Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43028.268ON27527513430.0
SAKL0H16896g8.268ON2852678201e-110
KLTH0G13552g8.268ON2812468201e-110
Kwal_56.237758.268ON2812587941e-106
AGR080W8.268ON2752747484e-99
KLLA0F19272g8.268ON2662747406e-98
TPHA0J007708.268ON2782467355e-97
TDEL0F039508.268ON2762707312e-96
ZYRO0C01518g8.268ON2772707131e-93
Kpol_392.38.268ON2812147112e-93
YDR116C (MRPL1)8.268ON2852136843e-89
Smik_4.3608.268ON2852826835e-89
Skud_4.3768.268ON2852816722e-87
Suva_2.2758.268ON2852736713e-87
NCAS0B038108.268ON3142706543e-84
NDAI0J013308.268ON3142566492e-83
KAFR0B054808.268ON2802156401e-82
CAGL0B01815g8.268ON2902215942e-75
KNAG0H032108.268ON2852425905e-75
TBLA0I031908.268ON2412144521e-54
Smik_16.1678.534ON29177692.4
TBLA0C069905.21ON51198659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4302
         (275 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   521   0.0  
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   320   e-110
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   320   e-110
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   310   e-106
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   292   4e-99
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   289   6e-98
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   287   5e-97
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   286   2e-96
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   279   1e-93
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   278   2e-93
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   268   3e-89
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   267   5e-89
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   263   2e-87
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   263   3e-87
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   256   3e-84
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   254   2e-83
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   251   1e-82
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   233   2e-75
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   231   5e-75
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   178   1e-54
Smik_16.167 Chr16 complement(307415..308290) [876 bp, 291 aa] {O...    31   2.4  
TBLA0C06990 Chr3 complement(1686545..1688080) [1536 bp, 511 aa] ...    30   9.9  

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/275 (93%), Positives = 258/275 (93%)

Query: 1   MFPRCLKLVTVRRGLNFTSVRCAANNSPSSTTKLSKEQMXXXXXXXXXXXXXXXXXSPFE 60
           MFPRCLKLVTVRRGLNFTSVRCAANNSPSSTTKLSKEQM                 SPFE
Sbjct: 1   MFPRCLKLVTVRRGLNFTSVRCAANNSPSSTTKLSKEQMKKKELRALLQKRAAAKKSPFE 60

Query: 61  HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV 120
           HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV
Sbjct: 61  HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV 120

Query: 121 FTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLG 180
           FTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLG
Sbjct: 121 FTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLG 180

Query: 181 PRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQK 240
           PRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQK
Sbjct: 181 PRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQK 240

Query: 241 AFKQALADQQGKKSSILGKTTVTSTHGPGIVIDFR 275
           AFKQALADQQGKKSSILGKTTVTSTHGPGIVIDFR
Sbjct: 241 AFKQALADQQGKKSSILGKTTVTSTHGPGIVIDFR 275

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  320 bits (820), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 154/267 (57%), Positives = 202/267 (75%), Gaps = 1/267 (0%)

Query: 9   VTVRRGLNFTSVRCAANNSPSS-TTKLSKEQMXXXXXXXXXXXXXXXXXSPFEHPLYMPV 67
           ++  R   F +     +  PS+  TKLSK+Q+                    +HPLYMPV
Sbjct: 18  ISCTRTSLFHTFTALKSEEPSTIATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPV 77

Query: 68  QQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQ 127
            QA RFLRAAEVGQP SQQTISLTT+V+S++GAP L+GNI FP PL+DVK+AVFTN++++
Sbjct: 78  TQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDK 137

Query: 128 EEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPA 187
            ++AR+QF CHLVGG+ELIE IK G+ P+DFDKA ATPD+   LTSQL  +LGPR LLP 
Sbjct: 138 LKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTSQLGRILGPRGLLPN 197

Query: 188 VKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALA 247
            KKGTV+E+I++LI+++M T+PFRQRG  +S+AV KC F+D Q+L+NI+A QK+FK ALA
Sbjct: 198 AKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALA 257

