507Wp and some similarites with YFL016C
           uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 462

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 110/411 (26%), Positives = 167/411 (40%), Gaps = 56/411 (13%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y  LG+  +A+  E+K+AY  LA  YHPD I+ E    +   KF ++  AY+ILSD 
Sbjct: 32  KDPYDTLGVGKSASPSEIKKAYYKLAKKYHPD-INKEQGAGD---KFHDLQNAYEILSDA 87

Query: 63  QKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYEDAEQKTSQKTKD 122
            K+S+YD +G    G    G        G   F +F  +G      +ED           
Sbjct: 88  DKKSQYDQFGAAAFGQGGAGGGPGGPGAGYGGFSDFSGFGNFGGINFEDLFGAAFGGGGG 147

Query: 123 FVV----------------PLKLSTKQLYLGKTFQFK---LKRNVL--CSKCEGLGLRKR 161
                              P+++S +  +    F  K   LK   L  C  C+G G++  
Sbjct: 148 RSSRGSPFGSSMFREYRGDPIEVSYRMPFKDAVFGAKDVNLKFRALDPCHTCDGSGMKTG 207

Query: 162 AAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGK 221
           A    P  C  C G G       +  GF  +    C +C G+GT   R+  D C  CHG 
Sbjct: 208 AK---PQSCPSCHGTG---TTVHVRAGF--QMATTCQQCGGEGTTTKRE--DLCGSCHGD 257

Query: 222 CV-IVENSILTLYVPRGHRHADTIRIDGQA---DMEAGKET--------GDLVFEIDEIT 269
            V   ++  + + +P+G +  D +R+ GQ    +M    E         GD++  I    
Sbjct: 258 GVEWTKDKSVRVDLPQGLQDGDVVRVPGQGSYPNMAVPPEMKSSIRLRRGDVLVRIRVDK 317

Query: 270 DPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFT 329
           DP   + R   D+     I +  A  G T  V  T D   +R+ +  G   +    +   
Sbjct: 318 DPRFSI-RDKWDIWFIQDIPITTAALGGTVQVP-TVDGSHVRLRVQPG--TQHDQIISIP 373

Query: 330 NEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHILPGLKNSSNS 380
           N G P   G+R G + V+  I+  K     E+   EA+ +I     N SN+
Sbjct: 374 NMGVPRVAGTR-GSMKVQYKIQVKKPQSKAERCLWEALANIT----NDSNA 419

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+  +A EQE+K+ YR  AL YHPDK + +++      KFK+IS AY+ILSD  K
Sbjct: 7  LYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKQISEAYEILSDSNK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 52/95 (54%), Gaps = 8/95 (8%)

Query: 261 LVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVL 320
           L F IDE   P    +R+  +L C++ ++  E+L GF++ V +T D R L I+    + +
Sbjct: 258 LQFIIDE--KPHPTFQREDDNLVCTVPLTFKESLLGFSKTV-QTIDGRNLPIS--RSQPI 312

Query: 321 RPGNYLKFTNEGWPINN--GSRFGDLYVKVNIEFP 353
           +P    ++  +G PI+   G R GDL VK  I +P
Sbjct: 313 QPTEITRYPGQGMPISKKPGQR-GDLIVKYKIAYP 346

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (70%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+ S+A++ E+K+ YR  AL YHPDK + +++      KFKEIS A++ILSD  K
Sbjct: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSNK 60

Query: 65 RSEYDHYG 72
          RS YD YG
Sbjct: 61 RSVYDQYG 68

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+  +A EQE+K+ YR  AL YHPDK + +++      KFKEIS A++IL+D QK
Sbjct: 7  LYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 68/144 (47%), Gaps = 18/144 (12%)

Query: 216 KKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQADMEAGKETG---DLVFEIDEITDPD 272
           K  HG     E + + + +  G +    I    Q D     +TG    L F I E + P+
Sbjct: 206 KGPHGAS---EKTQIDIQLKPGWKAGTKITYKNQGDYNP--QTGRRKTLQFVIQEKSHPN 260

Query: 273 AELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKV--LRPGNYLKFTN 330
              +R G DL  ++ +S  E+L GF++ + +T D R    T+P  +V  ++P     +  
Sbjct: 261 --FKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGR----TLPLSRVQPVQPSQTSTYPG 313

Query: 331 EGWPI-NNGSRFGDLYVKVNIEFP 353
           +G P   N S+ G+L VK  +++P
Sbjct: 314 QGMPTPKNPSQRGNLIVKYKVDYP 337

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+   A EQE+K+ YR  AL YHPDK + +++      KFKEIS A++IL+D QK
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REIYDQYG 68

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+   A EQE+K+ YR  AL YHPDK + +++      KFKEIS A++IL+D+QK
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTE------KFKEISEAFEILNDKQK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query: 261 LVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVL 320
           L F I E T P    +R G DL  ++ ++  E+L GF++ + +T D R L ++  S   +
Sbjct: 260 LQFVIQEKTHP--LYKRNGDDLEYTLPLTFKESLLGFSKTI-QTIDGRTLPLSRSS--PV 314

Query: 321 RPGNYLKFTNEGWPINN-GSRFGDLYVKVNIEFP 353
           +P    ++  +G P+    S+ GDL V+  I++P
Sbjct: 315 QPTETSRYPGQGMPMPKMPSQRGDLVVRFKIDYP 348

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+   A EQE+K+ YR  AL YHPDK + +++      KFKEIS A++IL+D QK
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 68/144 (47%), Gaps = 18/144 (12%)

Query: 216 KKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQADMEAGKETG---DLVFEIDEITDPD 272
           K  HG     E + + + +  G +    I    Q D     +TG    L F I E + P+
Sbjct: 220 KGPHGAS---EKTQIDIQLKPGWKAGTKITYKNQGDYNP--QTGRRKTLQFVIQEKSHPN 274

Query: 273 AELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKV--LRPGNYLKFTN 330
              +R G DL  ++ +S  E+L GF++ + +T D R    T+P  +V  ++P     +  
Sbjct: 275 --FKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGR----TLPLSRVQPVQPSQTSTYPG 327

Query: 331 EGWPI-NNGSRFGDLYVKVNIEFP 353
           +G P   N S+ G+L VK  +++P
Sbjct: 328 QGMPTPKNPSQRGNLIVKYKVDYP 351

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/74 (52%), Positives = 49/74 (66%), Gaps = 8/74 (10%)

Query: 1  MGKD--LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDI 58
          M KD  LY +LGI  +A E E+K+ YR  AL YHPDK + +++      KFKEIS A++I
Sbjct: 1  MVKDTKLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEI 54

Query: 59 LSDEQKRSEYDHYG 72
          LSD QKR  YD YG
Sbjct: 55 LSDAQKREVYDTYG 68

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 64/138 (46%), Gaps = 11/138 (7%)

Query: 220 GKCVIVENSILTLYVPRGHRHADTIRIDGQADME---AGKETGDLVFEIDEITDPDAELE 276
           G   + E + + + +  G +    I   G+ D      G++T   V +      P     
Sbjct: 209 GAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVLQ----EKPHEFFT 264

Query: 277 RKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPIN 336
           R+  DL  ++ +S  E+L GF++ V +T D + + IT    + ++P     +  +G  ++
Sbjct: 265 RQDNDLIYTLPLSFKESLLGFSKQV-QTIDGKTIPIT--RTQPIQPTQTSTYPGQGMTLS 321

Query: 337 -NGSRFGDLYVKVNIEFP 353
            N S+ GDL +K  I++P
Sbjct: 322 KNPSQRGDLIIKFKIDYP 339

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+   A EQE+K+ YR  AL YHPDK + +++      KFKEIS A++IL+D QK
Sbjct: 7  LYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 10/96 (10%)

Query: 261 LVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKV- 319
           L F I E + P+   +R G DL  ++ +S  E+L GF++ + +T D R    T+P  +V 
Sbjct: 256 LQFVIQEKSHPN--FKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGR----TLPLSRVQ 308

Query: 320 -LRPGNYLKFTNEGWPI-NNGSRFGDLYVKVNIEFP 353
            ++P     +  +G P   N S+ G+L VK  +++P
Sbjct: 309 PVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 344

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+   A EQE+K+ YR  AL YHPDK + +++      KFKEIS A++IL+D QK
Sbjct: 7  LYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REIYDQYG 68

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 68/144 (47%), Gaps = 18/144 (12%)

Query: 216 KKCHGKCVIVENSILTLYVPRGHRHADTIRIDGQADMEAGKETG---DLVFEIDEITDPD 272
           K  HG     E + + + +  G +    I    Q D  +  +TG    L F I E   P+
Sbjct: 222 KGPHGAA---EKTQIDIQLKPGWKAGTKITYKNQGDFNS--QTGRRKTLQFVIQEKGHPN 276

Query: 273 AELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKV--LRPGNYLKFTN 330
              +R G DL  ++ +S  E+L GF++ + +T D R    T+P  +V  ++P     +  
Sbjct: 277 --FKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGR----TLPLSRVQPVQPSQTSTYPG 329

Query: 331 EGWPI-NNGSRFGDLYVKVNIEFP 353
           +G P   N S+ G+L VK  +++P
Sbjct: 330 QGMPTPKNPSQRGNLIVKYKVDYP 353

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+  +A EQE+K+ Y+  AL YHPDK + +++      KFKEIS AY+ILSD  K
Sbjct: 7  LYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTE------KFKEISEAYEILSDSSK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REIYDQYG 68

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+  +A +QE+K+ YR  AL YHPDK +  ++      KFK+IS AY+ILSD  K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNTE------KFKQISEAYEILSDSNK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REVYDQYG 68

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+  +A +QE+K+ YR  AL YHPDK + +++      KFKEIS A++ILSD+ K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDKNK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REVYDQYG 68

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 67/138 (48%), Gaps = 11/138 (7%)

