Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43058.265ON31131113710.0
AGR083W8.265ON2953116408e-82
SAKL0H16962g8.265ON3363562612e-25
KLTH0G13618g8.265ON3023292209e-20
KLLA0F19206g8.265ON2633122162e-19
ZYRO0C01584g8.265ON2823181821e-14
YDR113C (PDS1)8.265ON3733271822e-14
Suva_2.2738.265ON3763801813e-14
Smik_4.3588.265ON3713221699e-13
Kwal_56.237818.265ON2933261643e-12
Skud_4.3748.265ON3732991548e-11
TDEL0F039208.265ON3223411361e-08
Kpol_543.418.265ON3061231147e-06
NCAS0B038308.265ON3252811004e-04
KNAG0H032308.265ON281129987e-04
KAFR0B055108.265ON275155970.001
NDAI0J013508.265ON42255930.004
TBLA0E044608.265ON277143910.005
CAGL0L12298g8.265ON286305860.026
TPHA0A017808.265ON352118810.11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4305
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...   532   0.0  
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...   251   8e-82
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...   105   2e-25
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    89   9e-20
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    88   2e-19
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    75   1e-14
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    75   2e-14
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    74   3e-14
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    70   9e-13
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    68   3e-12
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    64   8e-11
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    57   1e-08
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    49   7e-06
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    43   4e-04
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    42   7e-04
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    42   0.001
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    40   0.004
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    40   0.005
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    38   0.026
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    36   0.11 

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/311 (87%), Positives = 271/311 (87%)

Query: 1   MKKHEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNSRLPLASKDRNRSQSGFNL 60
           MKKHEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNSRLPLASKDRNRSQSGFNL
Sbjct: 1   MKKHEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNSRLPLASKDRNRSQSGFNL 60

Query: 61  KXXXXXXXXXXXXXXXXNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLK 120
           K                NKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLK
Sbjct: 61  KQQLVQGHVGGGVMVGQNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLK 120

Query: 121 DASDGSQDNGXXXXXXXXXXGNPLAAKLRSRLTSGVEDENEDDXXXXXXXXXXXXXXIKL 180
           DASDGSQDNG          GNPLAAKLRSRLTSGVEDENEDD              IKL
Sbjct: 121 DASDGSQDNGEESDDYDDEEGNPLAAKLRSRLTSGVEDENEDDGSSGLLLGGGLKKLIKL 180

Query: 181 HESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREEDDS 240
           HESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREEDDS
Sbjct: 181 HESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREEDDS 240

Query: 241 DSTEGERLLIPLDFGGIDESPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGKG 300
           DSTEGERLLIPLDFGGIDESPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGKG
Sbjct: 241 DSTEGERLLIPLDFGGIDESPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGKG 300

Query: 301 LSSNELQSLLD 311
           LSSNELQSLLD
Sbjct: 301 LSSNELQSLLD 311

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score =  251 bits (640), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 149/311 (47%), Positives = 188/311 (60%), Gaps = 16/311 (5%)

Query: 1   MKKHEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNSRLPLASKDRNRSQSGFNL 60
           MKKHEDKEN+ T S   G+++PRTP+HQLKRS+SN+  +N++R+PLASKDRN+SQ  F L
Sbjct: 1   MKKHEDKENLVT-SAGRGAMMPRTPIHQLKRSSSNLAGRNSTRMPLASKDRNQSQGVFGL 59

Query: 61  KXXXXXXXXXXXXXXXXNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLK 120
           K                 +SKRPAS+S  KNMPDSKLKKYGSVLGV Y  L K KSLVLK
Sbjct: 60  KTSGAGGAGGAQ-----AQSKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLK 114

Query: 121 DASDGSQDNGXXXXXXXXXXGNPLAAKLRSRLTSGVEDENEDDXXXXXXXXXXXXXXIKL 180
           D SD    N           GNPLAAKL+SRL S  E  NEDD                 
Sbjct: 115 DTSDCESAN----EESEEEEGNPLAAKLKSRLCSAEEGGNEDDGSSGLLLGEALSQLAAA 170

