Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43018.269ON56456428540.0
AGR079W8.269ON54256912791e-171
SAKL0H16874g8.269ON56356112421e-165
KLTH0G13530g8.269ON57456512351e-164
Kwal_56.237718.269ON56256112181e-161
YDR117C (TMA64)8.269ON56556711971e-158
Suva_2.2768.269ON56556611671e-154
TDEL0F039608.269ON55856311641e-153
TPHA0J007808.269ON58358211521e-151
CAGL0B01837g8.269ON56956611491e-151
Skud_4.3778.269ON56257311331e-149
Smik_4.3618.269ON56556911221e-147
ZYRO0C01496g8.269ON56756511171e-146
NCAS0B038008.269ON56556410751e-140
KAFR0B054708.269ON56256810551e-137
KLLA0F19294g8.269ON57057110471e-135
NDAI0J013108.269ON57958110481e-135
Kpol_392.28.269ON56656910241e-132
TBLA0I032008.269ON56357210061e-129
KNAG0H032008.269ON5615728511e-106
Kwal_55.199187.470ON23660713.7
SAKL0F05368g7.126ON23174679.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4301
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...  1103   0.0  
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   497   e-171
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   483   e-165
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   480   e-164
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   473   e-161
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   465   e-158
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   454   e-154
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   452   e-153
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   448   e-151
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   447   e-151
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   441   e-149
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   436   e-147
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   434   e-146
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   418   e-140
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   410   e-137
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   407   e-135
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   408   e-135
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   399   e-132
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   392   e-129
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   332   e-106
Kwal_55.19918 s55 complement(176744..177454) [711 bp, 236 aa] {O...    32   3.7  
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...    30   9.1  

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/564 (95%), Positives = 541/564 (95%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
           DNKPIFFKEKHSEFLIPTILTCWQYPG            DNKLKNGADLMLPGTIPPFSD
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
           NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240
           VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240

Query: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300
           LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA
Sbjct: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300

Query: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKNNDKHDVE 360
           SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKNNDKHDVE
Sbjct: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKNNDKHDVE 360

Query: 361 VVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILLDDTLF 420
           VVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILLDDTLF
Sbjct: 361 VVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILLDDTLF 420

Query: 421 SLAYKKSASDSTRKVLRAKMFDLILSTSFTEVFFIFKDGXXXXXXXXXXXNRNVSVMTEM 480
           SLAYKKSASDSTRKVLRAKMFDLILSTSFTEVFFIFKDG           NRNVSVMTEM
Sbjct: 421 SLAYKKSASDSTRKVLRAKMFDLILSTSFTEVFFIFKDGKPLSSKPLKSKNRNVSVMTEM 480

Query: 481 KIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQGPHGNTAI 540
           KIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQGPHGNTAI
Sbjct: 481 KIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQGPHGNTAI 540

Query: 541 NILNEHGIPSKYIDFDNKLNKKKK 564
           NILNEHGIPSKYIDFDNKLNKKKK
Sbjct: 541 NILNEHGIPSKYIDFDNKLNKKKK 564

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  497 bits (1279), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 258/569 (45%), Positives = 355/569 (62%), Gaps = 33/569 (5%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK+P +   SN KNSERK+L  ++R Q   + +QFS+T +K  TFKT +  GT++TD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
           +N P++F+ KH +  IPT+ +CW +P             ++KLK GADLMLPGT+PPFS 
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
              RG++VG+AS+  P VV+A+G+C+++L G+  V   TGVAV+VLHT  DGL  VFK+ 
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTA---KTASGPLEEPNSLSEVAEQ 237
            E P                 +A +A G   +   P A   KTA G          +AE+
Sbjct: 181 REAP-----------------EASEAKGASPEAREPEAEPPKTAPG--------EGLAEE 215

Query: 238 LEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSW 297
           LE L++E VDH LT+AVYYT+  D  L+LP+ AS FIA HV+KNLP +  +QV++KRSSW
Sbjct: 216 LERLTMEDVDHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSW 275

Query: 298 ARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKNND-K 356
            +A+K LK+FE QG L LKGK E+ TVVSVN     +KSF+PYRT+    ST SKN+   
Sbjct: 276 GKAAKLLKHFEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTT 335

Query: 357 HDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILLD 416
             +E+V +Y P  T    L+ LG +    L AKDI+  L +YV  +K V+  D+ ++ LD
Sbjct: 336 QSLEIVYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLD 395

Query: 417 DTLFSLAYKKSASDSTRKVLRAKMFDLILSTSFTEVFFIFKDGXXXXXXXXXXXNRNVSV 476
           DTL  L +K   +D+ R + R +    +LS SF+E F + + G              + V
Sbjct: 396 DTLAQLLHKNVNADTPRSLPRPEALAALLSRSFSEYFVVMR-GDAPLSKPQKGRAPPIKV 454