Query: 220 GKCVIVENSILTLYVPRGHRHADTIRIDGQAD---MEAGKETGDLVFEIDEITDPDAELE 276
           G+  I E + + + +  G +    I    Q D      G++T  L F + E   P    +
Sbjct: 214 GQGGIPEKTQIDIQLKPGWKAGTKITYKSQGDYNPQTGGRKT--LQFMLQEKNHP--VFK 269

Query: 277 RKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPI- 335
           R+G DL C++ ++  E+L GF + + +T D R L I+    + ++P     +  +G PI 
Sbjct: 270 REGDDLTCTLPLTFKESLLGFNKQI-QTIDGRTLPIS--RTQPIQPSETSVYPGQGMPIP 326

Query: 336 NNGSRFGDLYVKVNIEFP 353
              S+ G+L V+  I++P
Sbjct: 327 KTPSQRGNLIVRYKIDYP 344

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +L +   A EQE+K+ YR  AL YHPDK + +++      KFKEIS A++ILSD +K
Sbjct: 7  LYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAEK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REVYDQYG 68

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +L ++  A EQE+K+ YR  AL YHPDK + +++      KFKEIS A++IL+D QK
Sbjct: 7  LYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REIYDQYG 68

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+  +A +QE+K+ YR  AL YHPDK +  ++      KFKEIS A++ILSD  K
Sbjct: 7  LYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTE------KFKEISEAFEILSDSNK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REVYDQYG 68

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 8/74 (10%)

Query: 1  MGKD--LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDI 58
          M KD  LY +LG+  +A E E+K+ YR  AL YHPDK S +++      KFKEIS A++I
Sbjct: 1  MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDAE------KFKEISEAFEI 54

Query: 59 LSDEQKRSEYDHYG 72
          L+D QKR  YD YG
Sbjct: 55 LNDPQKREVYDTYG 68

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 46/84 (54%), Gaps = 4/84 (4%)

Query: 271 PDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTN 330
           P +   R G DL  S+ ++  E+L GF++ + +T D R L I+    + ++P +   +  
Sbjct: 258 PHSNYTRDGNDLIYSLPLTFKESLLGFSKTI-QTIDGRTLPIS--RVQPVQPSDSSTYPG 314

Query: 331 EGWPI-NNGSRFGDLYVKVNIEFP 353
           +G PI    S+ G+L VK  I++P
Sbjct: 315 QGMPIAKTPSQRGNLIVKYKIDYP 338

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (67%), Gaps = 8/74 (10%)

Query: 1  MGKD--LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDI 58
          M KD  LY +LG+  +A E E+K+ YR  AL YHPDK + +++      KFKEIS A++I
Sbjct: 1  MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAE------KFKEISEAFEI 54

Query: 59 LSDEQKRSEYDHYG 72
          L+D QKR  YD+YG
Sbjct: 55 LNDPQKREIYDNYG 68

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 271 PDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTN 330
           P     R G DL  ++ ++  E+L GF + + +T D R L I+    + ++P +   +  
Sbjct: 255 PHENYTRDGNDLIYTLPLTFKESLLGFNKTI-QTIDGRTLPIS--RVQPVQPSDVSTYPG 311

Query: 331 EGWPI-NNGSRFGDLYVKVNIEFP 353
           +G P+  N S+ G+L VK  I++P
Sbjct: 312 QGMPVAKNPSQRGNLIVKYKIDYP 335

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+  +A E E+K+ YR  AL YHPDK + +++      KFKEIS A++IL+D QK
Sbjct: 7  LYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REIYDSYG 68

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LGI + AT+ E+K+AYR  ++  HPDK  ++    E   +F+ IS AY +LSD+Q R
Sbjct: 8  YDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATE---RFQAISEAYQVLSDKQLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          S YD YG+  E + P G F+D
Sbjct: 65 SNYDKYGK--EKAIPSGGFED 83

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 117/448 (26%), Positives = 175/448 (39%), Gaps = 73/448 (16%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y VLG+  +A   E+K+AY  LA  YHPD   D+     S+ KF +I+ AY+ILSDE
Sbjct: 46  KDPYKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKG----SDKKFHDITNAYEILSDE 101

Query: 63  QKRSEYDHYGR-------------------FDEGSFPFGDFDDD-YKRGNEDFMNFFRYG 102
           +K+ +YD +G                    F  G+ PF +   + +  G  +F + F   
Sbjct: 102 KKKMQYDQFGSAAFDNSQGGGSGGFSGGNPFAGGANPFANAGGNPFGFGGINFEDLFGAA 161

Query: 103 AGRYGQYEDAEQKT--------------SQKTKDFV-VPLKLSTKQLYLG-KTFQFKLKR 146
             +                         S+   D V V   LS K    G +     +  
Sbjct: 162 FSKANGAAGRGGGRSSGRGNGSPFGGFYSEVRGDNVEVIHTLSFKDAVFGSRNVTLNVSS 221

Query: 147 NVLCSKCEGLGLRKRAAHCMPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTV 206
              C  C G G++  +      +C  C G G       +  GF  +    C  C G G  
Sbjct: 222 IEQCKTCTGSGMKPGSHRS---ECSSCHGTG---TTVHVRAGF--QMASTCMSCGGTGEN 273

Query: 207 VSRDPSDNCKKCHGKCVIVENSILTLYV--PRGHRHADTIRIDGQA---DMEAGKET--- 258
           ++R+  D C+ C G+         T+ V  P G    D IR+ GQ    ++    E    
Sbjct: 274 IARE--DVCRNCDGEGTEPRPVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAPEQRDQ 331

Query: 259 -----GDLVFEIDEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRIT 313
                GDL+  I    D    + R G +L  +  I +  A+ G   +V  T D   LR+ 
Sbjct: 332 VKVTRGDLLVRIRVKQDKVFSI-RNGNELWQTREIPVTTAVLG-GNVVIPTLDGNQLRLR 389

Query: 314 IPSGKVLRPGNYLKFTNEGWPINNG--SRFGDLYVKVNIEFPKDNWLNEKSELEAIKHIL 371
           + SG   R G  +    +G P   G  SR GD+ V+  +         E+   EA+  + 
Sbjct: 390 VRSG--TRDGETVSVPGQGVPRGRGGLSR-GDMKVQWRVPVRTPKTAVERCLWEALADVT 446

Query: 372 --PGLKNSSNSHQGDGDDPA-NTEDINS 396
              G   S +  + D D  A NT+  NS
Sbjct: 447 NDSGASRSPDHVRLDTDSSAGNTKSSNS 474

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 57/94 (60%), Gaps = 13/94 (13%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LGI+ +A+  E+K+AYR  A++ HPDK  D+    E++AKF+ I  AY +LSD + R
Sbjct: 8  YDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDP---EAQAKFQAIGQAYQVLSDPELR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF 99
          S YD +G+  E + P        ++G ED   FF
Sbjct: 65 SRYDEFGK--EDAVP--------QQGFEDAAEFF 88

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 56/94 (59%), Gaps = 9/94 (9%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y VLG++  AT  E+K+AYR  A+  HPDK  D+    E++AKF+E+  AY +LSD   R
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDP---EAQAKFQEVGEAYQVLSDPGLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF 99
          S YD +G+ DE + P   F+D     NE F   F
Sbjct: 65 SRYDEFGK-DE-AVPQQGFED----ANEYFTAIF 92

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 46/68 (67%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+  +A++ E+K+ YR  AL YHPDK + +++      KFKEIS A++ILSD  K
Sbjct: 7  LYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPNK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REVYDTYG 68

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 67/138 (48%), Gaps = 11/138 (7%)

Query: 220 GKCVIVENSILTLYVPRGHRHADTIRIDGQADME---AGKETGDLVFEIDEITDPDAELE 276
           G+  I E   + + +  G +    I    + D      G++T  + F I E   P    +
Sbjct: 204 GQTGIPEKKQIDIQLRPGWKAGTKITYKNEGDYNPSTGGRQT--IQFIIQE--KPHEFFK 259

Query: 277 RKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPIN 336
           R G DL  ++ ++  E+L GF + V RT D R  +I+I   + ++P   +++  +G P++
Sbjct: 260 RDGNDLIYTLPLTFKESLLGFDKTV-RTIDGR--QISIHKTQPVQPSEEMRYPGQGMPLS 316

Query: 337 -NGSRFGDLYVKVNIEFP 353
            N S  GDL VK   ++P
Sbjct: 317 KNPSERGDLIVKYKTDYP 334

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 56/92 (60%), Gaps = 12/92 (13%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS--DESQRAESEAKFKEISAAYDILS 60
           K+ Y VLG+   AT ++++++Y ++   YHPDK     E+Q+ +++ K  EI+ AY+ILS
Sbjct: 504 KNYYKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILS 563

Query: 61  DEQKRSEYD--HYGR--------FDEGSFPFG 82
           DE KR EYD    GR        F +G FPFG
Sbjct: 564 DEGKRKEYDDQRSGRAPQGQGSPFGQGGFPFG 595

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y VLG++ +AT +++K+AYR  A+  HPDK  ++    E++AKF+E+S AY +LSD + R
Sbjct: 8  YDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPND---PEAQAKFQEVSKAYKVLSDGELR 64

Query: 66 SEYDHYGRFDE 76
          S YD  G  DE
Sbjct: 65 SRYDEVGLSDE 75

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 56/88 (63%), Gaps = 7/88 (7%)

Query: 1  MGKDL--YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDI 58
          M KD+  Y VLGI+ +AT  E+K+AYR  A+  HPDK  D+    ++++KF+ +  AY +
Sbjct: 1  MVKDMEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDD---PDAQSKFQAVGEAYQV 57

Query: 59 LSDEQKRSEYDHYGRFDEGSFPFGDFDD 86
          LSD Q +S YD +G+ D  + P   F+D
Sbjct: 58 LSDPQLKSRYDQFGKDD--AVPQAGFED 83

