Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43038.267ON1091095443e-73
AGR081C8.267ON1301043061e-36
KLLA0F19250g8.267ON1161192999e-36
Kwal_56.237768.267ON1301132931e-34
TDEL0F039408.267ON1101112805e-33
SAKL0H16918g8.267ON1111122675e-31
ZYRO0C01540g8.267ON971082597e-30
KLTH0G13574g8.267ON112812468e-28
TPHA0A017708.267ON104872397e-27
Kpol_543.428.267ON112702251e-24
YDR115W8.267ON105672205e-24
Suva_2.2748.267ON105932181e-23
KAFR0B054908.267ON85832143e-23
Skud_4.3758.267ON105612163e-23
Smik_4.3598.267ON105612154e-23
NCAS0B038208.267ON115892112e-22
CAGL0B01793g8.267ON98872093e-22
TBLA0E044708.267ON94521989e-21
NDAI0J013408.267ON141542001e-20
KNAG0H032208.267ON86491935e-20
TDEL0A044105.576ON325976680.54
Suva_2.6315.576ON326676632.8
KLTH0G04180g5.545ON51857623.6
Skud_2.3008.587ON75128607.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4303
         (109 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...   214   3e-73
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...   122   1e-36
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...   119   9e-36
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...   117   1e-34
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...   112   5e-33
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...   107   5e-31
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...   104   7e-30
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    99   8e-28
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    97   7e-27
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    91   1e-24
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    89   5e-24
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    89   1e-23
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    87   3e-23
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    88   3e-23
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    87   4e-23
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    86   2e-22
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    85   3e-22
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    81   9e-21
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    82   1e-20
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    79   5e-20
TDEL0A04410 Chr1 (780072..789851) [9780 bp, 3259 aa] {ON} Anc_5....    31   0.54 
Suva_2.631 Chr2 (1121570..1131370) [9801 bp, 3266 aa] {ON} YDR45...    29   2.8  
KLTH0G04180g Chr7 (333951..335507) [1557 bp, 518 aa] {ON} simila...    28   3.6  
Skud_2.300 Chr2 complement(546556..548811) [2256 bp, 751 aa] {ON...    28   7.5  

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score =  214 bits (544), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 109/109 (100%), Positives = 109/109 (100%)

Query: 1   MLYKSRSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQ 60
           MLYKSRSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQ
Sbjct: 1   MLYKSRSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQ 60

Query: 61  RRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109
           RRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY
Sbjct: 61  RRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score =  122 bits (306), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 60/104 (57%), Positives = 80/104 (76%)

Query: 6   RSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQRRWKS 65
           RS+LQW  RR+++T+VS    M  + Q    +    + +   +PS++S++ GL Q+RWKS
Sbjct: 27  RSMLQWSSRRTIMTVVSPVRKMAPVPQIQYGAIGAFTPAAAPKPSMLSMLLGLTQKRWKS 86

Query: 66  RGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109
           RGNT+QPSTLKRKRRVGFLARARS+TG+ ILKRR+EKGRWYLT+
Sbjct: 87  RGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score =  119 bits (299), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 69/119 (57%), Positives = 85/119 (71%), Gaps = 13/119 (10%)

Query: 1   MLYKSRSLLQWFPRRSLVTLVSSFSPMKSLV----QPLATSAANTSVSTFQR------PS 50
           M + +R+LLQW  +R+L +  SSFSP+++L     +PLA    N    T Q        S
Sbjct: 1   MSFITRNLLQWTSKRTLTSF-SSFSPLRTLDSRLHRPLA--QVNPMEITLQSQTQANGSS 57

Query: 51  VISLVFGLNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109
           +  ++F L QRRWKSRGNTFQPSTLKRKRRVGFLARARS++GQ+ILKRRK KGRWYLTY
Sbjct: 58  IFGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score =  117 bits (293), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 80/113 (70%), Gaps = 5/113 (4%)