Query: 248 DQQGKKSSILGKTTVTSTHGPGIVIDF 274
           +Q+ KK SILG+TT+T+THGPG+VIDF
Sbjct: 258 NQKAKKPSILGQTTLTTTHGPGLVIDF 284

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  320 bits (820), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 147/246 (59%), Positives = 196/246 (79%)

Query: 29  SSTTKLSKEQMXXXXXXXXXXXXXXXXXSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTI 88
           ++T+KLSK+Q+                    EHPLYMPV +A RFLRAAEVGQP SQQT+
Sbjct: 35  NATSKLSKDQLKKREVRRFAQKKAAARRPASEHPLYMPVDKALRFLRAAEVGQPQSQQTL 94

Query: 89  SLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEA 148
           S+TT+V+S++GAPLLSGN+ FPN L+++K+AVFTN+++Q ++ARE+F CH+VGG+EL+E 
Sbjct: 95  SVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEK 154

Query: 149 IKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIANLIRENMFTV 208
           IK G  P+DFDK+ ATP++   L SQL  +LGPR LLPA KKGTVSEN+ +LI+++M T+
Sbjct: 155 IKQGQVPLDFDKSFATPEIATLLASQLGRILGPRGLLPAAKKGTVSENLESLIKDSMGTL 214

Query: 209 PFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGP 268
           PFRQRG  +S+AVG+C F+DKQLL+NIVA QK+ K+ALA+Q+ KK S+LG+TT+TST GP
Sbjct: 215 PFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGP 274

Query: 269 GIVIDF 274
           GIVIDF
Sbjct: 275 GIVIDF 280

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  310 bits (794), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 147/258 (56%), Positives = 194/258 (75%), Gaps = 1/258 (0%)

Query: 17  FTSVRCAANNSPSSTTKLSKEQMXXXXXXXXXXXXXXXXXSPFEHPLYMPVQQAFRFLRA 76
           F+++R     SP   +KLSK+Q+                    +HPLYMPV +A RFLRA
Sbjct: 24  FSALRAEETPSPV-VSKLSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKALRFLRA 82

Query: 77  AEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFK 136
           AE GQP SQQT+S+TT+V+S++GAP LSGN+ FP PL+D+K+AVFTN+++Q ++ARE+F 
Sbjct: 83  AEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFG 142

Query: 137 CHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSEN 196
           CHLVGG++L+E IK G   +DFDK+ ATP++   L SQL  +LGPR LLPA KKGTV+EN
Sbjct: 143 CHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKKGTVAEN 202

Query: 197 IANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSI 256
           +  L++ +M T+PFRQRG  +SVAVGKC F+DKQLL+NI+A QK  K+ALA Q+ KK S+
Sbjct: 203 LEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSL 262

Query: 257 LGKTTVTSTHGPGIVIDF 274
           LG+TT+TSTHGPGIVIDF
Sbjct: 263 LGQTTLTSTHGPGIVIDF 280

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  292 bits (748), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 137/274 (50%), Positives = 200/274 (72%), Gaps = 2/274 (0%)

Query: 1   MFPRCLKLVTVRRGLNFTSVRCAANNSPSSTTKLSKEQMXXXXXXXXXXXXXXXXXSPFE 60
           +F R + L++ RRGL+ T+V+ +   + ++++KLSK+Q+                     
Sbjct: 2   LFSR-VGLLSFRRGLHLTAVQLS-QEAAATSSKLSKDQLKKRELRRLAQRKAAARRPASA 59

Query: 61  HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV 120
            PLYMPVQQA RFLRAAEVGQP +QQTIS+ T+V+ DKGA LLSG +  P+P+R+ KVAV
Sbjct: 60  SPLYMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAV 119

Query: 121 FTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLG 180
           FTN+ EQ E AR ++ C+LVGG EL+E +K+G+  +DFDKA ATPD+   + ++L  VLG
Sbjct: 120 FTNDPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLG 179