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 52/83 (62%), Gaps = 5/83 (6%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          + Y VLGI   AT  E+K+AYR +A++ HPDK  D+    E++AKF+ +  AY +L+D  
Sbjct: 6  EFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDP---EAQAKFQAVGEAYQVLNDPA 62

Query: 64 KRSEYDHYGRFDEGSFPFGDFDD 86
           R +YD +G+  + + P   F+D
Sbjct: 63 LRKQYDEFGK--DNAVPQQGFED 83

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y VLG+   AT  E+K+AYR  A+  HPDK  D+    E+E KF+ +  AY +LSD + R
Sbjct: 8  YDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDP---EAETKFQAVGEAYQVLSDTELR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          S YD +G+ D  + P   F+D
Sbjct: 65 SRYDQFGKDD--AVPQQGFED 83

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 9/99 (9%)

Query: 1  MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
          +  + Y +LG++ N+T+ E+K+AYR  ++  HPDK        ++  KF+ IS AY +LS
Sbjct: 3  VNTEYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDK---NPNNPDATKKFQAISEAYQVLS 59

Query: 61 DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF 99
          D+  RS YD +G+  + + P G F+D     NE F   F
Sbjct: 60 DKNLRSNYDKFGK--DKAIPKGGFED----ANEQFTAMF 92

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
          LY +LG+  N  + E+K+ YR  AL YHPDK + +++      KFKEIS A++IL+D  K
Sbjct: 7  LYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPNK 60

Query: 65 RSEYDHYG 72
          R  YD YG
Sbjct: 61 REVYDKYG 68

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 4/80 (5%)

Query: 275 LERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWP 334
           L+R G DL  ++ +S  E+L GF++ V  T D R  +I I   + ++P    ++  +G P
Sbjct: 256 LKRDGNDLTYTLPLSFKESLLGFSKTV-HTIDGR--QIFISKTQPVQPSEESRYPGQGMP 312

Query: 335 IN-NGSRFGDLYVKVNIEFP 353
           ++ N S  GDL VK  I++P
Sbjct: 313 LSKNPSERGDLIVKYKIDYP 332

>ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]
           {ON} weakly similar to uniprot|P40358 Saccharomyces
           cerevisiae YJL073W JEM1 DnaJ-like chaperone required for
           nuclear membrane fusion during mating localizes to the
           ER membrane exhibits genetic interactions with KAR2
          Length = 584

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 4/70 (5%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDK---ISDESQRAESEAKFKEISAAYDIL 59
           KD Y +L I  NA  +E+++AY N   MYHPDK   +S+E Q+   E K  EI+ AY+ L
Sbjct: 474 KDYYKILNIPKNANAKEIRKAYLNFTKMYHPDKQGQLSEEQQKKNDE-KMSEINEAYETL 532

Query: 60  SDEQKRSEYD 69
           SDE KR EYD
Sbjct: 533 SDEGKRREYD 542

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LGIK  AT  E+K+AYR  A+  HPDK  D+    +++AKF+ +  AY +LSD+  R
Sbjct: 8  YDILGIKPEATATEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDQGLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          S+YD +G+  E + P   F+D
Sbjct: 65 SKYDEFGK--EDAVPQQGFED 83

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LGIK +AT  E+K+AYR  A+  HPDK  D+    +++AKF+ +  AY +LSD   R
Sbjct: 8  YDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          S+YD +G+  E + P   F+D
Sbjct: 65 SKYDEFGK--EDAVPQQGFED 83

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 52/94 (55%), Gaps = 9/94 (9%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y  LGI   AT  E+K+AYR  A+  HPDK  D+    E+E KF+ +  AY +LSDE  R
Sbjct: 8  YDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDP---EAENKFQAVGEAYQVLSDESLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF 99
          + YD YG+ D  + P   F+D     NE F   F
Sbjct: 65 ARYDEYGKDD--AVPQQGFED----ANEYFTVIF 92

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 51/81 (62%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LGIK  AT  E+K+AYR  A+  HPDK  D+    +++AKF+ +  AY +LSD   R
Sbjct: 8  YDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          S+YD +G+  E + P   F+D
Sbjct: 65 SKYDEFGK--EDAVPQQGFED 83

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 53/83 (63%), Gaps = 3/83 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+++NAT+ E+K+AYR  AL +HPDK  D  +  E+ A F  + AAY++L+D Q+R
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDKNPDNVE--ETTAIFASVRAAYEVLADPQER 63

Query: 66 SEY-DHYGRFDEGSFPFGDFDDD 87
          + Y DH  +    S    D DD+
Sbjct: 64 AWYDDHKEQILNDSVNLDDADDE 86

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 51/81 (62%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LGIK  AT  E+K+AYR  A+  HPDK  D+    +++AKF+ +  AY +LSD   R
Sbjct: 8  YDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          S+YD +G+  E + P   F+D
Sbjct: 65 SKYDQFGK--EDAVPQQGFED 83

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (59%), Gaps = 13/94 (13%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG++ +A+  ++K+AYR  A++ HPDK  D+    E++AKF+ I  AY +LSD   R
Sbjct: 8  YDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDP---EAQAKFQAIGEAYQVLSDPDLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF 99
          S YD +G+  E + P        ++G ED   FF
Sbjct: 65 SRYDEFGK--ENAVP--------QQGFEDAAEFF 88

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 49/81 (60%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+   AT  E+K+AYR  ++  HPDK  D+    E   +F+ IS AY +LSDE  R
Sbjct: 8  YEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDPMATE---RFQAISEAYQVLSDEDLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
           +YD +G+ +  + P G F+D
Sbjct: 65 GKYDRFGKTE--AVPKGGFED 83

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 51/75 (68%), Gaps = 7/75 (9%)

Query: 1  MGKD---LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYD 57
          +GKD    Y VL I+  A++ E+K+AYR LA+  HPDK  ++  RA SEA FK I+ A++
Sbjct: 16 LGKDKHAFYEVLQIEREASDNEIKKAYRKLAIKLHPDK--NKHPRA-SEA-FKRINRAFE 71

Query: 58 ILSDEQKRSEYDHYG 72
          +LSDEQKR  +D  G
Sbjct: 72 VLSDEQKRRIFDQVG 86

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 52/81 (64%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+ + AT  E+K+AYR  ++  HPDK  ++ +  E   +F+ IS AY +L D++ R
Sbjct: 8  YDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDDELR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          ++YD YGR +  + P G F+D
Sbjct: 65 AKYDKYGRKE--AIPQGGFED 83

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG++S+A++ E+K+AYR  AL YHPDK  D  Q  E+  KF  I AAY++LSD Q+R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVQ--EATEKFAIIRAAYEVLSDPQER 63

Query: 66 SEYDHY 71
          + YD +
Sbjct: 64 AWYDSH 69

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LGI   AT+ E+K+AYR  ++  HPDK  ++    E   +F++IS AY +LSDE  R
Sbjct: 8  YDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATE---RFQQISEAYQVLSDEHLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          + YD +G+  E + P   F+D
Sbjct: 65 NNYDQFGK--EQAIPKEGFED 83

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 50/81 (61%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+K  AT  E+K+AYR  A+  HPDK  D+    E+++KF+ +  AY +LSD   R
Sbjct: 8  YDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDP---EAQSKFQAVGEAYQVLSDPGLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          S YD +G+ D  + P   F+D
Sbjct: 65 SRYDEFGKDD--AVPQHGFED 83

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LGI S+A+E+E+K AYR L++ +HPDK++    E +R   E  + +I+ AY+ L+
Sbjct: 119 DPYDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALT 178

Query: 61  DEQKRSEYDHYGRFD 75
           DE  R  +  YG  D
Sbjct: 179 DELTRQNFLKYGHPD 193

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 51/71 (71%), Gaps = 4/71 (5%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDK---ISDESQRAESEAKFKEISAAYDIL 59
           KD Y +LG+  +AT ++V+R+Y  L   +HPDK   ++DE QR ++E K  EI+ AY+IL
Sbjct: 527 KDYYKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDE-QRQKNEEKMAEINEAYEIL 585

Query: 60  SDEQKRSEYDH 70
           SD+ KR++YD+
Sbjct: 586 SDDDKRTKYDN 596

>TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.297
           YJL073W
          Length = 666

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 48/71 (67%), Gaps = 2/71 (2%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDES--QRAESEAKFKEISAAYDIL 59
            KD Y VL I ++AT++E+++AY  L   YHPDK    S  Q+A++ AK   I+ AY+IL
Sbjct: 558 NKDFYKVLSIPTSATDKEIRKAYLLLTKKYHPDKQGQLSPKQQAKNHAKMIAINEAYEIL 617

Query: 60  SDEQKRSEYDH 70
           SDE KR +YD+
Sbjct: 618 SDENKRRDYDN 628

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 4/70 (5%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          + Y +L +   AT+ E+K+AYR LA+  HPDK    S    SEA FK I+ A+++LS+E+
Sbjct: 21 EFYEILRVDKKATDGEIKKAYRKLAIKLHPDK---NSHPRASEA-FKVINRAFEVLSNEE 76

Query: 64 KRSEYDHYGR 73
          KRS YD  GR
Sbjct: 77 KRSIYDRIGR 86

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {ON}
           Anc_7.157
          Length = 482

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 65/120 (54%), Gaps = 13/120 (10%)

Query: 6   YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
           Y +LGI+ +AT+ E+K+AYR  ++  HPDK  ++ Q  E   +F+ IS AY +LSDE  R
Sbjct: 8   YDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQATE---RFQAISEAYQVLSDESLR 64

Query: 66  SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQY--EDAEQKTSQKTKDF 123
            +YD YG+  + + P   F+D      E F   F  G   +  Y  E    K  QKT++ 
Sbjct: 65  LKYDKYGK--KEAIPQNGFED----AAEQFSAIF--GGDAFASYIGELTLLKNLQKTEEL 116