Query: 1   MLYKSRSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQR----PSVISLVF 56
           M + S  L Q+  RRSL T+ SSFSP+   +     S  N S++T       PS +S +F
Sbjct: 19  MSFLSSRLFQFSARRSLTTM-SSFSPLNVCMFRSPVSQVNNSIATGSSSSAMPSYLSSLF 77

Query: 57  GLNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109
           GL Q+RWKSRGNT+QPSTLKRKRRVGFLAR +SK G KILKRR+EKGRWYLT+
Sbjct: 78  GLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score =  112 bits (280), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 79/111 (71%), Gaps = 3/111 (2%)

Query: 1   MLYKSRSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQRPSVISLVF--GL 58
           M + +R  LQ   RR+L +L SSFSP++SL     +        T    S ISL+F  G+
Sbjct: 1   MSFLARKPLQLNARRTLTSL-SSFSPLRSLFAQNKSQGLLGVPETHSPLSSISLLFPFGI 59

Query: 59  NQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109
            QRRWKSRGNTFQPSTLKRKRR+GFLARARSKTG ++L+RRK KGRWYLTY
Sbjct: 60  MQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score =  107 bits (267), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 77/112 (68%), Gaps = 4/112 (3%)

Query: 1   MLYKSRSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQRPS---VISLVFG 57
           M + S+ L  +  RR+  T  SSFSP++SL      +  N  +S  Q      +++++ G
Sbjct: 1   MSFLSKHLFHFSARRTFTTF-SSFSPLRSLNSQALVNHNNPLLSQSQSQQPSSIMNILLG 59

Query: 58  LNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109
           L QRRWKSRGNT+QPSTLKRKRRVGFLARA++K   KILK RKEKGRWYLT+
Sbjct: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score =  104 bits (259), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 75/108 (69%), Gaps = 18/108 (16%)

Query: 5   SRSLLQWFPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQR---PSVISLVFGLNQR 61
           +R++ Q   RRSL T+  +++P              T+VS  QR   PS +S  FG+ QR
Sbjct: 5   ARNIFQVGARRSLFTM-GNWTP--------------TTVSPLQRLLGPSPLSSGFGMGQR 49

Query: 62  RWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109
           RWKSRGNTFQPSTLKRKRRVGFLARARSK G KIL+RRK KGRW+LT+
Sbjct: 50  RWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 99.4 bits (246), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 62/81 (76%), Gaps = 2/81 (2%)

Query: 29  SLVQPLATSAANTSVSTFQRPSVISLVFGLNQRRWKSRGNTFQPSTLKRKRRVGFLARAR 88
           S+ Q  A  AA  S S    P + S +FG  QRRWKSRGNT+QPSTLKRKRRVGFLARA+
Sbjct: 34  SVFQAAAPMAAERS-SQGSSP-LFSALFGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAK 91

Query: 89  SKTGQKILKRRKEKGRWYLTY 109
           SK G K+LKRR+EKGRWYLT+
Sbjct: 92  SKQGYKVLKRRREKGRWYLTH 112

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 96.7 bits (239), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 52/87 (59%), Positives = 60/87 (68%), Gaps = 3/87 (3%)

Query: 26  PMKSLVQPLATS--AANTSVSTFQRPSVISLVFGLN-QRRWKSRGNTFQPSTLKRKRRVG 82
           P  +LV  +  S    N   S     S++ L   L  QRRWKSRGNT+QPSTLKRKRR+G
Sbjct: 18  PNNTLVDSIKNSILGGNAIGSRTGLASILGLNLDLGLQRRWKSRGNTYQPSTLKRKRRIG 77

Query: 83  FLARARSKTGQKILKRRKEKGRWYLTY 109
           FLARARSK G KIL+RRK KGRWYLT+
Sbjct: 78  FLARARSKQGNKILERRKAKGRWYLTH 104

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 91.3 bits (225), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (82%), Gaps = 3/70 (4%)

Query: 40  NTSVSTFQRPSVISLVFGLNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRR 99
            T+ +TF   S I+ + GL QRRWKSRGNT+QPSTLKRKR+ GFLARARS++G KIL+RR
Sbjct: 46  GTATNTFG--SAITGLLGL-QRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERR 102

