Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43048.266ON28928915390.0
AGR082C8.266ON2662844774e-58
KLLA0F19228g8.266ON3052803859e-44
SAKL0H16940g8.266ON3032883789e-43
Kwal_56.237778.266ON2672813681e-41
KLTH0G13596g8.266ON2672403489e-39
TDEL0F039308.266ON2802773393e-37
ZYRO0C01562g8.266ON2772672958e-31
KAFR0B027408.266ON2562682371e-22
NDAI0B020108.266ON2812872257e-21
Kpol_392.48.266ON2812862091e-18
YLR091W (GEP5)8.266ON2932901811e-14
Suva_10.1758.266ON2992881792e-14
NCAS0B050408.266ON2732411702e-13
Smik_12.1508.266ON2922921703e-13
Skud_12.1598.266ON2942811562e-11
TPHA0J007608.266ON2492281332e-08
KNAG0G020608.266ON2862221305e-08
KLTH0A02244g8.87ON59887770.40
Skud_13.3072.380ON34793702.3
Kpol_1029.208.418ON91198669.0
NOTE: 1 genes in the same pillar as Ecym_4304 were not hit in these BLAST results
LIST: CAGL0L12320g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4304
         (289 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...   597   0.0  
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...   188   4e-58
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...   152   9e-44
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   150   9e-43
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   146   1e-41
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   138   9e-39
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   135   3e-37
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   118   8e-31
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...    96   1e-22
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...    91   7e-21
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...    85   1e-18
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...    74   1e-14
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...    74   2e-14
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...    70   2e-13
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...    70   3e-13
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    65   2e-11
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    56   2e-08
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    55   5e-08
KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} simila...    34   0.40 
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    32   2.3  
Kpol_1029.20 s1029 complement(39953..42688) [2736 bp, 911 aa] {O...    30   9.0  

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/289 (100%), Positives = 289/289 (100%)

Query: 1   MGGMNRKVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSYLRR 60
           MGGMNRKVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSYLRR
Sbjct: 1   MGGMNRKVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSYLRR 60

Query: 61  VIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAK 120
           VIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAK
Sbjct: 61  VIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAK 120

Query: 121 VLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFS 180
           VLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFS
Sbjct: 121 VLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFS 180

Query: 181 HYLFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPL 240
           HYLFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPL
Sbjct: 181 HYLFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPL 240

Query: 241 SREVESLLHSIIKECDRSMGRLYKWSCNGAYTMDPKTNQFEVSSLCRML 289
           SREVESLLHSIIKECDRSMGRLYKWSCNGAYTMDPKTNQFEVSSLCRML
Sbjct: 241 SREVESLLHSIIKECDRSMGRLYKWSCNGAYTMDPKTNQFEVSSLCRML 289

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score =  188 bits (477), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 104/284 (36%), Positives = 157/284 (55%), Gaps = 24/284 (8%)

Query: 4   MNRKVLEIVSRLPLHAHTKKVIADNVG-SVGKGEFKRVDVIEPINRYLLSGEVSYLRRVI 62
           MN  +  IVSRLPLH  T +VI   +     +   +R++++EP+N +L  G    L+R++
Sbjct: 1   MNEHIQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLV 60

Query: 63  FDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVL 122
           F V+F+++    EH+R   R+ +ELQ FWPYERH  LL+       S R LW     +VL
Sbjct: 61  FHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVL 120

Query: 123 DIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFSHY 182
             M+Y RH WLR+ +                        ++  L + +R  +L  +F+ Y
Sbjct: 121 QQMQYCRHHWLREGDV----------------------PERYALTQAQREEVLHRVFAQY 158

Query: 183 LFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPLSR 242
           +F+K RP L   + LPIP+VE+GM+PLG D+PDVR+D LF+ ++K+ L+ L  + P L+ 
Sbjct: 159 MFLKQRPALWSVRRLPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTP 218

Query: 243 EVESLLHSIIKEC-DRSMGRLYKWSCNGAYTMDPKTNQFEVSSL 285
             E  +  II EC  R+M R+Y  +C  AY +D     F VS L
Sbjct: 219 AAEEDMLRIIAECPTRAMRRIYLRACRRAYVLDADAQLFRVSRL 262