Query: 181 HESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREEDDS 240
            E+     E+VP +E APEK+PEL H+PNGYE  +  ++ KLA Y SPFLRF D+E++++
Sbjct: 171 GETQ----EDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFGDKEDEEN 226

Query: 241 DSTEGERLLIPLDFGGIDESPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGKG 300
                 + LIPL+FG +D+S S   E  AT          + +   + DE+QF F +G+G
Sbjct: 227 TEPGDSQQLIPLEFGALDDSQSSSDEDDATSNGAALGAIALSQ--EEPDEVQFEFAVGEG 284

Query: 301 LSSNELQSLLD 311
           L S +L SLLD
Sbjct: 285 LDSKDLHSLLD 295

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score =  105 bits (261), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 114/356 (32%), Positives = 156/356 (43%), Gaps = 65/356 (18%)

Query: 1   MKKHEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVH-LKNNS-------RLPLASKDRN 52
           M+ HE+KEN+   SE     +P TP H LKRS S +  L +NS       RLPLASKD N
Sbjct: 1   MRTHENKENVIFSSEN----LPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNN 56

Query: 53  RSQSGFNLKXXXXXXXXXXXXXXXXN---KSKRPA---SNSFVKN---------MPDSKL 97
           +S +  N                      K  RP    + SF+           +PDS+L
Sbjct: 57  KSNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRL 116

Query: 98  KKYGSVLGVNYPHLTKTKSLVLKDASD------GSQDNGXXXXXXXXXXGNPLAAKLRSR 151
           KKYGSVLG  Y  L + KSLVLKD  +         +             NPLAAKL   
Sbjct: 117 KKYGSVLG--YNGLPRVKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKA 174

Query: 152 LTSGVEDENEDDXXXXXXXXXXXXXXIK---LHESDNQDTEEVPQIETAPEKVPELEHIP 208
           L +  ED+ E+               +K   + E +N D E    IE  P    EL H+P
Sbjct: 175 LNNHNEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFE----IEIVPPHSEELPHVP 230

Query: 209 NGYEQFEDEEIVKLATYTSPFLRFADREEDDSDSTEGERLLIPLDFGG---IDESPSKKQ 265
           NGY  F++ +++KL T+TSPF       ++DSD  E +      D+ G   I    S+ +
Sbjct: 231 NGYSPFKESDVIKLNTFTSPF----SMHKEDSDCEECD------DYDGLLTISMVKSEDE 280

Query: 266 ELMATQENIIANKTIVDELGTQADEIQFSFDI----------GKGLSSNELQSLLD 311
           E      +    K+ +DE    A    F F+           G+GL+  +L+SLLD
Sbjct: 281 EQDDDTNDRKRRKSWIDEGLATARHGLFDFNKPELYIEPHYNGEGLNKEDLESLLD 336

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 89.4 bits (220), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 106/329 (32%), Positives = 142/329 (43%), Gaps = 45/329 (13%)

Query: 1   MKKHEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNS------RLPLASKDRNRS 54
           M +HEDKEN    S  S S VP TP H L RS S   +KN S      R PLASKD NRS
Sbjct: 1   MGRHEDKEN----SIWSESNVPVTPRHLLSRSQS--FMKNKSPKRAEARRPLASKDNNRS 54

Query: 55  QSGFNLKXXXXXXXXXXXXXXXXNKSKRPASN---SFVKNMPDSKLKKYGSVLGVNYPHL 111
            S    K                 K  RP  N   SFV N       + G    +N    
Sbjct: 55  VSYLGTKEPL-------------RKRTRPGVNHAGSFVGNA------RLGPAPTLNASGA 95

Query: 112 TKTKSLVLKDA--SDGSQDNGXXXXXXXXXXGNPLAAKLRSRLTSGVED-ENEDDXXXXX 168
            K KSLVLKD    +GSQ  G           N LAAKLR++L S   D E E       
Sbjct: 96  PKIKSLVLKDGIEEEGSQSEGAEVDEDDDDDSNRLAAKLRTKLLSRDRDAEGEQTGLLGA 155