Query: 181 PRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQK 240
           P+ LLP+VKKGTV+ +++ L+ +++ + PF+QR   +S+A+GKC FSD+Q+++N++AVQ 
Sbjct: 180 PKGLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQA 239

Query: 241 AFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
           AF+ A+  Q+ KK+S+ G TT+TSTHGPGIVIDF
Sbjct: 240 AFRAAMTSQKTKKTSLFGTTTLTSTHGPGIVIDF 273

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  289 bits (740), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 143/274 (52%), Positives = 190/274 (69%), Gaps = 9/274 (3%)

Query: 1   MFPRCLKLVTVRRGLNFTSVRCAANNSPSSTTKLSKEQMXXXXXXXXXXXXXXXXXSPFE 60
           MFPR        R    TS R A        TKL+KEQ+                    +
Sbjct: 1   MFPRIFT-----RQFQITSFRLAEETG----TKLTKEQLRKRELRKMVQRRLQAKTPASD 51

Query: 61  HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV 120
           HPLYMPV +A R+LRA EVGQP SQQTI+LTT+VV+++G P L+GN+ F  PL+DVKVAV
Sbjct: 52  HPLYMPVSRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAV 111

Query: 121 FTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLG 180
           FTN++ Q  + ++++  HLVGG++L+  IK G+  IDFDKA ATPD+V QL SQ+  +LG
Sbjct: 112 FTNDEAQAALMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILG 171

Query: 181 PRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQK 240
           PR LLP  KKGTV+E++  LI+++M +VPFRQRG  +S+ V K  F+DK++L+N++A QK
Sbjct: 172 PRGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQK 231

Query: 241 AFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
           AFKQ++ +QQ KK SIL +TT+TSTHGPGIVIDF
Sbjct: 232 AFKQSITNQQTKKPSILSQTTLTSTHGPGIVIDF 265

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  287 bits (735), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 135/246 (54%), Positives = 190/246 (77%), Gaps = 1/246 (0%)

Query: 29  SSTTKLSKEQMXXXXXXXXXXXXXXXXXSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTI 88
           +  +KLSK+Q+                     HPLYM V QA RFLRAAEVGQP SQQTI
Sbjct: 33  AQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTI 92

Query: 89  SLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEA 148
           +LTT+VVS+KG+P L+G+I F  PL++VK+A+FTN++ Q ++A+E+F C++VGG+ELI  
Sbjct: 93  NLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISK 152

Query: 149 IKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIANLIRENMFTV 208
           IKNG+  +DFDKA ATPD+V +L S +A +LGPR + P++KKGTVSEN+ +LI+ N+ ++
Sbjct: 153 IKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSI 211

Query: 209 PFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGP 268
           PFRQ G  +SVA+GKC+FSD+Q+L+N+++V+KAFK +++ Q+ KK SILGKT +++THGP
Sbjct: 212 PFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGP 271

Query: 269 GIVIDF 274
           GIVIDF
Sbjct: 272 GIVIDF 277

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  286 bits (731), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 143/270 (52%), Positives = 199/270 (73%)

Query: 5   CLKLVTVRRGLNFTSVRCAANNSPSSTTKLSKEQMXXXXXXXXXXXXXXXXXSPFEHPLY 64
           C+    +RR    T     A  + ++ +KLSK+Q+                 SP +HPLY
Sbjct: 6   CIGRSVLRRSFLHTGNVLRAEEAAANVSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLY 65

Query: 65  MPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNN 124
           M +  A RFLRAAEVGQP +QQTI+LTT VV+++G P L+G++ FP PL++VK+AVF+ +
Sbjct: 66  MSIPMALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGD 125

Query: 125 KEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRL 184
           ++Q +VARE+F CHLVGGTE+IE IK+G+ P+DFDKA ATPD+   LTSQLA +LGPR +
Sbjct: 126 EDQLKVAREKFNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARILGPRGV 185