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score =  152 bits (385), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 145/280 (51%), Gaps = 21/280 (7%)

Query: 17  LHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSYLRRVIFDVYFRILNPKAEH 76
           LH+ TK  I+  V +  K   K+ + +  +N +  +     L ++++ V+F +LN   +H
Sbjct: 15  LHSITKDAIS-KVDTFPKN--KQHETLHRLNSFNENPTRKTLEKLVYSVHFHLLNDPPKH 71

Query: 77  VRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVLDIMRYDRHLWLR-- 134
           V    +Y  EL  FWPYE    +L  + P   S   LWSRNN   LD + ++RH WLR  
Sbjct: 72  VDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFLSFNRHKWLRPK 131

Query: 135 -----DREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFSHYLFVKSRP 189
                + E    +  I G   TQ  + LR   +K  + ET     L+ IF HY F+K+ P
Sbjct: 132 NWQTPNEELIKDITGIDGLQSTQITEVLRLPAEK--IKET-----LRQIFEHYYFLKTNP 184

Query: 190 TLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPLSREVESLLH 249
            LC  K L  PIVE+GM P G D+ D+RIDNLF+K+ K     L    P L+ + ES+L 
Sbjct: 185 KLCATKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVLTSDAESILT 244

Query: 250 SIIKECD--RSMGRLYKWSCNGAYTMDPKTNQFEVSSLCR 287
           SI+ + D  R   RLYK   + +Y    K  +FE+S L R
Sbjct: 245 SIVNDPDLNRRTKRLYKNVASRSYLF--KDGKFEISELAR 282

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  150 bits (378), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 157/288 (54%), Gaps = 23/288 (7%)

Query: 4   MNR--KVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEP-INRYLLSGEVSYLRR 60
           MNR   +L  +  LPL   T  ++    G+V       +D +E  +  Y  +     L  
Sbjct: 1   MNRVKTLLNFLECLPLDTRTLDLLE---GTVKLCSSALLDTLEQKLFDYQANENSKSLEW 57

Query: 61  VIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAK 120
           ++++ YF   N    H+++F +   +L+  WPYERH  LLS   P + S R++W+ NN K
Sbjct: 58  IVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKK 117

Query: 121 VLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGET-ERIALLKL-- 177
           VL  MR++R+ W R+ +P   L++ F        Q L  EK++ ++  T  +I+ L+L  
Sbjct: 118 VLSSMRFERNPWCRN-DPLEQLNA-FNVNKILNYQALEEEKNRGSMLSTLPKISQLELTL 175

Query: 178 ----IFSHYLFVKSRPTLCGH-KNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKT 232
               IF HY+F+K  P LC + K LPIPIVE+ M PLG+D+P VRI NLF++++ AT K 
Sbjct: 176 LFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKL 235

Query: 233 LLHDFPPLSREVESLLHSIIKE-------CDRSMGRLYKWSCNGAYTM 273
           L  + P LS E E+LL  II          +R + RLY+ +C  +Y +
Sbjct: 236 LAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVI 283

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  146 bits (368), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 133/281 (47%), Gaps = 40/281 (14%)

Query: 4   MNRKVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSYLRRVIF 63
           MNR + +++ +LPL   T K+I   +       F     +E   +Y    +   L  +I 
Sbjct: 1   MNRGI-QVLEKLPLDVRTLKLIEKRLERAESLRF-----LELARQYEAKKDYKTLENIIH 54

Query: 64  DVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVLD 123
             YF   N   +H++ F  +  EL+ FWPYE H  +L  + P   S R+LWS  N +VL 
Sbjct: 55  HTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRVLA 114

Query: 124 IMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFSHYL 183
            MRY  + W R                         E     L E ER      IF H+L
Sbjct: 115 AMRYGSYGWNR-------------------------EGGGERLTELERTLRFHEIFQHFL 149

Query: 184 FVKSRPTLC-GHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPLSR 242
           F++ RP LC   K+L +PIVE+ M PLG+++ DVRI NLF+++     + L  D P LS 
Sbjct: 150 FLQRRPQLCKNRKHLSVPIVEIPMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALSA 209