Query: 169 XXXXXXXXXIKLHE-SDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKL-ATYT 226
                     KL + ++  D+++  ++E  P +   L H+P GY  F ++EI KL     
Sbjct: 156 TGGLQSLLGPKLSQRAEESDSDQ--EVEVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDV 213

Query: 227 SPF-LRFADREEDDSDSTEGERLLIPLDFGGIDESPSKKQELMATQENIIANKTIVDELG 285
           SPF L F+  +ED+  +++    L  L+F   D   +   +    + +     TI    G
Sbjct: 214 SPFQLNFSGVDEDEDINSQDSTQLFTLNFDRDDNDDTDADQSGRKRHHTPERTTIPISTG 273

Query: 286 TQADEIQFSFD---IGKGLSSNELQSLLD 311
            +     F  +    G GL++ EL+SLL+
Sbjct: 274 QRRKSDVFELEPTYAGNGLTAKELESLLE 302

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 99/312 (31%), Positives = 143/312 (45%), Gaps = 55/312 (17%)

Query: 4   HEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNSRLPLASKDRNRSQSGFNLKXX 63
           +E KENI +  +P   +  RTP++Q+KR+ S   L   +R PLASKD NR+QS  ++K  
Sbjct: 3   NEGKENIISVQDPDNDLGLRTPLNQMKRTDS---LVRGNRRPLASKDNNRTQSILSVKNN 59

Query: 64  XXXXXXXXXXXXXXNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKDAS 123
                         +  KRPAS SF+KNMP++KLKKYGSVLG+N   + +TKSLVLKD  
Sbjct: 60  AALGKSD-------HPLKRPAS-SFMKNMPENKLKKYGSVLGMNT-FMPRTKSLVLKDTE 110

Query: 124 DGSQDNGXXXXXXXXXXG-NPLAAKLRSRLTSGVEDENEDDXXXXXXXXXXXXXXIKLHE 182
              +++              P    L     +G++                    +   +
Sbjct: 111 LNEKNDDEDEEDEEDDLPIFPSGKSLNLGFGNGLK-------------------ALIREK 151

Query: 183 SDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREEDDSDS 242
            D  + E  P+ +     +P      NGY+ F+ E I KL  + SPF      E    D+
Sbjct: 152 EDELNIEYAPKRQKELPYIP------NGYDPFDKESIEKLQHHRSPF----QVESITFDT 201

Query: 243 TEGERLLIPLDFGGIDE---SPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGK 299
            E +  LI L     DE   SP++        E    N++I  ELG + +        G+
Sbjct: 202 EERDPELISL--AATDEDLVSPTRYNNHKHNLELDSDNESITIELGEEYN--------GQ 251

Query: 300 GLSSNELQSLLD 311
           GL + EL SLLD
Sbjct: 252 GLDTLELNSLLD 263

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 93/318 (29%), Positives = 142/318 (44%), Gaps = 80/318 (25%)

Query: 17  SGSI-VPRTPMHQLKRSTSNV----------------HLKNNSRLPLASKDRNRSQSGFN 59
           +GS+ +P+TP+H LKRS  NV                 ++   RLPLASKD N+S +   
Sbjct: 20  NGSLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSVSPVRGQRRLPLASKDHNKSSAAGP 79

Query: 60  LKXXXXXXXXXXXXXXXXNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVL 119
           +                  K ++P     + + P  KL+KYGSVLG  Y  L +TKSLVL
Sbjct: 80  V------------------KKRQPTLQGELLSNP-RKLQKYGSVLG--YTDLPRTKSLVL 118

Query: 120 KDASDGSQDNGXXXXXXXXXXGNPLAAKLRSRLTSGVEDENEDDXXXXXXXXXXXXXXIK 179
           KD        G           + L  KL+  +    ED NE                 K
Sbjct: 119 KD--------GDDEDDDEEEENSELQKKLQDAMNRR-EDSNE-----------GLGGLAK 158