Query: 100 KEKGRWYLTY 109
           K KGRWYL++
Sbjct: 103 KAKGRWYLSH 112

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 89.4 bits (220), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 1/67 (1%)

Query: 44  STFQRPSVISLVFGL-NQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEK 102
           S  + PS   L FGL  QRRWKSRGNT+QPSTLKRKR  GFLARA+SK G KILKRRK K
Sbjct: 39  SPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLK 98

Query: 103 GRWYLTY 109
           GRW+L++
Sbjct: 99  GRWFLSH 105

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 88.6 bits (218), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/93 (54%), Positives = 66/93 (70%), Gaps = 5/93 (5%)

Query: 20  LVSSFSPMKSL--VQPLATSAANTSVSTFQRPSVISLVFG-LNQRRWKSRGNTFQPSTLK 76
           + SS SP+ +L  ++P  +   N+S    +  S+    FG + QRRWKSRGNT+QPSTLK
Sbjct: 15  MFSSISPISALSVLRPQTSMLLNSS--PLKTMSLTPFGFGFIGQRRWKSRGNTYQPSTLK 72

Query: 77  RKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109
           RKR  GFLARA+SK G KILKRRK KGRW+L++
Sbjct: 73  RKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 87.0 bits (214), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 59/83 (71%), Gaps = 6/83 (7%)

Query: 33  PLATSAANTSV------STFQRPSVISLVFGLNQRRWKSRGNTFQPSTLKRKRRVGFLAR 86
           P+  +  NTS+      +T Q  +V  ++    Q+RWKSRGNT+QPSTLKRKR+ GFL+R
Sbjct: 3   PIIKTNRNTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSR 62

Query: 87  ARSKTGQKILKRRKEKGRWYLTY 109
           A+SK   KILK RKEKGRWYL++
Sbjct: 63  AKSKQKSKILKDRKEKGRWYLSH 85

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 87.8 bits (216), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 1/61 (1%)

Query: 50  SVISLVFG-LNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLT 108
           S+ +L FG + QRRWKSRGNT+QPSTLKRKR  GFLARA+SK G KILKRRK KGRW+L+
Sbjct: 45  SLTALGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLS 104

Query: 109 Y 109
           +
Sbjct: 105 H 105

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 87.4 bits (215), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 1/61 (1%)

Query: 50  SVISLVFG-LNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLT 108
           S+ +  FG ++QRRWKSRGNT+QPSTLKRKR  GFLARA+SK G KILKRRK KGRW+L+
Sbjct: 45  SLTTFGFGFIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLS 104

Query: 109 Y 109
           +
Sbjct: 105 H 105

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 85.9 bits (211), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 62/89 (69%), Gaps = 3/89 (3%)

Query: 22  SSFSPMKSLVQPLATSAANTSVSTFQRPSVISLV-FGLNQRRWKSRGNTFQPSTLKRKRR 80
           SS   ++  +  L +   +  +S  Q P + SL+ FG+ QRRWKSRGNT+QPSTLKRKR+
Sbjct: 29  SSLGLIRQGITGLGSPMGSNVLS--QSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRK 86

Query: 81  VGFLARARSKTGQKILKRRKEKGRWYLTY 109
            GFLA+AR     KILKRR+ KGRWYLT+
Sbjct: 87  FGFLAKARDSQKCKILKRRRLKGRWYLTH 115

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 85.1 bits (209), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 46/87 (52%), Positives = 59/87 (67%), Gaps = 1/87 (1%)

Query: 23  SFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQRRWKSRGNTFQPSTLKRKRRVG 82
           + +P   ++   + S     +S+    S I  +F L QRRWKSRGNT+QPSTLKRKR+ G
Sbjct: 13  NLTPGNGMIGKNSVSLIRNEISSGTSFSSILTLFPL-QRRWKSRGNTYQPSTLKRKRKFG 71