Query: 243 EVESLLHSII--------KECDRSMGRLYKWSCNGAYTMDP 275
           E ESLL  II        +   R + RLY+ +C GAY + P
Sbjct: 210 ENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGAYVIKP 250

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  138 bits (348), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 121/240 (50%), Gaps = 34/240 (14%)

Query: 44  EPINRYLLSGEVSYLRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGE 103
           E   +Y   G    L  ++   YF   N  A H+++F  +  EL+  WPYE H  +LS +
Sbjct: 35  ELAQQYTADGSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMD 94

Query: 104 RPYKDSARYLWSRNNAKVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDK 163
            P   S R+LWS N+ KVL  M Y+          K++ D+               E+  
Sbjct: 95  TPKTQSIRFLWSSNSPKVLSKMSYE----------KYAHDT---------------EERP 129

Query: 164 NTLGETERIALLKLIFSHYLFVKSRPTLC-GHKNLPIPIVEVGMSPLGEDMPDVRIDNLF 222
           + L E +R      +F H+LF+KSRP LC   K L +PIVE+ M PLG+++P+VR+ NLF
Sbjct: 130 SRLTELQRTVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLF 189

Query: 223 RKRSKATLKTLLHDFPPLSREVESLLHSIIK--------ECDRSMGRLYKWSCNGAYTMD 274
           +++     K L  D P LSR+ E  L  II            R + RLY+ +C GAYT++
Sbjct: 190 KRKIAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYTIE 249

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  135 bits (339), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 142/277 (51%), Gaps = 39/277 (14%)

Query: 8   VLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVS--------YLR 59
           +L+ + +LPLH+ T  ++A  +    KG+  +  VI P+ + + + E S         L 
Sbjct: 9   LLKALEKLPLHSKTLDLLACKL----KGDELKT-VIIPLAKLVSNLESSRAETQRIKALE 63

Query: 60  RVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNA 119
            +I+  +F   +P   H++ F+ +  ++ + WPYERH  +L+ E+P   S RY W  ++ 
Sbjct: 64  SIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDSSK 123

Query: 120 KVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIF 179
            VL +  Y ++ W+ D        +I  +  T                  +R  L   +F
Sbjct: 124 TVLSMAEYSKNPWIED--------NILSKKLTI----------------IQRDLLFHSVF 159

Query: 180 SHYLFVKSRPTLCGH-KNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFP 238
           SHYLF+K+ P LC + +NLPIPIVE+ M PLG D+   RI NLF+ +   T + L  + P
Sbjct: 160 SHYLFLKANPRLCNNGRNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENP 219

Query: 239 PLSREVESLLHSIIKEC-DRSMGRLYKWSCNGAYTMD 274
            LSR  E++L  II +   R   RLY+ SC  AY M+
Sbjct: 220 VLSRGSENILSEIISDASSRKQRRLYQASCKRAYVME 256

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  118 bits (295), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 124/267 (46%), Gaps = 36/267 (13%)

Query: 12  VSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSYLRRVIFDVYFRILN 71
           + +LPLH  T+KV+           +K + V + I+ +    +  YL  +I   +F   N
Sbjct: 17  IRQLPLHIETQKVLE---FYCRNSSYKSLLVAQDISEFEKHNDHKYLEALIQKTHFLWDN 73

Query: 72  PKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVLDIMRYDRHL 131
           P    +++F+ Y KEL   WPYE    LLS   P K+S  YLW       L  +R+++H 
Sbjct: 74  PLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWRDGKELALSNLRFEKHR 133

Query: 132 WLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNT---LGETERIALLKLIFSHYLFVKSR 188
           W                             D+N    L   +   LL  IF  Y F+KS 
Sbjct: 134 W----------------------------ADENIIERLSPEQGTQLLHSIFHQYFFLKSH 165

Query: 189 PTLC-GHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPLSREVESL 247
             LC  ++ +P+PIVE+ + P+G D+ D RI NLF++++      L  +  PLS   E L
Sbjct: 166 ARLCYNNRKIPVPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQL 225