Query: 477 MTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLE-PSTLQSTTEVQVQGPH 535
             E KI++K+VT++SNFE+YGVDPEEL+ ELR RCSGS+T+ + P+T     EVQVQGPH
Sbjct: 455 TNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNT--KAVEVQVQGPH 512

Query: 536 GNTAINILNEHGIPSKYIDFDNKLNKKKK 564
             T ++ILN+HGIPSKYI  D K+  KKK
Sbjct: 513 EATIVSILNKHGIPSKYITLDCKVQPKKK 541

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  483 bits (1242), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 252/561 (44%), Positives = 358/561 (63%), Gaps = 17/561 (3%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK P IK+ SNLKNSERKKLL +VR Q    ++QF T +VKQ TFK  T+ GT++TDE
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
            N PI+FKEKH   + PT+ TCW  P             + KL  GADLMLPG +PPFS 
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
            C++G LVGVAS+ +P V++AIG+ QL+L    +V+GETGVAV ++HT +DGL + FKM 
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 VEPPSQL--LVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQL 238
           +EPP  +    S+  E E E +  AD+A  I          T            + +EQL
Sbjct: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNT-----------EDASEQL 229

Query: 239 EELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWA 298
            ELS E +DHFLT+++YYTL  D+ L+LP+ ASNF++NH++ NLP +   Q+++K+SSW 
Sbjct: 230 NELSAEDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWK 289

Query: 299 RASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKNNDKHD 358
           +++KFLK+FE   FLKLKGK ++L VV +NKDK E+K F PYR       T +K   + +
Sbjct: 290 KSAKFLKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKAQEN 349

Query: 359 ---VEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILL 415
              ++ V  Y+P+++AK    A+   PN +  A+++KA L+ Y+ +K LVN  D++++LL
Sbjct: 350 SNMMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLL 409

Query: 416 DDTLFSLAYKKSASDST-RKVLRAKMFDLILSTSFTEVFFIFKDGXXXXXXXXXXXNRNV 474
           DDTLF +  + +  ++  R + RA++    L+ +FTE F I K                +
Sbjct: 410 DDTLFPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKGDVPLFKTALKGAIPEI 469

Query: 475 SVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQGP 534
            ++TEMKI RK+VT++SNFE + +D E L+ ELRKRCSGS+T+ E  +   T EV VQGP
Sbjct: 470 QIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGP 529

Query: 535 HGNTAINILNEHGIPSKYIDF 555
           HG   I +LNE+GIP+K+I+F
Sbjct: 530 HGAIVIGMLNEYGIPTKWINF 550

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  480 bits (1235), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 249/565 (44%), Positives = 360/565 (63%), Gaps = 12/565 (2%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK+P IK+ SNLKNSERK +    + Q  + E+ F + ++KQ TFKTP  TGT+FTD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
            N PI+FKEK S+ L PT+ TCW                + KL  GA+LMLPGT+PPF +
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
            C + ++V VAS+  P VV+AIG+ Q+NL    +V+GE+GVAV+++HT  D L +VFK+ 
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240
           ++PP         E E EA  + DD G     E L   K+     E   ++ +++EQL E
Sbjct: 181 LQPPEGSAAILDSESEEEADIE-DDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTE 239

Query: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300
           L +E VDHF T+++YY+LA D  L+ PI ASNF++NH+++NLP I  TQV++K++SW + 
Sbjct: 240 LRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKT 299

Query: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKN-----ND 355
           +KFLKYFE +GFLKLKGK ++LT++ V++ K+E+K+F PYR I    S+S K      N+
Sbjct: 300 AKFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYR-IGGGASSSEKGASSVANE 358

Query: 356 KHDVEV---VVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERI 412
           K    V   V  Y+P+++ KA L A    PN M   +DIK+ ++KY++ K LV+  ++  
Sbjct: 359 KEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSA 418

Query: 413 ILLDDTLFSLAYKKSASD-STRKVLRAKMFDLILSTSFTEVFFIFK-DGXXXXXXXXXXX 470
           + LDD L+ L  + S  + + R + RA++   +L  +F+E F I K DG           
Sbjct: 419 VRLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGS 478

Query: 471 NRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQ 530
              V ++TEMKI RK+VT++SNFE + VD +EL+  LRK+CSGS+T+ E +T   T EV 
Sbjct: 479 IPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVT 538