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LG+  ++TE+E+K+AYRNL+L +HPDK+     E +R   E  F +IS AY+ L+
Sbjct: 121 DPYEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEALT 180

Query: 61  DEQKRSEYDHYGRFD 75
           +   +  Y  YG  D
Sbjct: 181 NPATKENYLLYGHPD 195

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 49/70 (70%), Gaps = 4/70 (5%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDK---ISDESQRAESEAKFKEISAAYDIL 59
           K+ Y +LGI ++A  ++++RAY +L   YHPDK   +SD ++RA+ E K   I+ AY++L
Sbjct: 508 KNYYKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSD-AERAKVEEKMSSINEAYEVL 566

Query: 60  SDEQKRSEYD 69
           SDE KR EYD
Sbjct: 567 SDESKRKEYD 576

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG++S+A++ E+K+AYR  AL YHPDK  D  +  E+  KF  I AAY++LSD Q+R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVE--EATEKFAIIRAAYEVLSDSQER 63

Query: 66 SEYDHY 71
          + YD +
Sbjct: 64 AWYDSH 69

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG++S+A++ E+K+AYR  AL YHPDK  D  +  E+  KF  I AAY++LSD Q+R
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVE--EATQKFAIIRAAYEVLSDSQER 63

Query: 66 SEYDHY 71
          + YD +
Sbjct: 64 AWYDSH 69

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +L +KS+AT+ ++KRAYR  AL+YHPDK  + +   E+   F +I AAY++LSD Q+R
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDK--NRNNIEEATEVFAQIRAAYEVLSDAQER 63

Query: 66 SEYDHY 71
          + YD +
Sbjct: 64 AWYDAH 69

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 48/81 (59%), Gaps = 3/81 (3%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESE--AKFKEISAAYDILS 60
           KD Y +LG+  N+  + +++AY NL   YHPDK    SQ+ + +   K  EI+ AY+IL 
Sbjct: 553 KDYYKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILG 612

Query: 61  DEQKRSEYDHYGRFDEGSFPF 81
           DE K+ EYD  GR   G+  F
Sbjct: 613 DESKKKEYDD-GRLGNGNAHF 632

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 5/75 (6%)

Query: 1  MGKDL--YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDI 58
          M KDL  Y VLG+   A+  E+K+AYR  A+  HPDK  D+    +++AKF+ +  AY +
Sbjct: 1  MVKDLEYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDP---DAQAKFQRVGEAYQV 57

Query: 59 LSDEQKRSEYDHYGR 73
          LSDE+ R  YD +G+
Sbjct: 58 LSDEELRKRYDEFGK 72

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 51/83 (61%), Gaps = 5/83 (6%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          + Y VLG+   AT  ++K+AYR  A+  HPDK  D+    E+++KF+ +  AY +LSD  
Sbjct: 6  EYYDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDP---EAQSKFQAVGEAYQVLSDPG 62

Query: 64 KRSEYDHYGRFDEGSFPFGDFDD 86
           RS+YD +G+ D  + P   F+D
Sbjct: 63 LRSKYDQFGKDD--AVPNAGFED 83

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 41/64 (64%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +L I S+AT++E+K+AYR+  L  HPDK++  +    +     +I  AY ILS+ QKR
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 66 SEYD 69
           EYD
Sbjct: 70 GEYD 73

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 45/70 (64%), Gaps = 4/70 (5%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          + Y +L +   AT+ E+K+AYR LA+  HPDK    S     EA FK I+ A+++LS+E+
Sbjct: 21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDK---NSHPKAGEA-FKVINRAFEVLSNEE 76

Query: 64 KRSEYDHYGR 73
          KRS YD  GR
Sbjct: 77 KRSIYDRIGR 86

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 51/81 (62%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG++ +AT  E+K+AYR  A+  HPDK  D+    +++AKF+ +  AY +LSD   R
Sbjct: 8  YDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDP---DAQAKFQAVGEAYQVLSDPGLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          S YD +G+ D  + P   F+D
Sbjct: 65 SRYDEFGKDD--AVPKQGFED 83

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 2/71 (2%)

Query: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS--DESQRAESEAKFKEISAAYDI 58
             KD Y +LGI   AT +++++AY  L   YHPDK     ES++ ++  K  EI+ AY+ 
Sbjct: 556 FNKDYYKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYET 615

Query: 59  LSDEQKRSEYD 69
           LSDE K+SEYD
Sbjct: 616 LSDEAKKSEYD 626

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG++++A++ E+K+AYR  AL YHPDK  D  +  E+  KF  I AAY++LSD Q+R
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDKNPDNVE--EATQKFAVIRAAYEVLSDPQER 63

Query: 66 SEYDHY 71
          + YD +
Sbjct: 64 AWYDSH 69

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDE---SQRAESEAKFKEISAAYDILS 60
           D Y++LG+  +AT++++K AYR L++ +HPDK+S +    +RA  E  + +IS AY+ L+
Sbjct: 123 DPYALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALT 182

Query: 61  DEQKRSEYDHYGRFD 75
           DE  ++ Y  YG  D
Sbjct: 183 DEITKANYLTYGHPD 197

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 5/85 (5%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS--DESQRAESEAKFKEISAAYDILS 60
           K+ Y VL +   AT ++++++Y ++   YHPDK     ESQ+ +++ +  EI+ AY+ILS
Sbjct: 502 KNYYKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILS 561

Query: 61  DEQKRSEYD--HYGRFDE-GSFPFG 82
           DE KR EYD    GR  +   FPFG
Sbjct: 562 DEGKRKEYDDQRAGRGQQRQGFPFG 586

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 40/64 (62%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +L I S+AT++E+KRAYR+  L  HPDK++  +    S     +I  AY ILSD + R
Sbjct: 10 YEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIRSR 69

Query: 66 SEYD 69
           EYD
Sbjct: 70 CEYD 73

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 2/69 (2%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKI-SDESQRAES-EAKFKEISAAYDILS 60
           KD Y +LG+  NA  +E+++AY NL   YHPDKI ++ + + ES      +I+ AY+ LS
Sbjct: 541 KDYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLS 600

Query: 61  DEQKRSEYD 69
           DE KR EYD
Sbjct: 601 DEDKRKEYD 609

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
           Anc_7.157
          Length = 414

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 56/104 (53%), Gaps = 11/104 (10%)

Query: 6   YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
           Y +LGI  +AT  E+K+AYR  ++  HPDK  ++    E   +F+ IS AY +LSD+  R
Sbjct: 8   YELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSDDTLR 64

Query: 66  SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQY 109
            +YD YG+ +  + P G F+D      E F   F  G   +  Y
Sbjct: 65  LKYDKYGKKE--AVPTGGFED----AAEQFSAIF--GGDAFSSY 100

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LGI ++A+E+++K AYR L++ +HPDK+S    E +R   E  + +I+ AY+ L+
Sbjct: 129 DPYELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALT 188

Query: 61  DEQKRSEYDHYGRFD 75
           DE  R  +  YG  D
Sbjct: 189 DEAMRENFLKYGHPD 203

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LGI++ AT  E+K+AYR  ++  HPDK  ++    E   +F+ IS AY +LSD   R
Sbjct: 8  YELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATE---RFQAISEAYQVLSDSDLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          + YD +G+  E + P G F+D
Sbjct: 65 ANYDKFGK--EKAIPKGGFED 83

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 4/85 (4%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +L ++S+A++ ++K+AYR  AL YHPDK  D  +  E+   F EI AAY++LSD Q+R
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVE--EATTIFAEIRAAYEVLSDPQER 63

Query: 66 SEYDHYGRFDEGSFPF--GDFDDDY 88
          + YD +        P    D DDDY
Sbjct: 64 AWYDSHKEQILSDTPLNPNDEDDDY 88

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LGI S+A+++++K AYR L+L +HPDK+     E+ R   EA++ +I+ AY+ L+
Sbjct: 121 DPYELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLT 180

Query: 61  DEQKRSEYDHYGRFD 75
           DE  R  Y  YG  D
Sbjct: 181 DELIRFNYLTYGHPD 195

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 50/81 (61%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y  LGI  +AT  E+K+AYR  A++ HPDK  ++    +++AKF+ +  AY +LSD   R
Sbjct: 8  YDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDP---DAQAKFQAVGQAYQVLSDPGLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          S YD +G+ D  + P   F+D
Sbjct: 65 SRYDEFGKDD--AVPQQGFED 83

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 49/78 (62%), Gaps = 6/78 (7%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +L +  +A+ QE+K++YR LA+  HPDK  D+ Q   ++ KF+E++ AY +L D+  R
Sbjct: 8  YDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQ---AQTKFQELAKAYQVLIDDDLR 64

Query: 66 SEYDHYGRFDE--GSFPF 81
           +YD +G  DE  G  P 
Sbjct: 65 KKYDQFG-LDETNGEIPM 81

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 51/81 (62%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG++  AT+ E+K+AYR  +++ HPDK  D+    E   +F+ IS AY +LS++  R
Sbjct: 8  YDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATE---RFQSISEAYQVLSNKDLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          + YD  G+  E + P G F+D
Sbjct: 65 ANYDKSGK--EKAIPKGGFED 83

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
           {ON} highly similar to uniprot|P40564 Saccharomyces
           cerevisiae YIR004w DJP1
          Length = 425

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 57/99 (57%), Gaps = 10/99 (10%)

Query: 6   YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
           Y +LGI   AT  E+K+AYR  ++  HPDK  ++    E   +F+ IS AY +LS E+ R
Sbjct: 8   YDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLSSEELR 64