Query: 180 LHESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREED- 238
           L      D      IE AP ++P LE+ P+G+ ++EDE+IVKL       LR  D ++D 
Sbjct: 159 LVRDTKDD------IEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVD---LRIRDDQDDH 209

Query: 239 -DSDSTEGERLLIPL---DFGGIDESPSKKQELMATQENI--IANKTIVDELGTQADEIQ 292
            D++  E +  L+PL   +    D + ++  E++     I       + DE     D+++
Sbjct: 210 EDNEPQENDDGLLPLMSIESNNEDSNENEADEILPKNHRIHPFPKLRVFDE-----DQVE 264

Query: 293 FSFDIGKGLSSNELQSLL 310
             ++ G+GL++ EL+ LL
Sbjct: 265 NIYN-GEGLNAEELEDLL 281

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 74.7 bits (182), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 93/327 (28%), Positives = 128/327 (39%), Gaps = 78/327 (23%)

Query: 1   MKKHEDKEN--IPTGSEPSGSIVPRTPMHQLKRSTSNV---------------------- 36
           M  +EDKEN  + TG+E SG   P+TP H LKRS SN+                      
Sbjct: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61

Query: 37  -----------------HLKNNSRLPLASKDRNRSQSGF-----NLKXXXXXXXXXXXXX 74
                            H +   RLPLA+KD NRS+S       N               
Sbjct: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLS 121

Query: 75  XXXNKSKRPAS-----------NSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKDAS 123
              N   R  S           N  + N    KL+KYGSVLG  Y  L K KSLVLKD +
Sbjct: 122 IRKNDQLRKLSQISRSRSRANHNDLLSN--SRKLQKYGSVLG--YNALPKMKSLVLKDLA 177

Query: 124 D-GSQDNGXXXXXXXXXXGNPLAAKLRSRLTSGVEDENEDDXXXXXXXXXXXXXXIKL-- 180
           D G  +             + L  KL+S L      + E++               +L  
Sbjct: 178 DSGKNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGLQQLIK 237

Query: 181 --------HESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRF 232
                    ++D  D  +   IE AP++   L ++P GY  F+ ++I KL T+ SP+   
Sbjct: 238 NSTKNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLD 297

Query: 233 ADREEDDSDSTEGERLLIPLDFGGIDE 259
            + E+D  D  +    L+PL+   IDE
Sbjct: 298 LEDEDDTPDKVD----LLPLE--QIDE 318

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 74.3 bits (181), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 104/380 (27%), Positives = 154/380 (40%), Gaps = 75/380 (19%)

Query: 1   MKKHEDKEN--IPTGSEPSGSIVPRTPMHQLKRSTSNV---------------------- 36
           M  +EDKEN  + TG+E S +  P+TP H LKRS SNV                      
Sbjct: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60

Query: 37  -----------------HLKNNSRLPLASKDRNRSQSG-FNLKXXXXXXXXXXXXXXXXN 78
                            H +   RLPLA+KD NRS+S  F L+                 
Sbjct: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120

Query: 79  KSKRPAS-----------------NSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKD 121
            S R                    N  + N    KL+KYGSVLG  Y  L K KSLVLKD
Sbjct: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNN--SRKLQKYGSVLG--YNALPKMKSLVLKD 176

Query: 122 ASDGSQDN-GXXXXXXXXXXGNPLAAKLRSRL--TSGVEDENEDDXXXXXXXXXXXXXXI 178
            +D +++              N L+ KL+S        EDE+E                +
Sbjct: 177 LADPAKNQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQL 236

Query: 179 -----KLHESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFA 233
                K  E   ++  +   IE AP++   L ++P+GY  F+ E+I+KL T+ SP+    
Sbjct: 237 IKNTAKGKEGPGKEDGDDHDIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDL 296

Query: 234 DREEDDSDSTEGERLLIPLDFGGIDESPSKKQELMATQENI---IANKTIVDELGTQADE 290
           +   ++++S +   LL  ++    DE  +    +   QE     +A +   D+       
Sbjct: 297 EGNSNNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPAELSLALQNSEDDDNAAMPL 356