Query: 185 LPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQ 244
           LP VKKGTV+ +++ L++++M ++PFRQRG  +S+AVGK  FSD+Q+L+N +A   A K+
Sbjct: 186 LPTVKKGTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDAVKE 245

Query: 245 ALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
           ALA+Q  KK+S+LGKTT++STHGPGIVIDF
Sbjct: 246 ALANQVSKKTSLLGKTTLSSTHGPGIVIDF 275

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  279 bits (713), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 129/270 (47%), Positives = 195/270 (72%), Gaps = 5/270 (1%)

Query: 10  TVRRGLNFTSVRC-----AANNSPSSTTKLSKEQMXXXXXXXXXXXXXXXXXSPFEHPLY 64
           ++R  L  ++ RC     A   +  + +KL+KEQ+                     HPLY
Sbjct: 7   SLRSQLLGSTSRCLFHTAALLRAEEAGSKLTKEQLRKREVRRAARRKVEAKKPAHTHPLY 66

Query: 65  MPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNN 124
           MP   A R+LRA EVG P SQQ I++TT VV+D+G P ++GN+  P+PL+DV VAVF+N+
Sbjct: 67  MPTPLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVAVFSND 126

Query: 125 KEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRL 184
           ++Q  +AR++F+CHLVGG+++I  IK G+ P+DFDKA ATPD+  +LTSQ+A +LGP+++
Sbjct: 127 EQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQV 186

Query: 185 LPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQ 244
           LP  K+GTV+ ++  LI+++  ++PFRQ+G  +S+AV KC+FSD+Q+L+N++AVQ AFK+
Sbjct: 187 LPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKE 246

Query: 245 ALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
           A+++Q+ K+ SILG+TT+T+THGPGIVID 
Sbjct: 247 AVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  278 bits (711), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 126/214 (58%), Positives = 172/214 (80%)

Query: 61  HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV 120
           +PLYMP+ QA R+LRAAEVGQP SQQ I++TT VVS++G   L+GNI +  P++DVK+AV
Sbjct: 67  YPLYMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIKDVKIAV 126

Query: 121 FTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLG 180
           F+N+ E+    +E+  CHL+GGT+L+E IK+G  P+DFDKA ATPD+   LTSQLA VLG
Sbjct: 127 FSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQLARVLG 186

Query: 181 PRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQK 240
           PR +LP +KKGTVSE++++LI+ ++  +PFRQ G  +SV+VG+C+FSDKQ+L+NI+AV+ 
Sbjct: 187 PRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRS 246

Query: 241 AFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
           A+   L+ Q+ KK S+LGKTT+TSTHGPGI IDF
Sbjct: 247 AYNTTLSSQKSKKPSLLGKTTITSTHGPGITIDF 280

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  268 bits (684), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 121/213 (56%), Positives = 173/213 (81%)

Query: 62  PLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVF 121
           PLYMPV +A R+LRAAEVG+P SQQTI+LTT+VV ++G   LSG++ FP PLR +K+A F
Sbjct: 72  PLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAF 131

Query: 122 TNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGP 181
           TN++ + E  RE++  HL+GG +L+  IK+G+  +DFDKA ATPD+V  L SQ+A +LGP
Sbjct: 132 TNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGP 191

Query: 182 RRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKA 241
           R +LP+VKKGTVS++I++L++E++ ++PFRQRG  +S+ VGKC F+D+++LQNI++ + A
Sbjct: 192 RGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAA 251

Query: 242 FKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
           FK A+ +Q+ KK +IL KTT++STHGPGIVIDF
Sbjct: 252 FKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDF 284

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  267 bits (683), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 133/282 (47%), Positives = 193/282 (68%), Gaps = 13/282 (4%)

Query: 2   FPRCLKLVTVRRGLNFTSVRCAA---------NNSPSSTTKLSKEQMXXXXXXXXXXXXX 52
            P+     + RR L+ T+ +  A         +N+PS    L+K+Q              
Sbjct: 7   IPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPS----LTKDQAKKRELKRLAQRKA 62