Query: 66  SEYDHYGRFDEGSFPFGDFDDDYKR-----GNEDFMNFF 99
           ++YD +G+  + + P G F+D  ++     G E F ++ 
Sbjct: 65  AKYDKFGK--QEAIPKGGFEDAAEQFSAIFGGEAFASYI 101

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 4/70 (5%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          + Y +L +   AT+ ++K+AYR LA+  HPDK    S     EA FK I+ A+++LS+E+
Sbjct: 21 EFYEILKVDRKATDSDIKKAYRKLAIKLHPDK---NSHPKAGEA-FKVINRAFEVLSNEE 76

Query: 64 KRSEYDHYGR 73
          KRS YD  GR
Sbjct: 77 KRSIYDRIGR 86

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           +D Y  LG+  +A+  ++K+AY  LA  +HPD   DE     +E KF ++  AY+ILSDE
Sbjct: 40  RDPYETLGVAKDASASQIKKAYYKLAKQFHPDINKDEG----AEKKFHDLQNAYEILSDE 95

Query: 63  QKRSEYDHY 71
            KR +YD +
Sbjct: 96  NKRRQYDQF 104

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y++LG+ ++AT++EV+ AYR L++ +HPDK++    + QR+E E ++  I+ AY  L+
Sbjct: 116 DPYTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALT 175

Query: 61  DEQKRSEYDHYGRFD 75
           DE  +  Y  +G  D
Sbjct: 176 DEITKENYLKFGHPD 190

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (69%), Gaps = 4/69 (5%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           Y VL I+ +A++ E+K++YR LA+  HPDK  +   RA SEA FK I+ A+++LSDE+K
Sbjct: 25 FYEVLQIERSASDNEIKKSYRKLAIKLHPDK--NPHPRA-SEA-FKVINRAFEVLSDEEK 80

Query: 65 RSEYDHYGR 73
          R  YD  GR
Sbjct: 81 RRLYDRLGR 89

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 51/81 (62%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LGI+ +AT  E+K+AYR  A+  HPDK  D+    ++++KF+ +  AY +LSD+  R
Sbjct: 8  YDILGIQPSATSTEIKKAYRKKAMETHPDKHPDD---PDAQSKFQSVGEAYQVLSDDDLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
            YD +G+  + + P   F+D
Sbjct: 65 KRYDEFGK--DNAVPQHGFED 83

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+ + A+  E+K+AYR  ++  HPDK  ++    E   +F+ IS AY +L D+  R
Sbjct: 8  YDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATE---RFQAISEAYQVLGDDDLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          ++YD YGR +  + P G F+D
Sbjct: 65 AKYDKYGRKE--AIPQGGFED 83

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 49/83 (59%), Gaps = 5/83 (6%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          + Y +LG+K  AT  E+K+AYR  A+  HPDK  ++     ++AKF+ +  AY +LSD++
Sbjct: 6  EYYDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPN---AQAKFQAVGEAYQVLSDDE 62

Query: 64 KRSEYDHYGRFDEGSFPFGDFDD 86
           R  YD  G+  E + P   F D
Sbjct: 63 LRKRYDQLGK--ESAVPQQGFVD 83

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 51/82 (62%), Gaps = 2/82 (2%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+ S+A++ E+K+AYR  AL YHPDK  + ++  E+   F  I  AY++LSD Q+R
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDK--NPTKVEEATEIFATIRTAYEVLSDPQER 63

Query: 66 SEYDHYGRFDEGSFPFGDFDDD 87
          + YD +        P  +++D+
Sbjct: 64 AWYDSHKEQILNDIPLNEYEDE 85

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 4/70 (5%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          + Y +L +   AT+ E+K+AYR LA+  HPDK    +   ++   FK I+ A+++LS+E+
Sbjct: 21 EFYQILKVDKKATDGEIKKAYRKLAIKLHPDK----NPHPKASEAFKIINRAFEVLSNEE 76

Query: 64 KRSEYDHYGR 73
          KR  YD  GR
Sbjct: 77 KRGLYDRIGR 86

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 50/81 (61%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+ + A+  E+K+AYR  ++  HPDK  ++ +  E   +F+ IS AY +L D + R
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPKATE---RFQAISEAYQVLGDNELR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
           +YD YGR +  + P G F+D
Sbjct: 65 VKYDKYGRKE--AIPQGGFED 83

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 52/81 (64%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+ + A+  E+K+AYR  ++  HPDK  ++ +  E   +F+ IS AY +L D++ R
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDLKATE---RFQAISEAYQVLGDDELR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          ++YD +GR +  + P G F+D
Sbjct: 65 AKYDKFGRKE--AIPQGGFED 83

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+++ A++ ++K+AYR  AL+YHPDK  D  +  E+ A F  I AAY++L+D Q+R
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDKNRDNVE--EATAIFATIRAAYEVLADPQER 63

Query: 66 SEYDHY 71
          + YD +
Sbjct: 64 AWYDSH 69

>TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.297
           YJL073W
          Length = 604

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 15/108 (13%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEA--KFKEISAAYDILS 60
           +D Y +LG+   AT ++++RAY +    YHPDK    S++ ES+   K  +I+ AY+ LS
Sbjct: 493 RDYYKILGLPKTATSKDIRRAYLDFTKKYHPDKQGQLSEKEESKIHEKMSQINEAYETLS 552

Query: 61  DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQ 108
           D+ +R EYD        S P                N FR+   R GQ
Sbjct: 553 DDTRRKEYDQARSSGSRSGPMNP-------------NMFRHANAREGQ 587

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 62/120 (51%), Gaps = 32/120 (26%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDK---ISDESQRAESEAKFKEISAAYDI 58
            KD Y +L +  +A  ++++++Y NL   +HPDK   +S++ Q+   E K  EI+ AY++
Sbjct: 525 NKDYYKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQE-KMSEINEAYEV 583

Query: 59  LSDEQKRSEYD------------------HYGR-FDEGSFPFGDFDDDYKRGNEDF-MNF 98
           LSDE KR+EYD                   +GR F +  FPFG        GN  F MNF
Sbjct: 584 LSDETKRNEYDLNRSGNHNGMANGGAQNFDFGRMFQQQGFPFG--------GNPHFKMNF 635

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 49/83 (59%), Gaps = 5/83 (6%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          + Y VLGI   AT  E+K+AYR  A+  HPDK  D+   +E   +F+++  AY +LSD  
Sbjct: 6  EYYDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASE---RFQQVGEAYQVLSDPD 62

Query: 64 KRSEYDHYGRFDEGSFPFGDFDD 86
           R +YD +G+  + + P   F+D
Sbjct: 63 LRKQYDEFGK--DNAVPQQGFED 83

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 11/104 (10%)

Query: 6   YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
           Y +LGI  NAT  E+K+AYR  ++  HPDK  ++    E   +F+ IS AY +LS+++ R
Sbjct: 8   YDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATE---RFQAISEAYQVLSNDELR 64

Query: 66  SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQY 109
           ++YD  G+  + + P G F+D      E F   F  G   +  Y
Sbjct: 65  AKYDRLGK--QEAVPKGGFED----AAEQFSAIF--GGDAFASY 100

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 47/71 (66%), Gaps = 4/71 (5%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDK---ISDESQRAESEAKFKEISAAYDI 58
            KD Y +LG+K N+  +E++++Y +L   YHPDK   +S+E Q   +  K ++I+ AY+ 
Sbjct: 602 NKDYYKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQE-RNHKKMEQINEAYEC 660

Query: 59  LSDEQKRSEYD 69
           LSDE KR EYD
Sbjct: 661 LSDESKRKEYD 671

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (62%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LG+  ++T++E+K AYR L++ +HPDK+S   +E +R   E +F  I+ AY  L+
Sbjct: 111 DPYELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALT 170

Query: 61  DEQKRSEYDHYGRFD 75
           DE  +  Y  YG  D
Sbjct: 171 DEITKENYRKYGHPD 185

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {ON}
           similar to uniprot|P40564 YIR004W Saccharomyces
           cerevisiae DJP1 Cytosolic J-domain-containing protein,
           required for peroxisomal protein import
          Length = 429

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 56/104 (53%), Gaps = 11/104 (10%)

Query: 6   YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
           Y +LG+  NA   E+K+AYR  ++  HPDK  ++    E   +F+ IS AY +LS+E+ R
Sbjct: 8   YDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATE---RFQSISQAYQVLSNEELR 64

Query: 66  SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQY 109
           ++YD +G+  E + P   F+D      E F   F  G   +  Y
Sbjct: 65  TKYDKFGK--EEAVPQNGFED----AAEQFSAIF--GGDAFASY 100

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 47/71 (66%), Gaps = 2/71 (2%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEA--KFKEISAAYDIL 59
           GKD Y VLGI   A+ +E+++AY +L   YHPDK    S++ + +   K  +++ AY+IL
Sbjct: 520 GKDYYKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEIL 579

Query: 60  SDEQKRSEYDH 70
           SDE K+ +YD+
Sbjct: 580 SDEGKKRDYDN 590

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 57.0 bits (136), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +L I S+AT+ E+K+AYRN  L  HPDK+S       S     +I  AY ILS+ + R
Sbjct: 10 YEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKTR 69

Query: 66 SEYD 69
           EYD
Sbjct: 70 REYD 73

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 49/83 (59%), Gaps = 8/83 (9%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKI-SDESQRAES-EAKFKEISAAYDILS 60
           KD Y  LG+  +AT +E+++AY NL   YHPDKI ++ + + ES      +I+ AY+ LS
Sbjct: 537 KDYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALS 596

Query: 61  DEQKRSEYD------HYGRFDEG 77
           D+ KR EYD      H   F +G
Sbjct: 597 DDNKRKEYDLSRSNPHRNTFAQG 619

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 2/69 (2%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS--DESQRAESEAKFKEISAAYDILS 60
           KD Y +L +  NA  +++++AY  L   YHPDK     E+++  +E K   I+ AY+ILS
Sbjct: 506 KDYYKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILS 565