Query: 531 VQGPHGNTAINILNEHGIPSKYIDF 555
           VQGPHG   I +LNE GIP+K+I+F
Sbjct: 539 VQGPHGPAVIELLNESGIPTKWINF 563

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  473 bits (1218), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 243/561 (43%), Positives = 366/561 (65%), Gaps = 12/561 (2%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK+P IK+ SNLKNSERKKL    R Q    ++ F + ++KQ TFKTP  TGT++TD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
            N PI+FKEK S+ L PT+ +CW                + KL  GA+LMLPGT+PPF +
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
            C + K+VGVAS+ +P VV+AIG+ QLNL    +V+GE+GVAV+++HT +D L + FK+ 
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEP-NSLSEVAEQLE 239
           ++PP         E + E  + A+ +G I+           S PL+EP  ++ + AEQL 
Sbjct: 181 LQPPEG--ADGIAESDSEENSDAEVSGAIK------IEPKPSAPLQEPIVNIDDAAEQLS 232

Query: 240 ELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWAR 299
           +LS+E VDHF T+A+YYTL  D+ L++P  ASNF++NH+++NLP +  TQV++K++SW +
Sbjct: 233 QLSVEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKK 292

Query: 300 ASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKNNDKHD- 358
            +KFLK+FE +GFLKLKGK ++LT+V ++K K E+K F PYRT   S  ++   ++++  
Sbjct: 293 TAKFLKHFEKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGSTGSESEQNSM 352

Query: 359 VEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILLDDT 418
           ++ +V Y+P+++AK  L A   +PN+M   +++K  ++ Y+  K LV+  ++  + LDD 
Sbjct: 353 MKALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDL 412

Query: 419 LFSLAYKKSASD-STRKVLRAKMFDLILSTSFTEVFFIFK-DGXXXXXXXXXXXNRNVSV 476
           LFSL  + +  + + R +LRA++   IL  +F E F + K DG              + +
Sbjct: 413 LFSLVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQI 472

Query: 477 MTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQGPHG 536
           +TEMKI RK+VT++SNFE + VD +EL+  LRK+CSGS+T+ E +T   TTEV VQGPHG
Sbjct: 473 VTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHG 532

Query: 537 NTAINILNEHGIPSKYIDFDN 557
              I +LN+  IP+K+I+F N
Sbjct: 533 PAVIELLNQLAIPTKWINFVN 553

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  465 bits (1197), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 243/567 (42%), Positives = 361/567 (63%), Gaps = 20/567 (3%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK+P IK+ SNLKNSERKKLL   + Q  N+E+ F T+ +KQ  F    + GT++TDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
           +N PI FKEKH E L PT+ +CW+YP             +  L NGA+LM+ G+IPPF  
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
            C  G L G+AS + P  V AIG+ +L+L    KV+GETGVAVK++H  NDGL +VFKM 
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 VEPPSQLLV-SQKHEVELEALAQADDAGGIQ-EDEDLPTAKTASGPLEEPNSLSEVAEQL 238
           +EPP  L   S+ + +  + +  ++    ++ E ED+   K AS  +E      E+AE L
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDV---KEASVDVE------EIAEVL 231

Query: 239 EELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWA 298
           +  ++  VD+F+T+A+YYTL  D  L+LPI ASNFI+NH+M+NLP I   +V++K++SW 
Sbjct: 232 DHFTVSDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWK 291

Query: 299 RASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR------TIQKSVSTSSK 352
           +++KFLK+FE +GFLKLKGK ++LT+V  N DK E+K+F PY+        +   ST+SK
Sbjct: 292 KSAKFLKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSK 351

Query: 353 NNDKHDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERI 412
                 +  +  Y+P N AK  L  +    +    ++DI++ +++Y++ K L +  D+  
Sbjct: 352 EKTSGMMYSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGK 411

Query: 413 ILLDDTLFSLA-YKKSASDSTRKVLRAKMFDLILSTSFTEVFFIFK-DGXXXXXXXXXXX 470
           +++DD LF +   KK   +++R + R ++   +L+ +FTE + IFK D            
Sbjct: 412 VIMDDLLFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGS 471

Query: 471 NRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQ 530
             ++ ++TEMKI RK++TR+SNFE++ VDPE L+ +LRK CSGS+T+ E  T +   EVQ
Sbjct: 472 LPHIKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFK-CAEVQ 530

Query: 531 VQGPHGNTAINILNEHGIPSKYIDFDN 557
           VQGPHG + I+ LN+ GIPSK+IDF+N
Sbjct: 531 VQGPHGQSIIDHLNKLGIPSKWIDFEN 557

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  454 bits (1167), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 238/566 (42%), Positives = 356/566 (62%), Gaps = 18/566 (3%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK+P IK+ SNLKNSERKKLL   + Q  N+E+ F T+ +KQ  F    + GT++TDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
           +N PI FKEKH+E L PT+ +CW+               +  L NGA+LM+ G+IPPF  
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
            C  G L GVAS + P +V A+G+ +++L    +V+GETGVAVK++H  NDGL + FK+ 
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPN-SLSEVAEQLE 239
           +EPP+   V+ + E          D   I+  E   T +     ++E N ++ E+AE L+
Sbjct: 181 LEPPAAFDVASEDE--------DIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLD 232