Query: 291 IQFSFDIGKGLSSNELQSLL 310
           I+  ++ G+GL S EL+ LL
Sbjct: 357 IESLYN-GEGLDSEELEDLL 375

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 69.7 bits (169), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 93/322 (28%), Positives = 127/322 (39%), Gaps = 79/322 (24%)

Query: 1   MKKHEDKEN--IPTGSEPSGSIVPRTPMHQLKRSTSNV---------------------- 36
           M  +EDKEN  + +G+  S    P+TP H LKRS SNV                      
Sbjct: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60

Query: 37  -----------------HLKNNSRLPLASKDRNRSQSGFNLKXXXXXXXXXXXXXXXXN- 78
                            H +   RLPLA+KD NR++S   +                 N 
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120

Query: 79  ----------KSKRPASNSFVKNMPD-----SKLKKYGSVLGVNYPHLTKTKSLVLKDAS 123
                     K  + + N    N  D      KL+KYGSVLG  Y  L K KSLVLKD  
Sbjct: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLG--YNALPKMKSLVLKDLV 178

Query: 124 D-GSQDNGXXXXXXXXXXGNPLAAKLRSRLTSGVEDENEDDXXXXXXXXXXXXXXIKL-- 180
           D G  +             N L+ KL++ L      ++E +               +L  
Sbjct: 179 DPGKNEESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIK 238

Query: 181 --------HESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPF-LR 231
                    +SDN D  E   IE AP+++  L ++P+GY  F  E+I KL ++ SP+ L 
Sbjct: 239 NSVQNESKSKSDNADGYE---IEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELD 295

Query: 232 FADREEDDSDSTEGERLLIPLD 253
                EDD  ST+   LL PL+
Sbjct: 296 L----EDDGGSTDKVDLL-PLE 312

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 67.8 bits (164), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 106/326 (32%), Positives = 141/326 (43%), Gaps = 48/326 (14%)

Query: 1   MKKHEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNS------RLPLASKDRNRS 54
           M   E+KEN    SE S   VP TP H L RS S   +KN S      R PLASKD N+S
Sbjct: 1   MGARENKENA-IWSERS---VPVTPTHLLSRSQS--FMKNISPKRAEQRKPLASKDNNKS 54

Query: 55  QSGFNLKXXXXXXXXXXXXXXXXNKSKRPASN---SFVKNMPDSKLKKYGSVLGVNYPHL 111
            +GF                    K  RP  N   SF+ N       + G V  +N    
Sbjct: 55  -TGF------------LGAKEPLRKRTRPTVNHAGSFIGNT------RPGVVPILNTNGA 95

Query: 112 TKTKSLVLKD--ASDGSQDNGXXXXXXXXXXGNPLAAKLRSRLTS-GVEDENEDDXXXXX 168
            + KSLVLKD    + SQ +G           N LAAKLR +L +   +D  E       
Sbjct: 96  PRIKSLVLKDDIEEEQSQSDGGEAEDDE---SNSLAAKLRGKLNARDRDDSTEQGGLLGA 152

Query: 169 XXXXXXXXXIKLHESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLA-TYTS 227
                     KLH S+  D++   ++E  P +   L HIP+GY  F DE+I KL  T  S
Sbjct: 153 TGGLQGLANTKLH-SETLDSDSDLEVEVIPPRPEPLPHIPHGYTPFTDEDIGKLQDTEAS 211

Query: 228 PF-LRFADREEDDSDSTEGERLLIPLDFGGIDESPSKKQELMATQENIIANKTIVDELGT 286
           PF L FAD ++D S     +   + LD    ++     QE    + +    K     +  
Sbjct: 212 PFQLNFADDDDDASSQDSTQLFTLKLD----NDDNLGDQEHDRKRLHTPEKKPTRASIAQ 267

Query: 287 QADEIQFS-FDIGKGLSSNELQSLLD 311
           QA + +      G GLS+ EL+SLL+
Sbjct: 268 QAADFELDPIYAGHGLSTKELESLLE 293