Query: 61  DEQKRSEYD 69
           DE KR EYD
Sbjct: 566 DESKRKEYD 574

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 57.8 bits (138), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           Y +L ++  +TE E+K+AYR LA+  HPDK    +   ++   FK I+ A+++LSD +K
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDK----NPHPKASEAFKIINRAFEVLSDNEK 77

Query: 65 RSEYDHYGR 73
          R  +D  GR
Sbjct: 78 RRIFDQLGR 86

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG++  A++ E+K+AYR  AL +HPDK  D     E+   F  I AAY++LSD Q+R
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDKNPDNVD--EATENFATIRAAYEVLSDPQER 63

Query: 66 SEYDHYGRFDEGSFPFGDFDDDY 88
          + YD +        P G  +D Y
Sbjct: 64 AWYDAHKEQILNDSPIGTAEDGY 86

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 45/69 (65%), Gaps = 2/69 (2%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKI-SDESQRAES-EAKFKEISAAYDILS 60
           KD Y VLG+   AT +E+++AY NL   YHPDKI ++ + + E+      +I+ AY+ LS
Sbjct: 534 KDYYKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLS 593

Query: 61  DEQKRSEYD 69
           D+ KR EYD
Sbjct: 594 DDDKRKEYD 602

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LGI ++ATE+EV+ +YR L++ +HPDK+S    + +R + E ++  I+ AY  L+
Sbjct: 115 DPYELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALT 174

Query: 61  DEQKRSEYDHYGRFD 75
           +E  R  Y  YG  D
Sbjct: 175 EEVTRENYLKYGHPD 189

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKI-SDESQRAES-EAKFKEISAAYDILS 60
           KD Y +LG+  +A+ +E+++AY NL   YHPDKI ++ + + ES      +I+ AY+ LS
Sbjct: 537 KDYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLS 596

Query: 61  DEQKRSEYD 69
           D+ KR EYD
Sbjct: 597 DDDKRKEYD 605

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
          {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
          YJR097W JJJ3 Protein required along with Dph1p Dph2p
          Kti11p and Dph5p for synthesis of diphthamide which is
          a modified histidine residue of translation elongation
          factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 53/93 (56%), Gaps = 4/93 (4%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y VL +K +A+  E+K+AYR+  L  HPDK +DE++ A +      I  AY +LSDE+ R
Sbjct: 5  YEVLRVKFDASLIEIKQAYRDRLLNAHPDKNNDENKPALN-VSVNAIQEAYRVLSDEKLR 63

Query: 66 SEYDH---YGRFDEGSFPFGDFDDDYKRGNEDF 95
           EYDH    G+ + G    GD  D+Y     DF
Sbjct: 64 REYDHEVVEGQKNSGYVGTGDGLDEYSLDEFDF 96

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 53.9 bits (128), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 31/61 (50%), Positives = 44/61 (72%), Gaps = 4/61 (6%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           Y VL ++  A++ E+K+AYR LA+  HPDK  ++  RA SEA FK I+ A+++LSDEQK
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDK--NKHPRA-SEA-FKRINRAFEVLSDEQK 78

Query: 65 R 65
          R
Sbjct: 79 R 79

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 4/70 (5%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          + Y VL ++  A++ E+K+AYR LA+  HPDK    +    S   FK I+ A+++L DE 
Sbjct: 23 EFYEVLQVERTASDNEIKKAYRRLAIKLHPDK----NGHPRSAEAFKVINRAFEVLGDED 78

Query: 64 KRSEYDHYGR 73
          KR  +D  GR
Sbjct: 79 KRRLFDQLGR 88

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 46/75 (61%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LG+   A+++E+K AYR L+L +HPDK++    E ++   E  + +IS AY+ L+
Sbjct: 120 DPYDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALT 179

Query: 61  DEQKRSEYDHYGRFD 75
           DE  +  Y  YG  D
Sbjct: 180 DELVKQNYLMYGHPD 194

>NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92
          Length = 276

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/77 (46%), Positives = 43/77 (55%), Gaps = 7/77 (9%)

Query: 2  GKDLYSVLGIKSNATE----QEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYD 57
          GKDLY  L I    T     QE+KR YR LAL YHPDK  ++S       KF EIS A +
Sbjct: 12 GKDLYEDLEITDALTRRISIQEIKRQYRTLALKYHPDKHPNDSNLIH---KFHEISIATN 68

Query: 58 ILSDEQKRSEYDHYGRF 74
          IL+DE+   EY  + R 
Sbjct: 69 ILTDEKLSEEYISWYRV 85

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 45/70 (64%), Gaps = 4/70 (5%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          D Y+VL ++ ++ E E+K++YR LA+  HPDK    +   ++   FK I+ A+++LSD +
Sbjct: 22 DFYNVLKVERSSDETEIKKSYRKLAIKLHPDK----NPHPKASEAFKVINRAFEVLSDNE 77

Query: 64 KRSEYDHYGR 73
          KR  +D  GR
Sbjct: 78 KREIFDRIGR 87

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LGI  +A+++++K AYR L++ +HPDK+S    + +R   E K+ +I+ AY+ L+
Sbjct: 121 DPYELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALT 180

Query: 61  DEQKRSEYDHYGRFD 75
           DE  +  +  YG  D
Sbjct: 181 DEVIKENFLKYGHPD 195

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 64/121 (52%), Gaps = 13/121 (10%)

Query: 6   YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
           Y +LG+  +A   E+K+AYR  ++  HPDK  ++ +  E   +F+ IS AY +LS ++ R
Sbjct: 8   YDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLSSDELR 64

Query: 66  SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQY--EDAEQKTSQKTKDF 123
           ++YD +G+  E + P   F+D      E F   F  G   +  Y  E    K  QKT++ 
Sbjct: 65  AKYDKFGK--EEAVPQNGFED----AGEQFAAIF--GGEAFASYIGELTLLKNIQKTEEL 116

Query: 124 V 124
           V
Sbjct: 117 V 117

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 2/78 (2%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +L +   A++ E+K+AYR  AL YHPDK  +  +  E+ A F EI AAY++LSD Q+R
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDKNRENPE--EATAIFSEIRAAYEVLSDPQER 63

Query: 66 SEYDHYGRFDEGSFPFGD 83
          + YD + +      P  D
Sbjct: 64 AWYDSHKQQILNDTPLED 81

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           Y +L ++ +A   E+K++YR LA+  HPDK    +   ++   FK I+ A+++LSD++K
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDK----NPHPKAGEAFKVINRAFEVLSDDEK 80

Query: 65 RSEYDHYGR 73
          RS +D  GR
Sbjct: 81 RSVFDRIGR 89

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (53%), Gaps = 2/91 (2%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+   AT+ E+K+AYR  AL +HPDK  D     E+   F  I +AY++LSD Q+R
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDKNPDNVD--EATEIFATIRSAYEVLSDPQER 63

Query: 66 SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFM 96
          + YD +        P G  ++ Y     D M
Sbjct: 64 AWYDAHKEQILSDAPIGTQEEGYDENEVDSM 94

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 4/69 (5%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           Y +L ++  A + E+K+AYR LA+  HPDK    +   ++   FK I+ A+++LSD +K
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDK----NPHPKASEAFKIINRAFEVLSDVEK 78

Query: 65 RSEYDHYGR 73
          R  YD  GR
Sbjct: 79 RQLYDRIGR 87

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+ S A + E+K+A+R  AL YHPDK  D  +  E+   F +I AAY++L+D Q+R
Sbjct: 6  YELLGVSSTADDLELKKAFRRKALQYHPDKNRDNVE--EATETFAQIRAAYEVLNDPQER 63

Query: 66 SEYDHY 71
          + YD +
Sbjct: 64 AWYDSH 69

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 5/81 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +L I   AT  E+K+AYR  ++  HPDK  ++    E   +F+ IS AY +LSD+  R
Sbjct: 8  YDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDPTATE---RFQAISEAYQVLSDKNLR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDD 86
          + YD +G+  E + P G F+D
Sbjct: 65 ANYDKFGK--EKAIPKGGFED 83

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 9/94 (9%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+ ++A + ++K+AYR  ++  HPDK  D+    E   +F+ IS AY +LS E+ R
Sbjct: 8  YDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTATE---RFQAISEAYQVLSSEELR 64

Query: 66 SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF 99
           +YD +G+  E + P   F+D      E F   F
Sbjct: 65 MKYDKFGK--EEAMPKNGFED----AGEQFAAIF 92

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 98/225 (43%), Gaps = 30/225 (13%)

Query: 170 CGICDGRGFKERVSRIS----PGFISRERV--------PCDECDGKGTVVSRDPSDNCKK 217
           C  CDG G K   SR +     G  +R  V         C++C G+G+V+ RD +D C+ 
Sbjct: 210 CNTCDGSGLKPGASRSTCPGCSGTGTRVHVRAGFQMASTCNQCGGEGSVL-RD-ADTCQT 267

Query: 218 CHGKCVIVE-NSILTLYVPRGHRHADTIRIDGQADM------EAGKET-----GDLVFEI 265
           CHG+   ++ N  L + +P G +  D IRI G+          A K+T     GDL+  I
Sbjct: 268 CHGEGAKLDKNHELKVDLPHGLQDGDVIRISGKGSYPNIAVDPAMKDTVRLSRGDLLLRI 327

Query: 266 DEITDPDAELERKGTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNY 325
               DP  +++ K  D+  +  I +  A  G    +  T D   +R+ +  G   +  + 
Sbjct: 328 RVDKDPRFQIKNK-YDIWFTQDIPITTAALGGVVTIP-TVDGEQVRLKVSPG--TQHHDV 383