Query: 240 ELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWAR 299
            LS+  VD+F+T+A+YYTL  D +L LPI ASNFI+NH+M+NLP I   +V++KR+SW +
Sbjct: 233 HLSVSDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKK 292

Query: 300 ASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR------TIQKSVSTSSKN 353
           ++KFLK+FE +GFLKLKGK ++LT+V  N DK E+K+F PY+        +K  +T+SK 
Sbjct: 293 SAKFLKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKE 352

Query: 354 NDKHDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERII 413
                +  +  Y+P N AK  +            ++DI++ + +Y++ K LV+A D+  +
Sbjct: 353 KTSGMMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKV 412

Query: 414 LLDDTLFSLAYKKSAS-DSTRKVLRAKMFDLILSTSFTEVFFIFK-DGXXXXXXXXXXXN 471
           ++DD L+++  KK    D  R + RA++ D +L+ +FTE + I+K D             
Sbjct: 413 VMDDLLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSP 472

Query: 472 RNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQV 531
             + ++TEMKI RK++T++SNFE   +DPE L+ +LRK CSGS+T+ E  T +S  EVQV
Sbjct: 473 PRIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKS-AEVQV 531

Query: 532 QGPHGNTAINILNEHGIPSKYIDFDN 557
           QGPHG   I+ LN+ G+P+K+IDF+N
Sbjct: 532 QGPHGQLIIDHLNKSGVPNKWIDFEN 557

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  452 bits (1164), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 241/563 (42%), Positives = 354/563 (62%), Gaps = 21/563 (3%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK+P IK+ SNLKNSERKKLL + + Q    ++ FST+IVKQ  +K   + GT++TD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
           +N PI+FKEKH E L PT+ +CW  P             + +L NGA+LML GT+PPF +
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
            C   K+ G+AS   P V+ AIGV QLNL     V+G+ G+AVKV+H   DGL + FK+ 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240
           +EP   +L S+  E E E   +             P  +T    +    S+ +VA+ L+E
Sbjct: 181 IEP--AVLSSEPVEEEEEEEGKEKLTES-------PKRETFHTEI----SIEDVAQVLDE 227

Query: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300
           LS+E VDHF T+A+YYT   D  L +PI ASNFI+NH++ NLP + ++QV++K++SW + 
Sbjct: 228 LSVEDVDHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKT 287

Query: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKNNDKHDVE 360
           +KFLK+FE  GFL+LKGK ++L +V VNK+K E+K+F PY+T     + S KN++K    
Sbjct: 288 AKFLKHFEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKT--SGQTASKKNSNKDSSP 345

Query: 361 VVVY----YQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILLD 416
            ++Y    Y+P+N  K  +      P  +    ++K  +N+Y+T KKLV++ +++++LLD
Sbjct: 346 GMMYSEKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLD 405

Query: 417 DTLFSLAYKKSASDST-RKVLRAKMFDLILSTSFTEVFFIFKDGXXXXXXXXXXXN-RNV 474
           D LF + Y+K  +  T R V RA++ D  ++ +FTE + +FKD                V
Sbjct: 406 DLLFDMFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRV 465

Query: 475 SVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQGP 534
            ++TEMKI RK+VTR+S+FE + +DPE+L+  LRK CSGS+T+ E  T     EVQVQG 
Sbjct: 466 KIVTEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGA 525

Query: 535 HGNTAINILNEHGIPSKYIDFDN 557
           HG   I+ LN+ GIP+K+IDF++
Sbjct: 526 HGPLIIDYLNKQGIPTKWIDFES 548

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  448 bits (1152), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 239/582 (41%), Positives = 357/582 (61%), Gaps = 33/582 (5%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK P +K++SNLKNSERKKLL + + Q  + ++ F ++I+KQA +K  T+ GT++TDE
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
            N PI+FKEKHS+ L P++ TCW+ P             + K+ NGA+LM+ GT+ PF +
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
               G L G+AS + P VV AIG+ QL+L    KVVGETGVAV VLH + DGL + FKM+
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGI---QEDEDLPTAKTAS----GPLEEPNSLSE 233
           +EPP             E  A+ D+   +   Q+ +D+    T S     P   PN   +
Sbjct: 181 LEPP-------------ETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPN--DD 225

Query: 234 VAEQLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLK 293
           +AE LE L ++ +D F+T+++YY+L  D  L+ PI ASNFI+N++M NLP +    V+LK
Sbjct: 226 LAEVLETLPVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLK 285