Query: 53  XXXXSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNP 112
                   +PLYMPV  A R+LRAAEVG+P SQQTI+LTT+VV ++G   LSG++ FP P
Sbjct: 63  EAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKP 122

Query: 113 LRDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLT 172
           LR +KVA FTN++ + E  R+++  HL+GG +L+  IK+G+ P+DFDKA ATPD+V  L 
Sbjct: 123 LRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQ 182

Query: 173 SQLASVLGPRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLL 232
           SQ+A +LGPR +LP++KKGTVS++I +L+ E++ ++PFRQRG  +S+ VGKC FSD+++L
Sbjct: 183 SQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREIL 242

Query: 233 QNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
           QNI++ + AFK A+ +Q+ KK ++L KTT++STHGPGIVIDF
Sbjct: 243 QNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDF 284

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  263 bits (672), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 137/281 (48%), Positives = 196/281 (69%), Gaps = 13/281 (4%)

Query: 3   PRCLKLVTVRRGLNFTSVRCAA---------NNSPSSTTKLSKEQMXXXXXXXXXXXXXX 53
           P+   + + RR L+ T+ +  A         +N+PS    L+KEQ               
Sbjct: 8   PKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPS----LTKEQAKKRELKRLAQRRAE 63

Query: 54  XXXSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPL 113
                  +PLYMPV  A R+LRAAEVG+P SQQTI+LTT+VV ++G   LSG++ FP PL
Sbjct: 64  AKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPL 123

Query: 114 RDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTS 173
           R +KVAVFTN++ + +  RE++  HL+GG +L+  IKNG+ P+DFDKA AT D+V  L S
Sbjct: 124 RYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQS 183

Query: 174 QLASVLGPRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQ 233
           Q+A +LGPR +LP+VKKGTVS++I +L++E++ ++PFRQRG  +S+ +GKC F+D+++LQ
Sbjct: 184 QVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQ 243

Query: 234 NIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
           NI+A + AFK A++DQ+ KK +IL KTT++STHGPGIVIDF
Sbjct: 244 NIIAARAAFKAAVSDQKSKKPNILSKTTLSSTHGPGIVIDF 284

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  263 bits (671), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 191/273 (69%), Gaps = 13/273 (4%)

Query: 11  VRRGLNFTSVRCAA---------NNSPSSTTKLSKEQMXXXXXXXXXXXXXXXXXSPFEH 61
           +RR L+ T+ +  A         +N+PS    L+K+Q                       
Sbjct: 16  IRRYLSHTARQLYAEEYKTAAMSSNAPS----LTKDQAKKRELKRLAQRRAEAKRPAATS 71

Query: 62  PLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVF 121
           PL+MPV  A R+LRAAEVG+P SQQTI+LTT+VV ++G   +SGN+ F  PLR VKVAVF
Sbjct: 72  PLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVF 131

Query: 122 TNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGP 181
           TN++ + +  RE++   +VGGT+L+  IKN ++P+DFDKA ATPD+V  L SQ+A +LGP
Sbjct: 132 TNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGP 191

Query: 182 RRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKA 241
           R +LP+VKKGTVS++I +L++E++ ++PFRQRG  +S+ +GKC F+D++LLQNI++ + A
Sbjct: 192 RGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTA 251

Query: 242 FKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
           F+ A+ +Q+ KK S+L KTT++STHGPGIVIDF
Sbjct: 252 FRAAVDNQKAKKPSLLSKTTLSSTHGPGIVIDF 284

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  256 bits (654), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 129/270 (47%), Positives = 181/270 (67%), Gaps = 9/270 (3%)

Query: 13  RGLNFTSVRCAANNSPSSTTK--------LSKEQMXXXXXXXXXXXXXXXXXSPFEHPLY 64
           RG++ TS    A  + S+TT         LSKEQ+                     HPLY
Sbjct: 45  RGIHSTS-NVGAEEAASTTTSATIPVVPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLY 103