Query: 83  FLARARSKTGQKILKRRKEKGRWYLTY 109
           FLAR  +K   KI+KRRKEKGRWYLT+
Sbjct: 72  FLARMTNKRTAKIIKRRKEKGRWYLTH 98

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 80.9 bits (198), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 46/52 (88%)

Query: 58  LNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109
           ++ RRWKSRGNT+QPSTLKRKR+ GFL+RA+S T  KILKRRK KGRW+L++
Sbjct: 43  IDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 81.6 bits (200), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 46/54 (85%)

Query: 56  FGLNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109
           F +NQ+RWKSRGNT+QPSTLKRKR+ GFL+R R +   KILKRRK KGRW+L++
Sbjct: 88  FMINQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 79.0 bits (193), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 37/49 (75%), Positives = 43/49 (87%)

Query: 61  RRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109
           RRWKSRGNT+QPSTLKRKR+ GFLAR R+    K+LKRRKEKGRWYL++
Sbjct: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>TDEL0A04410 Chr1 (780072..789851) [9780 bp, 3259 aa] {ON} Anc_5.576
            YDR457W
          Length = 3259

 Score = 30.8 bits (68), Expect = 0.54,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 33/76 (43%), Gaps = 3/76 (3%)

Query: 12   FPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQRRWKSRGNTFQ 71
            F  + LV LVSS+   K       T     S + F +P   +L F L Q   KS G    
Sbjct: 1667 FLLKVLVELVSSYKQSKF---EFLTFDRRNSYTEFPKPRATALNFFLYQLLDKSVGREQS 1723

Query: 72   PSTLKRKRRVGFLARA 87
                KR+  VG LAR+
Sbjct: 1724 KFEAKRREVVGMLARS 1739

>Suva_2.631 Chr2 (1121570..1131370) [9801 bp, 3266 aa] {ON} YDR457W
            (REAL)
          Length = 3266

 Score = 28.9 bits (63), Expect = 2.8,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 12   FPRRSLVTLVSSFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQRRWKSRGNTFQ 71
            F  + LV LVSS++  K   + L  S  NT      RP   ++ F L +   K  GN   
Sbjct: 1657 FLLKLLVELVSSYNQCK--FEFLTFSRRNTYAER-PRPRTTAINFFLYRLLDKPVGNDHD 1713

Query: 72   PSTLKRKRRVGFLARA 87
                KR+  VG LAR+
Sbjct: 1714 KHEAKRREVVGMLARS 1729

>KLTH0G04180g Chr7 (333951..335507) [1557 bp, 518 aa] {ON} similar
           to uniprot|Q04080 YDR434W Saccharomyces cerevisiae GPI17
           Transmembrane protein subunit of the
           glycosylphosphatidylinositol transamidase complex that
           adds GPIs to newly synthesized proteins
          Length = 518

 Score = 28.5 bits (62), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 19  TLVSSFSPMKSLVQPLATSAANTSVSTFQRPSVISLVFGLNQRRWKSRGNTFQPSTL 75
           TL + F+P++  + PL     +TS+  F   +V S+  G N   W+   +T   S L
Sbjct: 208 TLDNYFTPLRRFLSPLVNFTVDTSIVQFNDLNVGSIHSGEN-TTWQDLAHTIDLSEL 263

>Skud_2.300 Chr2 complement(546556..548811) [2256 bp, 751 aa] {ON}
           YBR172C (REAL)
          Length = 751

 Score = 27.7 bits (60), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 75  LKRKRRVGFLARARSKTGQKILKRRKEK 102
           LKRK  V  L + R K  Q++LK+ KE+
Sbjct: 392 LKRKEEVQLLKKQRQKEEQELLKKLKEE 419

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.131    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,907,543
Number of extensions: 331512
Number of successful extensions: 1162
Number of sequences better than 10.0: 36
Number of HSP's gapped: 1158
Number of HSP's successfully gapped: 36
Length of query: 109
Length of database: 53,481,399
Length adjustment: 79
Effective length of query: 30
Effective length of database: 44,422,785
Effective search space: 1332683550
Effective search space used: 1332683550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)