Query: 294 RSSWARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKN 353
           +SSW + +KFL++FE +GF+KLKGK ++L +   NK+KTE+KSF PYRT   + + S K+
Sbjct: 286 KSSWKKTAKFLRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKD 345

Query: 354 --NDKHD----VEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNA 407
             ND  D    ++ V YY+P++  K  +        ++  A +++  + +Y+ +K LV++
Sbjct: 346 KTNDTSDNGDMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDS 405

Query: 408 TDERIILLDDTLFSLAYKKSASDSTRKVLRAKMFDLILSTSFTEVFFIFKDGXXXXXXXX 467
            ++++IL+DD ++SL YKK  S   R + RA + + I   +F E F I+K G        
Sbjct: 406 KNKKMILMDDLMYSLVYKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPL 465

Query: 468 XXXN-----RNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPST 522
                      V ++TEMKI RK++TR+SNFE++ +D E L+ +LRK C+G++T+ E  T
Sbjct: 466 FKKPIRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLT 525

Query: 523 LQSTTEVQVQGPHGNTAINILNEHGIPSKYIDFDNKLNKKKK 564
              T EVQVQGPH    I  LN   IP+K+IDF N +  K+K
Sbjct: 526 SPKTAEVQVQGPHSQVIIKHLNSLSIPTKWIDFKNSVKPKRK 567

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  447 bits (1149), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 236/566 (41%), Positives = 363/566 (64%), Gaps = 17/566 (3%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK+P IK+ SNLKNSERKKL    R Q +N+E+ F +  +KQ  FK  T  GTI+TDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
            N PI+FKEKH E L PT+L CW+ P             ++ + NGA+LM+ GTIPPF +
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
             T G + G+A   TP ++ A+G+ Q+NL    +V+GETGVAV+++H + D L++VFK+ 
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240
            EPP++LL +Q       +  + +    I EDE     ++ S   +E ++L ++AE L+E
Sbjct: 181 EEPPAELLQTQS-----SSSEELELEADIHEDET--KVESNSDTEKEKSNLDDMAEVLDE 233

Query: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPR-IHKTQVSLKRSSWAR 299
           L +E +D+F+T+A+YYT++ D  L+ P  ASNF++NH+  NLP+  +  +V++K+SSW +
Sbjct: 234 LRLEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKK 293

Query: 300 ASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTI--QKSVSTSSKNNDKH 357
            +KFLK+FE +GFLKLKG  ++LT+V VNKDK EIK F PY  I  Q S + S   N K 
Sbjct: 294 TAKFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKT 353

Query: 358 DVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILLDD 417
            +++V  Y+P+N AK  + +       +    +IK ++NKY+T K LV+  D++ +L+DD
Sbjct: 354 TIKIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDD 413

Query: 418 TLFSLAYKKSASDST--RKVLRAKMFDLILSTSFTEVFFIFK----DGXXXXXXXXXXXN 471
            L ++ YKK    +T  R + RA +   +L  +F + + +F+    +             
Sbjct: 414 MLMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEP 473

Query: 472 RNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLE-PSTLQSTTEVQ 530
             ++++TEMKI RK++T++SNFE++ +DPEE + ++RK+CSGS+T+ E  S+ + T EVQ
Sbjct: 474 PKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQ 533

Query: 531 VQGPHGNTAINILNEHGIPSKYIDFD 556
           VQGPHG   ++ LN+ GIP+K+IDF+
Sbjct: 534 VQGPHGQLIMSYLNDLGIPNKWIDFE 559

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  441 bits (1133), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 236/573 (41%), Positives = 356/573 (62%), Gaps = 21/573 (3%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK+P IK+ SNLKNSERKKLL   + Q  N E+ F T+ +KQ  F +  + G ++TDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
           +N PI FKEKH+E L PT+ +CW+ P             +  L NGA+LM+ G+IPPF  
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
               G L GVAS E P VV AIG+ +++L    +V+GETGVAVKV+H  NDGL +  K+ 
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQE-DEDLPTAKTASGPLEEPNSLSEVAEQLE 239
           ++PP  +  S   ++  + +   ++A  ++   E++  A+           + E+AE L+
Sbjct: 181 LDPP--IAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQV---------HVEELAEVLD 229

Query: 240 ELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWAR 299
             S+  VD+F+T+A+YYTL  D +L LPI  SNFI+NH+M+NLP I   +V++K++SW +
Sbjct: 230 HFSVSDVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRK 289

Query: 300 ASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKN--NDKH 357
           ++KFLK+FE +GFLKLKGK ++LT+V    DK E+K+F PY+    + +  S    N K 
Sbjct: 290 SAKFLKHFEKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKE 349