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 63.9 bits (154), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 115/299 (38%), Gaps = 75/299 (25%)

Query: 1   MKKHEDKEN--IPTGSEPSGSIVPRTPMHQLKRSTSNV---------------------- 36
           M  +EDKEN  + TG+E SG   P+TP H LKRS SNV                      
Sbjct: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60

Query: 37  -----------------HLKNNSRLPLASKDRNRSQSGFNLKXXXXXXXXXXXXXXXXN- 78
                            H +   RLPLA+KD NRS+S   +                 N 
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120

Query: 79  -----------------KSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKD 121
                               R   N  + N    KL+KYGSVLG N   L K KSLVLKD
Sbjct: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNN--SRKLQKYGSVLGYNA--LPKMKSLVLKD 176

Query: 122 ASDGSQDNGXXXXXXXXXXG--NPLAAKLRSRLTS--GVEDENEDDXXXXXXXXXXXXXX 177
            + G   N           G  + L  KL++        +DE+E +              
Sbjct: 177 LA-GPAKNQESSDDDDGSEGPESKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQ 235

Query: 178 I-------KLHESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPF 229
           +       K    +  D ++  +IE AP++   L ++P+GY  F+ E+I KL T+ SP+
Sbjct: 236 LIKNTTKGKQGSKEEDDDDDDYEIEIAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPY 294

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 90/341 (26%), Positives = 135/341 (39%), Gaps = 52/341 (15%)

Query: 1   MKKHEDKEN--IPTGSEPSGSIVPRTPMHQLKRSTS------------NVHLKN------ 40
           M  +E+KEN  +    E  G   P+TP H LKRS S            N+  ++      
Sbjct: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60

Query: 41  ---------NSRLPLASKDRNRSQSGFNLKXXXXXXXXXXXXXXXXNKSKRP--ASNSFV 89
                      R PLASKD NRS +GF  +                +K +         +
Sbjct: 61  RASPSRRVQQGRPPLASKDNNRS-TGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQLL 119

Query: 90  KNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKDASDGSQDNGXXXXXXXXXXGNPLAAKLR 149
            N    +LKKYGSVLG N   L K KSLVLKD     +                    LR
Sbjct: 120 TN--PRRLKKYGSVLGYN--ALPKMKSLVLKDVDQVGEQGEDENDDEDE------DHILR 169

Query: 150 SRLTSGVEDENEDDXXXXXXXXXXXXXXIKLHESDNQDTEEVPQIETAPEKVPELEHIPN 209
            +L + ++  +E+               +      ++D  E  +IE  P++   L +IP 
Sbjct: 170 LKLHNAIDRSDEEGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPE 229

Query: 210 GYEQFEDEEIVKLATYTSPFLRFADREEDDSDSTEGERLLIPLDFGGIDESPSKKQELMA 269
           G+     E+  KL T+ SP+L   D  + D D  +G   L  +   G DE+  ++   + 
Sbjct: 230 GHLSLAQEDYDKLKTFRSPYLIEDDYSDSDDDKQDGFLQLEEIGSAGDDENIERENLTVK 289

Query: 270 TQENIIANKTIVDELGTQADEIQFSFDIGKGLSSNELQSLL 310
            +E +    T          EIQ S+  G+GL +++L  LL
Sbjct: 290 QREMLPQYDTF---------EIQPSY-CGEGLDASDLNDLL 320

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 189 EEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREEDDSDSTEGERL 248
           E+V +IE      P+ E+IP+ +  F++ +I KL T+ SPF       +D+ DS+E   L
Sbjct: 189 EDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQSNSDDEEDSSE---L 245

Query: 249 LIPLDFGGIDESPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGKGLSSNELQS 308
           L+        +      + + T +N+  N     +    AD +      G+GL SN+L+ 
Sbjct: 246 LL---LANTSDDEGTHNDKITTNKNLSINNKPNSKDVIPADILDIEPSYGEGLDSNDLED 302