Query: 326 LKFTNEGWPINNGSRFGDLYVKVNIEFPKDNWLNEKSELEAIKHI 370
           +    +G P  +    GD+ V+  +   K     EK   EA+  I
Sbjct: 384 VSIPQKGVPRGSFGTRGDMKVQYRVVIKKPQSQAEKCLWEALADI 428

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%), Gaps = 7/81 (8%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD YS LG+ ++AT  E+K+AY  LA  YHPD     ++ A+++ KF ++  AY+ILSD+
Sbjct: 38  KDPYSTLGVSNSATSSEIKKAYYKLAKKYHPDI----NKAADAQKKFHDLQNAYEILSDD 93

Query: 63  QKRSEYDHYGRFDEGSFPFGD 83
            KR ++D YG     +F  GD
Sbjct: 94  CKRQQWDQYG---PAAFSQGD 111

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+++ A++ ++K+AYR  AL YHPDK  D  +  E+   F  I +AY++L+D Q+R
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVE--EATTVFATIRSAYEVLADPQER 63

Query: 66 SEYDHY 71
          + YD +
Sbjct: 64 AWYDSH 69

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LGI ++A+++++K AYR L++ +HPDK++      +++  E  + +I+ AY+ L+
Sbjct: 125 DPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAYESLT 184

Query: 61  DEQKRSEYDHYGRFD 75
           DE  R  Y  YG  D
Sbjct: 185 DELVRQNYLKYGHPD 199

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDE---SQRAESEAKFKEISAAYDILS 60
           D Y +LGI  +A+++++K AYR L+L +HPDK+S E    +R   E  + +IS A++ L+
Sbjct: 125 DPYDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALT 184

Query: 61  DEQKRSEYDHYGRFD 75
           D   R  Y  YG  D
Sbjct: 185 DPIVRENYLKYGHPD 199

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 45/71 (63%), Gaps = 6/71 (8%)

Query: 4  DLYSVLGIKSN---ATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
          +LY +LG  +N    T  E+K+ YR+LAL YHPDK  ++    E   KF +I+ A +IL+
Sbjct: 14 NLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDKTPNDLTLVE---KFHKITIALNILT 70

Query: 61 DEQKRSEYDHY 71
          + Q ++EYD +
Sbjct: 71 NNQLKTEYDKW 81

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (65%), Gaps = 4/70 (5%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          + Y +L ++  A++ E+K+AYR LA+  HPDK  +   RA SEA FK I+ A+++LSD  
Sbjct: 24 EFYELLQVEKGASDNEIKKAYRKLAIRLHPDK--NTHPRA-SEA-FKRINRAFEVLSDVG 79

Query: 64 KRSEYDHYGR 73
          KR  +D  GR
Sbjct: 80 KRRMFDQLGR 89

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (61%), Gaps = 4/68 (5%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           Y +L I   A++ +VK+AYR LA+  HPDK    ++   +   FK+I+ A+++LSDE K
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDK----NRHPRAAEAFKKINRAFEVLSDENK 80

Query: 65 RSEYDHYG 72
          R  YD  G
Sbjct: 81 RKVYDQIG 88

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 51/90 (56%), Gaps = 10/90 (11%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+ S A++ ++K+AYR  AL YHPDK     Q+A     F  I AAY++LSD Q+R
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNVQQATE--IFASIRAAYEVLSDAQER 63

Query: 66 SEYDHYGRFDEGSFPFGDFDDDYKRGNEDF 95
          + YD +             +DD++   ED+
Sbjct: 64 AWYDAHRE--------QILNDDFENDEEDY 85

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LGI ++A+++++K AYR L++ +HPDK++      +++  E  + +I+ AY+ L+
Sbjct: 125 DPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLT 184

Query: 61  DEQKRSEYDHYGRFD 75
           DE  R  Y  YG  D
Sbjct: 185 DELVRQNYLKYGHPD 199

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 2   GKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDE---SQRAESEAKFKEISAAYDI 58
            K+ Y +LGIK  A+++E+++AY +L   YHPDK   +    +  +++ K  EI+ AY++
Sbjct: 539 AKNYYQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEV 598

Query: 59  LSDEQKRSEYD 69
           L+DE+KR EYD
Sbjct: 599 LNDEEKRKEYD 609

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 45/69 (65%), Gaps = 4/69 (5%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           Y +L ++  A + E+K++YR LA+  HPDK  +   RA SEA FK I+ A+++L D +K
Sbjct: 23 FYEILKVERTANDNEIKKSYRKLAIRLHPDK--NPHPRA-SEA-FKLINRAFEVLGDSEK 78

Query: 65 RSEYDHYGR 73
          RS YD  GR
Sbjct: 79 RSLYDRLGR 87

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDE---SQRAESEAKFKEISAAYDILS 60
           D Y +LG+ ++A ++E+K AYR L++ +HPDK+  +     R + E  + +I+ AY+ L+
Sbjct: 122 DPYEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLT 181

Query: 61  DEQKRSEYDHYGRFD 75
           DE  +  Y  YG  D
Sbjct: 182 DENVKENYLRYGHPD 196

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 47/75 (62%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LGI S+A+++++K AYR L++ +HPDK++      ++   E  + +I+ AY+ L+
Sbjct: 125 DPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLT 184

Query: 61  DEQKRSEYDHYGRFD 75
           DE  R  Y  YG  D
Sbjct: 185 DELVRQNYLKYGHPD 199

>Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}
           similar to Ashbya gossypii ADR124C
          Length = 624

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQ--RAESEAKFKEISAAYDILS 60
           KD Y  LG+  NA  ++++RAY  L   YHPDK    SQ  R + + K   I+ AY+ L 
Sbjct: 503 KDYYKELGVSKNANNKDIRRAYLQLTKKYHPDKQGQLSQEERLKVDEKMSAINEAYETLR 562

Query: 61  DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQYE 110
           D+ KR EYD      EG+       +   RG++     F +G GR G ++
Sbjct: 563 DDSKRKEYDMVR--SEGA------SNQRFRGSQQAPPQFNFGRGRKGGFK 604

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG++S A++ E+K+AYR  AL YHPDK  +  +  E+   F  I  AY++LSD Q+R
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDKNPNNVE--EATQAFATIRLAYEVLSDPQER 63

Query: 66 SEYDHY 71
          + YD +
Sbjct: 64 AWYDSH 69

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +LG+   AT+ E+K+AYR  AL +HPDK  D  +  E+   F  I +AY++LSD Q+R
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDKNPDNVE--EATEIFATIRSAYEVLSDPQER 63

Query: 66 SEYDHY 71
          + YD +
Sbjct: 64 AWYDAH 69

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 5/77 (6%)

Query: 2   GKDLYSVLGIKS----NATEQEVKRAYRNLALMYHPDK-ISDESQRAESEAKFKEISAAY 56
           G DLY VLG+ S      T +EVKR Y+ L L YHPDK +S     +   ++F  + +A+
Sbjct: 80  GVDLYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVASRFHSLRSAF 139

Query: 57  DILSDEQKRSEYDHYGR 73
            IL D   R++YD + R
Sbjct: 140 QILCDSSLRTQYDQWLR 156

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 44/69 (63%), Gaps = 4/69 (5%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           Y +L ++ ++++ ++K+AYR LA+  HPDK    +   ++   FK I+ A+++LSD QK
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDK----NPYPKAHEAFKLINRAFEVLSDSQK 77

Query: 65 RSEYDHYGR 73
          R  YD  GR
Sbjct: 78 RQIYDQIGR 86

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (60%), Gaps = 2/71 (2%)

Query: 1  MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQR--AESEAKFKEISAAYDI 58
          M K  Y VL +++ A+  ++KRAYR   L  HPDK + +  R  A ++A  ++I  AY +
Sbjct: 1  MNKSHYEVLAVEAGASLSQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRV 60

Query: 59 LSDEQKRSEYD 69
          L+D  +R +YD
Sbjct: 61 LADPTRREQYD 71

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 40/64 (62%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +L I S+AT++E+K+AYR+  L  HPDK++ ++    +      I  AY +LS+ + R
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIKTR 69

Query: 66 SEYD 69
           EYD
Sbjct: 70 GEYD 73

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 47/69 (68%), Gaps = 4/69 (5%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          + Y +L +  +A+E ++K+AYR LA+  HPDK  +   RA SEA FK+I+ A+++LSD+ 
Sbjct: 22 EFYEMLKVGKSASESDIKKAYRKLAIKLHPDK--NRHPRA-SEA-FKKINRAFEVLSDDS 77

Query: 64 KRSEYDHYG 72
          KR  +D  G
Sbjct: 78 KRRIFDQLG 86

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 54.3 bits (129), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 4/69 (5%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           Y +L +   A + E+K++YR LA+  HPDK    +   ++   FK I+ A+++L DE+K
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDK----NPHPKASEAFKRINRAFEVLGDEKK 80

Query: 65 RSEYDHYGR 73
          R  +D  GR
Sbjct: 81 RVLFDRIGR 89

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDE---SQRAESEAKFKEISAAYDILS 60
           D Y++L + +++T++E++ AYR L++ +HPDK+S +   ++R+  E ++  I+ AY  L+
Sbjct: 117 DPYALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALT 176

Query: 61  DEQKRSEYDHYGRFD 75
           DE  R  Y  YG  D
Sbjct: 177 DEVTRENYLKYGHPD 191

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 47/75 (62%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDE---SQRAESEAKFKEISAAYDILS 60
           D Y++L I +++T++E++ AYR L++ +HPDK+S +    +R   E ++  I+ AY  L+
Sbjct: 115 DPYALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALT 174

Query: 61  DEQKRSEYDHYGRFD 75
           DE  R  Y  YG  D
Sbjct: 175 DEITRENYLRYGHPD 189

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          YS LG+ SNA E E+ ++Y  LA   HPDK   E+    S  +FK IS A+ +L DE KR
Sbjct: 15 YSTLGLSSNANEAEIHKSYMMLARQLHPDKSKSEA----SAEQFKLISHAHSVLMDEAKR 70