Query: 358 DVEVVVY----YQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERII 413
               ++Y    Y+P + AK  L            ++DI++ L++Y++   L +  D+  +
Sbjct: 350 KTPGMMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKV 409

Query: 414 LLDDTLFSLAYKKSAS-DSTRKVLRAKMFDLILSTSFTEVFFIFK-DGXXXXXXXXXXXN 471
           ++DD LF++  KK  + ++ R + RA++ D +L+ +FTE + IFK D             
Sbjct: 410 VMDDLLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSP 469

Query: 472 RNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQV 531
             + + TEMKI RK++TR+SNFE++ +DPE L+ +LRK CSGS+T+ E  T +S  EVQV
Sbjct: 470 PRIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKS-AEVQV 528

Query: 532 QGPHGNTAINILNEHGIPSKYIDFDNKLNKKKK 564
           QGPHG   I+ LN  G+P+K+IDF+NKL KKK+
Sbjct: 529 QGPHGQLIIDHLNNLGVPNKWIDFENKLKKKKR 561

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  436 bits (1122), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 245/569 (43%), Positives = 353/569 (62%), Gaps = 24/569 (4%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK+P IK+ SNLKNSERKKLL     Q  N+E+ F T+I+KQ  F    + GT++TDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
           +N PI FKEKH E L PT+ +CW+ P             +  L NGA+LM+ G+IPPF  
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
            C  G L GVA  ++P VV AIGV +L+L    +V+GETGVAVKV+H  NDGL++ FK+ 
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 VEPPSQLLVSQKHE----VELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAE 236
           +EPP  L    + E     + E   Q   A   QE       KTA         L EVAE
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQES----IKKTAP-------DLEEVAE 229

Query: 237 QLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSS 296
            L+ L++  VD+F+T+A+YY+L  D  L LPI AS FI+NH+M+NLP I   +V++K+SS
Sbjct: 230 VLDHLTVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSS 289

Query: 297 WARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVS------TS 350
           W +++KFLK+FE +G LKLKGK ++LT+V  N DK E+K+F PY+    S S       +
Sbjct: 290 WKKSAKFLKHFEKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENAT 349

Query: 351 SKNNDKHDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDE 410
           SK+     +  +  Y+P + AK  L       +    ++D++  +++Y++ K L +  D+
Sbjct: 350 SKDRTSGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDK 409

Query: 411 RIILLDDTLFSLAYKKSAS-DSTRKVLRAKMFDLILSTSFTEVFFIFK-DGXXXXXXXXX 468
           R +++DD LF++  KK  + D+TR + R+++   +LS +FTE + IF+ D          
Sbjct: 410 RKVVMDDLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMK 469

Query: 469 XXNRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTE 528
                + ++TEMKI RK++T++SNFE++ +DPE L+ +LRK CSGS+T+ E  T +S  E
Sbjct: 470 GCPPRIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKS-AE 528

Query: 529 VQVQGPHGNTAINILNEHGIPSKYIDFDN 557
           VQVQGPHG   I+ LN+ GIPSK+IDF+N
Sbjct: 529 VQVQGPHGQFIIDYLNKSGIPSKWIDFEN 557

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  434 bits (1117), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 234/565 (41%), Positives = 344/565 (60%), Gaps = 17/565 (3%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK P +K+ SNLKNSE KKLL   RAQ  NQE+ F T ++KQ  F+  +  GT++TD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
           DNKPI+FKEKH   L PT+  CW +PG            + +L NGA+LML GT+ PF  
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
               G + G+AS   P VV A+GV QL+L     V+G+TGVAV+++H + DGL +VFK++
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240
            EPP  + +    E E E     +++      +++P+ + A         + ++AE L+E
Sbjct: 181 AEPP--VSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAV-------DIDDIAEVLDE 231

Query: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300
             +E VD FLT+A+YYTL  D  L+LPI ASNFI+NH+  NLP +   +V++K+SSW + 
Sbjct: 232 FRLEDVDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKT 291

Query: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR------TIQKSVSTSSKNN 354
           +KFLK FE +GFLKLKGK ++LT++ +NK K E+++FQPY+          S S ++K +
Sbjct: 292 AKFLKNFEKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKD 351

Query: 355 DKHDVEVVVYYQPLNTAKATLHALGNNPNAML-KAKDIKAILNKYVTEKKLVNATDERII 413
               +     Y+P+N AK  +     NP  +L  A+++K  LN Y+    L ++ +++++
Sbjct: 352 GSPQLRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMV 411

Query: 414 LLDDTLFSLAYKKSA-SDSTRKVLRAKMFDLILSTSFTEVFFIFKDGXXXXXXXXXXXNR 472
           +LDD L+ L  KK   + + R V RA + + +L+ SFT  F I+K               
Sbjct: 412 ILDDLLYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKGDIPLFKNPSRGNLP 471

Query: 473 NVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQ 532
           N+ ++TEMKI RK++TR+S FEI+ +D +EL+  LR+ CSGS+T+ E  T     EV VQ
Sbjct: 472 NIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQ 531

Query: 533 GPHGNTAINILNEHGIPSKYIDFDN 557
           GPHG   I+ LN  GIP+K+I FDN
Sbjct: 532 GPHGPLIIDHLNSLGIPTKWIKFDN 556

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  418 bits (1075), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 232/564 (41%), Positives = 346/564 (61%), Gaps = 15/564 (2%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MF+K+P IK+ SNLKNS+RKKL   + AQ  N ++    +IVKQ  F+TPT  GTI+TDE
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYT-CPSIVKQTNFQTPTTIGTIYTDE 59

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
            N PI+FKEKH   L  T+ TCW                  KL NGA+LM+ GTIPPF +
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 NCTRGKLVGVASSETP-FVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKM 179
               G L GVAS + P  VV AIG+  ++L    KVVGE+GVAV+++H   D L++ FK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 SVEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLE 239
            ++PP  ++  QK  V  E   + +       +ED  T + ++       ++ ++AE L+
Sbjct: 180 DLKPP--VVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTA-----TNVEDLAEVLD 232

Query: 240 ELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWAR 299
            LS++ VD+F+T+A+YYT+  D  L LPI ASNFI+ H+ KNLP +   +V++K+SSW +
Sbjct: 233 HLSVQDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKK 292

Query: 300 ASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR--TIQKSVSTSSKNNDKH 357
            +KFLK+FE +GFLKLKGK ++LTVV +NK K E+K+F PY+  +       + K  D  
Sbjct: 293 TAKFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQ 352

Query: 358 D--VEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILL 415
              +  + +Y+P+N AK  +   G     +    +I+  +N Y+T K LV+  +++++LL
Sbjct: 353 SGMMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLL 412

Query: 416 DDTLFSLAYKKSASDS-TRKVLRAKMFDLILSTSFTEVFFIF-KDGXXXXXXXXXXXNRN 473
           DD LF +  KK    + +R + RA++ +  L  +FTE F I+   G              
Sbjct: 413 DDLLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPR 472

Query: 474 VSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQG 533
           + ++TEMKI RK++T++SNFE +G++PE L+ +LRK CSGS+T+ E  T   T EVQVQG
Sbjct: 473 IKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQG 532

Query: 534 PHGNTAINILNEHGIPSKYIDFDN 557
           PHG   I+ LN+ G+P+K+ID++N
Sbjct: 533 PHGQIIIDHLNKLGVPTKWIDYEN 556

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  410 bits (1055), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 223/568 (39%), Positives = 349/568 (61%), Gaps = 26/568 (4%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQC-ANQEFQFSTTIVKQATFKTPTATGTIFTD 59
           MFKK+P IK+ S LKNS+RKKL+ +++AQ  ++++   +   + Q  F + TA GTI+TD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  EDNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFS 119
            ++ PI FK KHS+ L PT    W   G            +N + NGADLM+ GT+PPF 
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 DNCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKM 179
              T G +  VA+ E P V  A+G+ +LNL    +V+G+TGVAV++LH   D L+  FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 SVEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSE----VA 235
            +E P+ +          +++ Q +    + ++ D   A+  S  + EP S SE    +A
Sbjct: 181 KLEIPASV----------KSILQEETTADVAKESD---AEQESQSVTEPPSGSEGPDDIA 227

Query: 236 EQLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRS 295
           E L+EL++E VD+F+ +A+Y+T+  DNTL LP+ AS F++NH+M+NLP +   +V++KR+
Sbjct: 228 EVLDELTVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRT 287

Query: 296 SWARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR---TIQKSVSTS-S 351
           SW + +KFLKYFE +GFLKLKGK ++L +V +NKDK E+K+F PY+   T +K+ S S S
Sbjct: 288 SWKKTAKFLKYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDS 347

Query: 352 KNNDKHDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDER 411
                  V  V  Y+P+N  +  +     +   M  + +I+  +N Y+ +K LV+  D++
Sbjct: 348 TQTQGVSVSSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKK 407

Query: 412 IILLDDTLFSLAYKKSASDSTRKVL-RAKMFDLILSTSFTEVFFIFK-DGXXXXXXXXXX 469
           +++LDD LF++  +K  +    +++ RA + + +++ +F E F ++K D           
Sbjct: 408 MVMLDDLLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKG 467

Query: 470 XNRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEV 529
               + ++TEMKI RK+VTR+SNFE + + PEEL+ +LRK CSGS+T+ E  T +  +EV
Sbjct: 468 QTPKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISE--TPKKVSEV 525