Query: 309 LLD 311
           LLD
Sbjct: 303 LLD 305

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 104/281 (37%), Gaps = 93/281 (33%)

Query: 5   EDKENIPT-----GSEPSGSIVPRTPMHQL-KRSTSNVHLKNNS---------------- 42
           EDKEN  T      S     ++P TP H L KRS S V LK NS                
Sbjct: 7   EDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTV-LKPNSVNATDELGNISPRRRQ 65

Query: 43  ------RLPLASKDRNRSQSGFNLKXXXXXXXXXXXXXXXXNKSKRPASNSFVKNMPDSK 96
                 RLPLA KD N   S F+                    S++   N+        K
Sbjct: 66  LLQLQNRLPLAKKDNN--NSSFS--------------------SRKNGLNNI------KK 97

Query: 97  LKKYGSVLGVNYPHLTKTKSLVLKDASDGSQDNGXXXXXXXXXXGNPLAAKLR------- 149
           LKKYGSVLG++   L +TKSL+LKD  D                 N    KLR       
Sbjct: 98  LKKYGSVLGMDA--LPRTKSLILKDVDDKPD------DDEEDEDDNAFGLKLRNAMKQHE 149

Query: 150 -----------SRLTSGVEDENEDDXXXX-------XXXXXXXXXXIKLH---ESDNQDT 188
                      S L  G+  +NED+                      K+    ++  QDT
Sbjct: 150 NNSNEEENEGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDT 209

Query: 189 EEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPF 229
           +   +IE AP +   L  +P GY  F  E+I KL T+ S +
Sbjct: 210 DSDREIEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSY 250

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 58/129 (44%), Gaps = 26/129 (20%)

Query: 1   MKKHEDKEN------IPTGSEPSGSIVPRTPMHQLKRSTSNVHLK--NNSRLPLASKDRN 52
           M+ +EDKEN       P  +   GS V   P+    + + +V        RLPLASKD N
Sbjct: 1   MQDNEDKENAVAVPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLPLASKDNN 60

Query: 53  RSQSGFNLKXXXXXXXXXXXXXXXXNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLT 112
              SG  +                  K  R  ++   +     KLK+YGS+LG +   LT
Sbjct: 61  --ASGLVV----------------SGKLGRQPADQVREANSSRKLKRYGSLLGYDNRQLT 102

Query: 113 KTKSLVLKD 121
           ++KSL+LKD
Sbjct: 103 RSKSLILKD 111

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 68/155 (43%), Gaps = 20/155 (12%)

Query: 94  DSKLKKYGSVLGVNYP---HLTKTKSLVLKDASDGSQDNGXXXXXXXXXXGNPLAAKLRS 150
           ++++KKYGS+LG+  P    L KTKSL+LKD                      L  KL+ 
Sbjct: 69  NTRIKKYGSILGLENPGNFKLPKTKSLILKD----------NESSESEEEDGLLNRKLKE 118

Query: 151 RLTSGVEDENEDDXXXXXXXXXXXXXXIKLHESDNQDTEEVPQIETAPEKVPELEHIPNG 210
            L+     +N++D               + H S++ D+E    I    EK  EL +IP+ 
Sbjct: 119 ALS---RSQNDEDREGDGSVGLFAKEAFQNHISNDDDSE--IDIINGKEKDVELSYIPDH 173

Query: 211 YEQFEDEEIVKL--ATYTSPFLRFADREEDDSDST 243
           YE    +EI KL      + F   A    +D+DST
Sbjct: 174 YEVIAADEIEKLKQVNLGTRFKSSASSGLNDNDST 208

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 10/55 (18%)

Query: 80  SKRPASNSFV-----KNMPDSKLKKYGSVLGV-----NYPHLTKTKSLVLKDASD 124
           SK+  +NSF+     +     +LKKYGSVLG+     N+ +LT+ KSLVLKD  D
Sbjct: 97  SKKDNNNSFILKQQQQQFDHKRLKKYGSVLGLGTDGNNHNNLTRIKSLVLKDIDD 151

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 29/60 (48%)