Query: 65  MPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNN 124
           MPV +A R++RAAEVG+P  QQTI+LT++VV++KG   L+G+I  P PL+ +KVAVF+ N
Sbjct: 104 MPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQN 163

Query: 125 KEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRL 184
           +E     +E++ CHLVGG ELI  IKNG+   DFDKA A+ D+   L++QL   LG R L
Sbjct: 164 EELLTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLGRRGL 223

Query: 185 LPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQ 244
           LP  KKGTVS+++ +L+ + + ++PFRQ G  +S+ +GKC FSD+++L+NI+A + A  +
Sbjct: 224 LPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMK 283

Query: 245 ALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
           AL++Q+ KK SILGKTT++STHGPGIVIDF
Sbjct: 284 ALSEQKSKKPSILGKTTLSSTHGPGIVIDF 313

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  254 bits (649), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 126/256 (49%), Positives = 169/256 (66%)

Query: 19  SVRCAANNSPSSTTKLSKEQMXXXXXXXXXXXXXXXXXSPFEHPLYMPVQQAFRFLRAAE 78
           S     N  P++ TKLSKEQ+                     HPLYM V  A RF+RAAE
Sbjct: 58  STTSGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAE 117

Query: 79  VGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFKCH 138
           VG+P  QQTI+LTT++VS+KG  LL+GN+    PL+++K+AVF+ +KE  E  + QF C 
Sbjct: 118 VGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQ 177

Query: 139 LVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIA 198
           LVGG E +E IK+G    +FD A ATP++V  + SQL   LG R +LP  KKGTVS+++ 
Sbjct: 178 LVGGNETVEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLV 237

Query: 199 NLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILG 258
            L+   M  +PF+Q G  +S+ +GKC FSDK +L NI+A + AFK+ALA+Q+ K+ SIL 
Sbjct: 238 TLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILS 297

Query: 259 KTTVTSTHGPGIVIDF 274
           KTT++STHGPGIVIDF
Sbjct: 298 KTTLSSTHGPGIVIDF 313

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  251 bits (640), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 120/215 (55%), Positives = 159/215 (73%), Gaps = 1/215 (0%)

Query: 61  HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV 120
           HPLYM V  A RFLRA EVGQP SQQTI+LTT+V+S+KG P + GN+  P PLR+ KV V
Sbjct: 65  HPLYMKVPDALRFLRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVV 124

Query: 121 FTNNKEQEEVAREQFK-CHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVL 179
            +++ ++ E  ++ FK  HLVGG EL++  KN D  IDFDK +ATPD++      L  + 
Sbjct: 125 LSDDPKKLEEVQDNFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMF 184

Query: 180 GPRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQ 239
           GP+ LLP VKKGTVSEN+  L+ EN+ ++PFRQR   +S+ +GK +FSDKQ+L+NI+A +
Sbjct: 185 GPKGLLPNVKKGTVSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATR 244

Query: 240 KAFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
           +AF   L++Q+ KK S LGKTT+TSTHGPGIVIDF
Sbjct: 245 EAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIVIDF 279

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  233 bits (594), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 112/221 (50%), Positives = 165/221 (74%), Gaps = 6/221 (2%)

Query: 61  HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV 120
           HPLYMP+  A R+LR+AEVG+P   QTI++TT+VV+DKG   L+GNILFP+PL+ +K+A+
Sbjct: 70  HPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVVADKGNAALAGNILFPHPLKQMKIAI 129

Query: 121 FTNNKEQEEVAREQF--KCHLVGGTELIEAIKNGDTPID-FDKALATPDVVAQLTSQLAS 177
           F++NKE+ +  + ++  +  + GG ++I  IK+G   +D  +K  ATP++   + SQL  
Sbjct: 130 FSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGKIKVDGVNKVFATPEIFPTIASQLGR 189

Query: 178 VLGPRRLLPAVKK---GTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQN 234
           VLGP+ L+P +KK    TV E++ +LI EN+  V FRQRG  LSV+VG+C+FSD+ +L+N
Sbjct: 190 VLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSVSVGRCNFSDRDILEN 249

Query: 235 IVAVQKAFKQALADQQGKKSSILGKTTVTSTHGPGIVIDFR 275
           I+AV+ AFKQ+++ Q  KK SILGKTT+++T GPGIVIDF+
Sbjct: 250 IIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPGIVIDFQ 290

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  231 bits (590), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 111/242 (45%), Positives = 164/242 (67%)

Query: 33  KLSKEQMXXXXXXXXXXXXXXXXXSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTISLTT 92
           KL+KEQ+                    +  +Y+ V +A R LRA EVGQP SQQTI+LTT
Sbjct: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102

Query: 93  VVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEAIKNG 152
           +VVS+KG P L G+++ P PL+ V++A F+ + E  +  +E+ +  +VGG ELI+ +K+G
Sbjct: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162

Query: 153 DTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIANLIRENMFTVPFRQ 212
           + P+ FDKA ATPD+  QL S+L ++LG R LLP +KKGTV  ++  +IR  +  +PFRQ
Sbjct: 163 EVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222

Query: 213 RGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGPGIVI 272
           R   L+  + KC FSD+Q+L N++A ++AF+ A+ +Q+ KK SILG++T++STHGPGIVI
Sbjct: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282

Query: 273 DF 274
           D 
Sbjct: 283 DL 284

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  178 bits (452), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 91/214 (42%), Positives = 141/214 (65%), Gaps = 2/214 (0%)

Query: 61  HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV 120
           HPL M V  A R+LRA E G+  S+QT++L TVV + +G   L G I F   +R   +AV
Sbjct: 29  HPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAV 88

Query: 121 FTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLG 180
           FT + EQ ++A+E     ++GG+ELI+ I +G+  I F  A AT D+V  L +++A  LG
Sbjct: 89  FTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLG 146

Query: 181 PRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQK 240
            +++LP +KK TV +NI  L+++ ++ VPF ++  F+S  VGKC F+D+++L+N++  ++
Sbjct: 147 KQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKARE 206

Query: 241 AFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274
             ++AL +Q  KK S + K T+TSTHGPGI ID 
Sbjct: 207 GLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>Smik_16.167 Chr16 complement(307415..308290) [876 bp, 291 aa] {ON}
           YPL068C (REAL)
          Length = 291

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 11/77 (14%)

Query: 201 IRENMFTVPFRQRGPFLS-----VAVGKCDF------SDKQLLQNIVAVQKAFKQALADQ 249
           +++N+  +  RQ   F         VG  +F      +D QLLQNIV++   F+Q   D 
Sbjct: 93  VQKNLLDLIKRQESLFYKNIDKPTLVGLKNFEMLRLPNDLQLLQNIVSLLHLFEQLNHDS 152

Query: 250 QGKKSSILGKTTVTSTH 266
           +GK +S     T + +H
Sbjct: 153 KGKSASAGRAKTFSQSH 169

>TBLA0C06990 Chr3 complement(1686545..1688080) [1536 bp, 511 aa]
           {ON} Anc_5.21 YMR300C
          Length = 511

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 39/98 (39%), Gaps = 6/98 (6%)

Query: 135 FKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVS 194
           ++  +  GT+L E IK+  +P + D  +  PD       Q AS LG       VK   V 
Sbjct: 279 YRTRIEMGTKLAENIKSKMSPDEIDVVIPVPDTARTCALQCASALGKPYREGFVKNRYVG 338

Query: 195 ENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLL 232
                  +E   T   R+  P  S      +F DK +L
Sbjct: 339 RTFIMPNQEQRLTSVRRKLNPMES------EFKDKNVL 370

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,032,050
Number of extensions: 929595
Number of successful extensions: 2133
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2177
Number of HSP's successfully gapped: 29
Length of query: 275
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 167
Effective length of database: 41,097,471
Effective search space: 6863277657
Effective search space used: 6863277657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)