Query: 248 LHSIIKECD-RSMGRLYKWSCNGAYTM 273
           L  II + + RSM RLY+ +   AY +
Sbjct: 226 LGEIITKSETRSMRRLYQRASRRAYVV 252

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score = 95.9 bits (237), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 121/268 (45%), Gaps = 50/268 (18%)

Query: 7   KVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSYLRRVIFDVY 66
           K+   +  LPLH  T   + D   ++ + +   + ++  +  Y  +G+  +L  +I+ +Y
Sbjct: 19  KITNAIEGLPLHQKTLLQLQD---TLKRNDALAIPLLRDVVSYETTGKSKFLESIIYRLY 75

Query: 67  FRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVLDIMR 126
           F+ LN    H++      + L+  WP ERH    + E P   S R  W RN A  +D+  
Sbjct: 76  FQWLNEVPSHLKPLLNQYEHLKSNWPIERHIKFKNAE-PEAISLRNAWMRNKATAVDLST 134

Query: 127 YDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFSHYLFVK 186
            D  +                +P     +YLR  +D+                       
Sbjct: 135 SDGVI----------------KPILNHFRYLRVNEDR----------------------- 155

Query: 187 SRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPLSREVES 246
               LC  K + +PI+EV ++  G ++P+ R++NL +KR     K+LL D P LS ++E 
Sbjct: 156 ----LCK-KKVGLPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLED 210

Query: 247 LLHSIIKEC--DRSMGRLYKWSCNGAYT 272
            LHSII +    R++ R+Y  SC+ AYT
Sbjct: 211 TLHSIINDSKNTRALKRVYLRSCSRAYT 238

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score = 91.3 bits (225), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 127/287 (44%), Gaps = 47/287 (16%)

Query: 2   GGMNRKVLEIVSRLPLHAHT-----KKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVS 56
             + + +L  +  LPLH++T     +K +  N+ +    +   + +I    +   SG+  
Sbjct: 6   SKLTKTLLSSLQNLPLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQSK 65

Query: 57  Y----LRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARY 112
                L  +I+  YF   N  A H++ F+R    L  FWP+  HS +        DS + 
Sbjct: 66  LSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYHSKI--------DSKK- 116

Query: 113 LWSRNNAKVLDIMRYDRHLWLRDREPKFSLDSIFGE-PFTQQLQYLRHEKDKNTLGETER 171
                N+ +L         W +    K  L  +     +TQ L  +  +KD         
Sbjct: 117 -----NSIILT--------WNKSSNSKNMLRELLSHLNYTQSL--VPQKKDFQ------- 154

Query: 172 IALLKLIFSHYLFVKSRPTLCGH-KNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATL 230
             + K I+ HY+F+   P+LC + K LP PIVE+ M+ +G D+P  RI+NL R +   T 
Sbjct: 155 -VIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTW 213

Query: 231 KTLLHDFPPLSREVESLLHSIIKEC----DRSMGRLYKWSCNGAYTM 273
             L    P L+ E E+ L  II        R + +LY+ +C+ +Y +
Sbjct: 214 NYLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYVI 260

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 125/286 (43%), Gaps = 37/286 (12%)

Query: 8   VLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLS-------GEVSYLRR 60
           +LE + RLPLH  T  ++   +  V    F   + +  +N Y +S        E   L +
Sbjct: 15  LLESLERLPLHKPTLDILERRIH-VADLPFME-EYVGILNEYEISKINSKVENESRALEK 72

Query: 61  VIFDVYFRILNPK-AEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNA 119
           ++   +    N K   H+ +F+ +  EL   WPYE HS +L+  RP   S  YL   N+ 
Sbjct: 73  IVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLCLNND- 131

Query: 120 KVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIF 179
                          DR   F    I  + F    QY         L + +R+++   IF
Sbjct: 132 ---------------DRFFNFYKSQINNKWFNSVDQY--------KLTDEQRVSIYNDIF 168

Query: 180 SHYLFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPP 239
               F+K   T+       +PIVEV + P+G D+P  RI NLF K+     K L    P 
Sbjct: 169 KQIFFLKRHTTISEVNKNMVPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKLLSLSSPA 228