Query: 178 IKLHESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREE 237
           +KL        +E   IE AP +   L +IP GY  F +E+I KL  Y SPF    D  +
Sbjct: 260 VKLDNKKEDTYDEEDDIEYAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHHDHSD 319

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 59/143 (41%), Gaps = 40/143 (27%)

Query: 6   DKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNS----------------------- 42
           +KENI T         PRTP  QLKR +SN+ LK NS                       
Sbjct: 4   NKENIFTA--------PRTPSPQLKRDSSNI-LKFNSTTHTNVLKSKITDVPSNASGITA 54

Query: 43  RLPLASKDRNRSQSGFNLKXXXXXXXXXXXXXXXXNKSKRPASNSFVKNMPDSKLKKYGS 102
           R PLASKD+N  ++                       S      +    +P ++LKKYGS
Sbjct: 55  RRPLASKDKNVRRTALG------QVKSSISSNNSNTNSTNNNDKNKNNMLPMNRLKKYGS 108

Query: 103 VLGV--NYPHLTKTKSLVLKDAS 123
           VLG   N  +   +K+L+LKD +
Sbjct: 109 VLGYSNNTINSNASKTLILKDIA 131

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 118/305 (38%), Gaps = 68/305 (22%)

Query: 22  PRTPMHQLKRSTSNVH-LKNNSRLPLASKDRN--RSQSGFNLKXXXXXXXXXXXXXXXXN 78
           P TP   LKR+ S +   KN  R PLASKD+N  RS S  +LK                 
Sbjct: 21  PATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYLSLKRNSNQ------------ 68

Query: 79  KSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKDASDGSQ-DNGXXXXXXX 137
           K  +PA            + + GS        +T   SL+LKD + G + ++        
Sbjct: 69  KKLKPA------------VTRAGSTANNANRRVT---SLILKDIASGDEKESASESDSED 113

Query: 138 XXXGNPLAAKLRSRLTSGVEDENEDDXXXXXXXXXXXXXXIKLHESDNQDTEEVPQIETA 197
               NPLA K++  LT  +                      K+    + D E    IE A
Sbjct: 114 DEESNPLALKIKQALTHSIAS-----AEGKTGLLNGKSGLRKIFNDRDLDRE----IEVA 164

Query: 198 PEKVPELEHIPNGYEQFEDEEIVKL----ATYTSPFLRFADRE----EDDSDSTEGERLL 249
             + PE  + P GYE  +D ++ KL    A     F+  + R      DDS        L
Sbjct: 165 SVREPEKPYEPEGYEPLDDSDLEKLKLKNAINRPTFIMDSPRAISIVGDDSPQ------L 218

Query: 250 IPLDFGGIDESPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGKGL---SSNEL 306
           +PLD            E    +E ++ +K   DE+ T+A+    + +I + +   SS E+
Sbjct: 219 LPLDL-----------EESKLEEGVLNDKNTTDEVITRANTQAKNANITESIDDCSSVEI 267

Query: 307 QSLLD 311
            S+ D
Sbjct: 268 DSIYD 272

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 55/118 (46%), Gaps = 4/118 (3%)

Query: 196 TAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPF--LRFADREEDDSDSTEGERLLIPLD 253
           T     P+L + P GY  F +E+I KL T+ SP+  L   D    D ++     LL   +
Sbjct: 236 TKSAAYPDLSYSPEGYIPFNNEDIKKLNTFKSPYSNLNVNDSLLADHNNNNNSGLLELEN 295

Query: 254 FGGIDESPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGKGLSSNELQSLLD 311
            G  D+        ++  ++   ++   D       EIQ S++   GL +NEL++LLD
Sbjct: 296 VGSSDDDDDNNLLNISNIQDGRGSRQTNDNETFIDFEIQPSYN--DGLDANELENLLD 351

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.128    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,530,005
Number of extensions: 1434717
Number of successful extensions: 2961
Number of sequences better than 10.0: 33
Number of HSP's gapped: 2972
Number of HSP's successfully gapped: 41
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 65 (29.6 bits)