Query: 66 SEYD 69
           +YD
Sbjct: 71 LKYD 74

>KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa]
          {ON} weakly similar to uniprot|P46997 Saccharomyces
          cerevisiae YJL162C JJJ2 Protein that may function as a
          cochaperone as suggested by the presence of a DnaJ-like
          domain
          Length = 590

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 43/64 (67%), Gaps = 4/64 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          YSVLG+KS+A+E ++K+AYR +A+  HPDK    ++ A +   FK +S A  +L D++ R
Sbjct: 14 YSVLGLKSDASESQIKKAYRRIAMAIHPDK----NKSASAAEMFKLVSHAQSVLIDKELR 69

Query: 66 SEYD 69
            Y+
Sbjct: 70 RTYN 73

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 47/75 (62%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +LG+ ++A+++++K AYR L++ +HPDK++      ++   E  + +I+ AY+ L+
Sbjct: 125 DPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLT 184

Query: 61  DEQKRSEYDHYGRFD 75
           DE  R  Y  YG  D
Sbjct: 185 DELVRQNYLKYGHPD 199

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
           (DJP1) - involved in peroxisome biogenesis [contig 135]
           FULL
          Length = 421

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 54/104 (51%), Gaps = 11/104 (10%)

Query: 6   YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
           Y +LG+  +A   ++K+AYR  ++  HPDK  ++    E   +F+ IS AY +LS E  R
Sbjct: 9   YDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDPTATE---RFQAISQAYQVLSKEDLR 65

Query: 66  SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQY 109
           ++YD YG+  E + P   F+D      E F   F  G   +  Y
Sbjct: 66  AKYDKYGK--EEAIPKEGFED----AAEQFSMIF--GGDAFASY 101

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 65/121 (53%), Gaps = 13/121 (10%)

Query: 6   YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
           Y +LG+  +A + ++K+AYR  ++  HPDK  ++ +  E   +F+ IS AY +L  ++ R
Sbjct: 8   YDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPKATE---RFQAISEAYQVLGSDELR 64

Query: 66  SEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRYGAGRYGQY--EDAEQKTSQKTKDF 123
           ++YD +G+ DE + P   F+D      E F   F  G   +  Y  E    K  QKT++ 
Sbjct: 65  AKYDKFGK-DE-AVPQNGFED----AGEQFAAIF--GGEAFASYIGELTLLKNIQKTEEL 116

Query: 124 V 124
           V
Sbjct: 117 V 117

>YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON}
          JJJ2Protein of unknown function, contains a J-domain,
          which is a region with homology to the E. coli DnaJ
          protein
          Length = 583

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          YS+LG+ SNAT  EV ++Y  LA + HPDK   +    +SE  FK +  A+ IL+DE ++
Sbjct: 15 YSILGLTSNATSSEVHKSYLKLARLLHPDKTKSD----KSEELFKAVVHAHSILTDEDQK 70

Query: 66 SEYD 69
            YD
Sbjct: 71 LRYD 74

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 43/68 (63%), Gaps = 4/68 (5%)

Query: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64
           Y +L +   A++ ++K+AYR +A+  HPDK    ++   +   FK+++ A+++LSDE+K
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDK----NRHPRAAEAFKKVNRAFEVLSDEKK 80

Query: 65 RSEYDHYG 72
          R  YD  G
Sbjct: 81 RRVYDQLG 88

>KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {ON}
           Anc_5.4 YGR285C
          Length = 433

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 4   DLYSVLGI---KSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           DLY+ +G+   + NATE ++ +A+R   + YHPDK S      E +A FK I  A++ L+
Sbjct: 97  DLYAAMGLSKLRYNATENQIIKAHRKQVVKYHPDKQSAAGVGLEQDAFFKIIQKAFETLT 156

Query: 61  DEQKRSEYD 69
           D+ KR +YD
Sbjct: 157 DKTKRMQYD 165

>AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YGL128C (CWC23)
          Length = 273

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 10/77 (12%)

Query: 2  GKDLYSVLGIKSNATEQ-------EVKRAYRNLALMYHPDKISDESQRAESEAKFKEISA 54
          GKDLY++L +  ++ E+       +++  +R LAL YHPDK  D++Q+ +   KF  +  
Sbjct: 13 GKDLYALLEVSISSPEELEAVDAAQLRAQFRRLALRYHPDKRRDDTQQND---KFVSVQK 69

Query: 55 AYDILSDEQKRSEYDHY 71
          AYDILS+   R+ Y+ +
Sbjct: 70 AYDILSNSSLRATYNRW 86

>SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON}
          conserved hypothetical protein
          Length = 292

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 52/87 (59%), Gaps = 6/87 (6%)

Query: 4  DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQ 63
          D Y+ L + ++A + +VK++YR L L YHPDK+S++  + E++ +F ++  +Y++L+  +
Sbjct: 12 DPYATLELSNDAEDSQVKKSYRRLMLRYHPDKLSNDLAKEEAQDRFHKVQLSYEVLT--K 69

Query: 64 KRSEYDHYGRFDE----GSFPFGDFDD 86
           R  YD  G  +      S   GD+ D
Sbjct: 70 FREIYDKSGSIEACYATASDSLGDWKD 96

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 47/75 (62%), Gaps = 3/75 (4%)

Query: 4   DLYSVLGIKSNATEQEVKRAYRNLALMYHPDKIS---DESQRAESEAKFKEISAAYDILS 60
           D Y +L + S AT++E++ AYR L++ +HPDK++    +++R+  E ++  I+ AY  L+
Sbjct: 115 DPYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALT 174

Query: 61  DEQKRSEYDHYGRFD 75
           D+  R  +  YG  D
Sbjct: 175 DDATRDNFLRYGHPD 189

>KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} similar
          to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
          Protein involved in folding of mitochondrially
          synthesized proteins in the mitochondrial matrix
          localizes to the mitochondrial inner membrane member of
          the DnaJ family of molecular chaperones
          Length = 471

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 4/70 (5%)

Query: 3  KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
          KD Y VLGI  N+++ ++K+AY  LA  YHPD   +E    +S+ KF ++  AY+ILSDE
Sbjct: 24 KDPYKVLGINKNSSQSDIKKAYYKLAKKYHPDINKEE----DSQKKFHDLQNAYEILSDE 79

Query: 63 QKRSEYDHYG 72
           KR +YD +G
Sbjct: 80 DKRKQYDQFG 89

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 4/70 (5%)

Query: 3   KDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDE 62
           KD Y  LG+  NA+  E+K+AY  LA  +HPD     ++   +EAKF ++  AY+ILSD+
Sbjct: 35  KDPYETLGVGKNASSSEIKKAYYKLAKKFHPDI----NKEPNAEAKFHDLQNAYEILSDD 90

Query: 63  QKRSEYDHYG 72
            K+ +YD +G
Sbjct: 91  TKKQQYDQFG 100

>KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 433

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 4   DLYSVLGI---KSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60
           DLY+ +G+   +  AT Q++ +A+R   L YHPDK S      + +  FK I  AY+ L+
Sbjct: 97  DLYAAMGLSKLRYRATNQQIIKAHRKQVLKYHPDKTSASGASLDQDGFFKIIQKAYETLT 156

Query: 61  DEQKRSEYD 69
           D  KR +YD
Sbjct: 157 DSNKRPQYD 165

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 6/70 (8%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDE------SQRAESEAKFKEISAAYDIL 59
          Y VL I S+AT QE+K+AY+   L  HPDK S +      +    +     +I  AY IL
Sbjct: 11 YEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSINQIQQAYKIL 70

Query: 60 SDEQKRSEYD 69
          S+E  R +YD
Sbjct: 71 SNESTREQYD 80

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          Y +L ++  A + E+K+AYR  AL YHPDK  +  +  E+   F  I AAY++LSD Q+R
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDKNPENVE--EATEIFASIRAAYEVLSDPQER 63

Query: 66 SEYDHY 71
          + YD +
Sbjct: 64 AWYDSH 69

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 42/64 (65%), Gaps = 4/64 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          YS+LG+ S+ATE ++K+AYR +A+  HPDK    ++   +   FK +S A  +L D+++R
Sbjct: 14 YSMLGLTSDATEAQIKKAYRKIAMAIHPDK----NKSVSAAELFKLVSHAQSVLIDKEQR 69

Query: 66 SEYD 69
            Y+
Sbjct: 70 QSYN 73

>TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON}
          Anc_1.92 YGL128C
          Length = 285

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 8/73 (10%)

Query: 4  DLYSVLGIKSNATEQEV-----KRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDI 58
          +LY  L IK  ++ Q+V     K+ YR +ALMYHPDK  D S       KF  +S A  I
Sbjct: 14 NLYEELDIKIESSPQDVPLALIKKQYRKMALMYHPDKQPDNSSAIH---KFHMLSLATHI 70

Query: 59 LSDEQKRSEYDHY 71
          L+DE  R+ YD +
Sbjct: 71 LTDESSRAAYDKW 83

>Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa]
          {ON} YJL162C (REAL)
          Length = 560

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 6  YSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQKR 65
          YS+LG+ SNAT  EV ++Y  LA + HPDK   +    + E  FK +  A+ IL+DE ++
Sbjct: 15 YSILGLASNATSSEVHKSYLKLARLLHPDKTKSD----KCEELFKAVVHAHSILTDENQK 70

Query: 66 SEYD 69
            YD
Sbjct: 71 LRYD 74

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,257,710
Number of extensions: 2349722
Number of successful extensions: 8247
Number of sequences better than 10.0: 387
Number of HSP's gapped: 7767
Number of HSP's successfully gapped: 412
Length of query: 434
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 322
Effective length of database: 40,638,807
Effective search space: 13085695854
Effective search space used: 13085695854
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)