Query: 240 LSREVESLLHSIIKEC--DRSMGRLYKWSCNGAYTMDPKTNQFEVS 283
           +S   E ++ +I+++   +R + RLY+ S   +Y  D  TN  E++
Sbjct: 229 ISLSHEKIIMNILEDTKDNRRINRLYRRSLKNSYVFD-DTNPIEIT 273

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 127/290 (43%), Gaps = 39/290 (13%)

Query: 2   GGMNRKVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYL----------- 50
             +N  +L ++   PLH  TK  +   + S  + ++K  ++  P+ + L           
Sbjct: 3   SQVNALLLPVIESTPLHQITKVALTTTLTS-KQSDYKFKEIAVPLTKSLQLYEKAQRRQD 61

Query: 51  LSGEVSYLRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSA 110
           L   +  L  +I+  +F+  NP   H   F+++   L   WP+E H  L+       DS 
Sbjct: 62  LRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLV-------DSI 114

Query: 111 RYLWSRNNAKVLDIMRYDRHLWLRDREPKFSLDSIFG--EPFTQQLQYLR--HEKDKNTL 166
               + NN K+       R +WL     K    ++F    P+ Q    L      D +T 
Sbjct: 115 ----AVNNGKLNSTS--SRSVWL-----KADWITLFNVKNPWVQTPPSLMRLSGTDLDTF 163

Query: 167 GETERIALLKLIFSHYLFVKSRPTLC-GHKNLPIPIVEVGM-SPLGEDMPDVRIDNLFRK 224
              ERI L+  + +HY F+ +   L   HK  P P V++ + + LGE  P  +I  LF +
Sbjct: 164 TP-ERIFLINSLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFAR 222

Query: 225 RSKATLKTLLHDFPPLSREVESLLHSII--KECDRSMGRLYKWSCNGAYT 272
           +     K+L  + PPLS E E  L ++   +  +R + RLY  +C  AYT
Sbjct: 223 QLSHIYKSLFIENPPLSPENELALTAVFYDETVERRLRRLYMRACARAYT 272

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/288 (24%), Positives = 118/288 (40%), Gaps = 24/288 (8%)

Query: 1   MGGMNRKVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYL---------- 50
           +   N  +L  +  LPLH  TK  +   +  +   +FK  ++  P+   L          
Sbjct: 2   ISQANSLLLPFIDSLPLHQITKTALTTRLTDI-HSDFKFKEIAVPLTESLQVYEKAQRAQ 60

Query: 51  -LSGEVSYLRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDS 109
            L   +  L  +++  +F+  NP+  H   F+++   L   WP+E H  L+         
Sbjct: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120

Query: 110 ARYLWSRNNAKVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGET 169
              L S+ N      ++ D     + + P          P     Q    E D  T    
Sbjct: 121 LISLTSKGN-----WLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAFT---A 172

Query: 170 ERIALLKLIFSHYLFVKSRPTLC-GHKNLPIPIVEVGM-SPLGEDMPDVRIDNLFRKRSK 227
           ER  L+K + +HY F+ +   L   HK  P P+V++ + + LGE  P  +I  LF ++  
Sbjct: 173 ERTFLVKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLA 232

Query: 228 ATLKTLLHDFPPLSREVESLLHSIIKE--CDRSMGRLYKWSCNGAYTM 273
               +L  + PPLS   E  L ++  +   +R   RLY  +C  AYT+
Sbjct: 233 QIYTSLFVENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTI 280

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 105/241 (43%), Gaps = 45/241 (18%)

Query: 58  LRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRN 117
           L  + ++ YF   NP   H++ F++  + L+ +WP   H     G    +DS    W+++
Sbjct: 69  LESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHR----GMDTKRDSIIVQWAKS 124

Query: 118 NAKVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKL 177
           N                D   K +++ I  +P                    E + + K 
Sbjct: 125 NNG--------------DALLKGTMNHI--QPG----------------ASAEELLMFKK 152

Query: 178 IFSHYLFVKSRPTLCGH-KNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHD 236
           IF HY+F+     +  + K L  P+V V M+ +GE +P VR+ NLFRK+   T   L   
Sbjct: 153 IFQHYIFLTLNARITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCAL 212

Query: 237 FPPLSREVESLLHSII----KECDRSMGRLYKWSCNGAYTM---DPKTNQFEVS-SLCRM 288
            P L+ E    L  II    +   RS+ RLY+ +   A+ +    P++ QF ++  L RM
Sbjct: 213 NPVLNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHVIAGESPESIQFAIAKDLHRM 272

Query: 289 L 289
           L
Sbjct: 273 L 273

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 120/292 (41%), Gaps = 45/292 (15%)

Query: 4   MNRKVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYL-----------LS 52
           +N  +L ++  +PLH  TK  +   +    + ++K  ++  P+ + L           L 
Sbjct: 5   VNDLLLPVIQSIPLHQITKNALVTTLTDT-QSDYKFKEIAVPLTKLLQVHEKAQRRQDLR 63

Query: 53  GEVSYLRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARY 112
             +  L  +I+  +F+  NP+  H   F+++   L   WP+E H  L+     +K     
Sbjct: 64  TALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNS 123

Query: 113 LWSRNNAKVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGET--- 169
           + S+               WL+         + +   F  +  +++       L ET   
Sbjct: 124 IPSKTT-------------WLK---------ADWATLFQVKNPWVQTPPTPKNLSETDLD 161

Query: 170 ----ERIALLKLIFSHYLFVKSRPTLC-GHKNLPIPIVEVGM-SPLGEDMPDVRIDNLFR 223
               ER  L+  + + Y F+ +   L   HK  P P V++ + + LGE  P  +I  LF 
Sbjct: 162 AFTPERAFLVNSLGNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFS 221

Query: 224 KRSKATLKTLLHDFPPLSREVESLLHSII--KECDRSMGRLYKWSCNGAYTM 273
           ++      +L  + PPLS   +  L +I   K  DR   RLY  +C  AYT+
Sbjct: 222 RQLAYIYTSLFEENPPLSPANDIALMAIFNDKTMDRRFKRLYMRACARAYTI 273

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 117/281 (41%), Gaps = 30/281 (10%)

Query: 8   VLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYL-----------LSGEVS 56
           +L  +  LPLH  TK  +   +  + + ++K  ++  P+   L           L   + 
Sbjct: 9   LLPFIESLPLHRITKTALTTTLVGI-QSDYKFKEIAVPLTESLQVYEKAQRRQDLRTSLK 67

Query: 57  YLRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSR 116
            L  +IF  +F+  NP+  H   F+++   L   WP+E H  L+       DS       
Sbjct: 68  ALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLV-------DSI----CA 116

Query: 117 NNAKVLDIMRYDRHLWLR-DREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALL 175
           +N K+  +    +  WL+ D    F + + + +          H          ER  L+
Sbjct: 117 HNGKLNSMA--SKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLV 174

Query: 176 KLIFSHYLFVKSRPTLC-GHKNLPIPIVEVGM-SPLGEDMPDVRIDNLFRKRSKATLKTL 233
             + +HY F+ +   L   HK  P P V++ + + LGE     +I  LF ++      +L
Sbjct: 175 NSLGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSL 234

Query: 234 LHDFPPLSREVESLLHSIIKE--CDRSMGRLYKWSCNGAYT 272
             + PPLS + E  L ++  +   DR   RLY  +C  AYT
Sbjct: 235 FVENPPLSADNELALMAVFHDDSLDRRHKRLYMRACARAYT 275

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 107/228 (46%), Gaps = 16/228 (7%)

Query: 8   VLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLS----GEVSYLRRVIF 63
           +L+ ++RLPLH +T  ++   V +      + ++++   N   ++    G++  L+R+IF
Sbjct: 21  ILDGLNRLPLHPNTLDLLQKQVHTKLTKNSELIELLFDYNNAFINKQKPGQLKCLQRIIF 80

Query: 64  DVYFRILNP--KAEHVRQFERYLKELQLFWPYERHSCLLSGER--PYKDSARYLWSRNNA 119
             +    N     +H++ F+     L   WPYERH  L +  +  P   +  YLW+  N+
Sbjct: 81  KTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDILFAANKNVPETKALEYLWNNCNS 140

Query: 120 KVLDIM--RYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKL 177
             L  M  ++ + +  R  + K+  +  +   F ++    R+  + +TL E      +++
Sbjct: 141 DNLAFMGSKFMKEI-TRQIQNKYITEGDYVHVFLKE----RYNSEIHTLSEIIDEKEIEI 195

Query: 178 IFSHYLFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKR 225
                LF K    +     L IPIV + ++ LG  +P  R+ N F+K+
Sbjct: 196 NLFGELF-KQLHYINTINKLQIPIVILPLNALGLKIPKSRLYNKFKKK 242

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 86/222 (38%), Gaps = 43/222 (19%)

Query: 63  FDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVL 122
           +D  F  L+    H+  FE+    L   WP E H  L    + +  + ++ W  NN   L
Sbjct: 74  WDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHA-TLKHAWVTNNKHAL 132

Query: 123 DIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFSHY 182
            +                S D+    P               T G  E    L+ I SHY
Sbjct: 133 QM----------------SFDAAAANP---------------TSGNIELRGSLRQILSHY 161

Query: 183 LFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPL-S 241
             + +   + G   L +P+ E+ ++  GE++P  R  NL +++     + L+ + P L +
Sbjct: 162 QLLYNNMRMFGKIKLQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYN 221

Query: 242 REVESLLHSIIKE----------CDRSMGRLYKWSCNGAYTM 273
            E  + L +II              R + RLY+ +  G YT+
Sbjct: 222 TECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTL 263

>KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} similar
           to uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA
           ATP-dependent RNA helicase
          Length = 598

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 6/87 (6%)

Query: 12  VSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSYLRRVIFDVYFRILN 71
            S +P+ +  K V+ ++V   GK     + ++E + + +LSG  S L+R  F  Y  I++
Sbjct: 35  ASTIPMFSGNKDVVVESVTGSGKTIAFTIPILEKVVKEVLSG--SPLKRGHF--YSLIIS 90

Query: 72  PKAEHVRQFERYLKELQLFWPYERHSC 98
           P  E  +Q +  ++    ++P E  SC
Sbjct: 91  PTRELSKQIQDVVEAFLAYYPSE--SC 115

>Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {ON}
           YMR146C (REAL)
          Length = 347

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 7/93 (7%)

Query: 198 PIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPP--LSREVESLLHSIIKEC 255
           P+P+  V  SP G     + +DN+ +      +  +  D     L++  E  +H+II   
Sbjct: 93  PVPVKRVEFSPCGNYFLAI-LDNVMKNPGSINIYQIERDSTTHELTKVSEDPIHAIITHE 151

Query: 256 DRSMGRLYKWSCNGAYTM----DPKTNQFEVSS 284
                 +  WS  GAY +    D K ++++V++
Sbjct: 152 GLDAATVAGWSTKGAYIVAGHKDGKISKYDVNN 184

>Kpol_1029.20 s1029 complement(39953..42688) [2736 bp, 911 aa] {ON}
           complement(39953..42688) [2736 nt, 912 aa]
          Length = 911

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 21/98 (21%), Positives = 45/98 (45%), Gaps = 13/98 (13%)

Query: 50  LLSGEVSYLRRVIFDVYFRILNPKAEHVRQFERY----LKELQLFWPYERHSCLLSGERP 105
           L S + S+ +++ FD +   L P +++  +F+ Y     +EL+  +  +    L+S    
Sbjct: 537 LTSSDFSFTKKLAFDYHGNELTPSSQYAFKFKDYAPEVFRELRAMFGLDPADYLVSLTSK 596

Query: 106 Y---------KDSARYLWSRNNAKVLDIMRYDRHLWLR 134
           Y         K  + + +SR+   ++  + +  HL LR
Sbjct: 597 YILSELHSPGKSGSFFYYSRDYRYIIKTIHHSEHLHLR 634

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,898,065
Number of extensions: 1393323
Number of successful extensions: 3205
Number of sequences better than 10.0: 26
Number of HSP's gapped: 3233
Number of HSP's successfully gapped: 27
Length of query: 289
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 181
Effective length of database: 41,097,471
Effective search space: 7438642251
Effective search space used: 7438642251
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)