Query: 530 QVQGPHGNTAINILNEHGIPSKYIDFDN 557
           QVQGPHG   I+  N+ GIPSK+I F+N
Sbjct: 526 QVQGPHGQLIIDHFNKSGIPSKFIQFEN 553

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  407 bits (1047), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 219/571 (38%), Positives = 348/571 (60%), Gaps = 25/571 (4%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MF K+P IK  SNLKNS+RKKL   ++ Q  N+E+   T ++KQ +F+     G+I+TDE
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXX-XXDNKLKNGADLMLPGTIPPFS 119
            NKPI+FK K  + L PTI + W                 +  +  GA LMLPGT+PPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 DNCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKM 179
            N  RG +VG+AS++ P +V+AIG+ +++L GI  V+G  G+AV+V+H ++DGL++ FK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 SVEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLS---EVAE 236
            +EPP+  +V     +E  A+       G Q DE+       S  LE  +S S   E+A+
Sbjct: 180 ELEPPA--VVYNSEPIETTAIETQTSKYGEQLDEE-------SNHLERSSSQSPVNEIAD 230

Query: 237 QLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSS 296
           +LEE+SIE VDH L +AV Y++  D+ + LPI AS FI+NHVMKNLP +    V++K+SS
Sbjct: 231 ELEEMSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSS 290

Query: 297 WARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKN--N 354
           W +A+K LKY E++GFLKLKGK ++ TV+S+NK+  ++ + + Y+T+      SS +  N
Sbjct: 291 WKKATKLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTN 350

Query: 355 DKHDVEVVVY-----YQPLNTAKATLHAL-GNNPNAMLKAKDIKAILNKYVTEKKLVNAT 408
             +  ++  Y     Y+P++  +  +  +  + P +    +++K +L+ YV    L++  
Sbjct: 351 QSNKNKITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPE 410

Query: 409 DERIILLDDTLFSLAYKKSASDSTRKVLRAKMFD-LILSTSFTEVFFIFK-DGXXXXXXX 466
           ++ ++  DDTL+ ++ +   +   +K+ R  +     LS +F     I+K +G       
Sbjct: 411 NKSLVKYDDTLYQMSNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVP 470

Query: 467 XXXXNRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQST 526
                  + ++TE KI RK++TR++NFE + +D EEL+  LRK+CSGS+T+ E  + + T
Sbjct: 471 EKGPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTK-T 529

Query: 527 TEVQVQGPHGNTAINILNEHGIPSKYIDFDN 557
            EVQVQGPHG+  I+ILN++GIP+K+I F+N
Sbjct: 530 AEVQVQGPHGSIVISILNDYGIPTKWISFEN 560

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  408 bits (1048), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/581 (40%), Positives = 353/581 (60%), Gaps = 39/581 (6%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTT-IVKQATFKT--PTATGTIF 57
           MFKK+P IK+ SNLKNS+RKKLL  ++ Q   + + F+ + I+KQ  F+T  P + GTIF
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDEDNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPP 117
           T++ N PI+FK KH++ L PT+ TCW                  KL NGA+LM+ GTIPP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FSDNCTRGKLVGVASSETP-FVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEV 176
           F      G L G+AS + P  +V AIGV ++N+    KVVGETGVAV+V+H   D L+++
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKMSVEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAE 236
           FK +   P + +   K ++  E     D A     DED    K  +    EP+      E
Sbjct: 181 FKCNDLKPDEFV---KEQLNTEHPQDNDVA-----DEDTTRKKEENRESNEPD-----FE 227

Query: 237 QLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSS 296
            L+    E VD+F+T+++YYT+  D  ++LPI ASNFI+ H+ KNLP I   +V++K++S
Sbjct: 228 VLDHFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTS 287

Query: 297 WARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPY---RTIQKSVSTSSKN 353
           W + +KFLK+FE +GFLKLKGK ++LTVV +NK K E+K+F PY   ++   S S SS N
Sbjct: 288 WKKTAKFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPN 347

Query: 354 -NDKHDVEVVVY----YQPLNTAKATLHALGNNPN-AMLKAKDIKAILNKYVTEKKLVNA 407
            NDK D + ++Y    Y+P+N AK  L A+   P   +   ++I+ I+  Y+  K L++ 
Sbjct: 348 TNDKSDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDM 407

Query: 408 TDERIILLDDTLFSLAYKKS--ASDSTRKVLRAKMFDLILSTSFTEVFFIFK-------- 457
            ++++ILLDD LF++ +K+   A+ + R ++R  + + IL+ +FTE + I++        
Sbjct: 408 KNKKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGEL 467

Query: 458 --DGXXXXXXXXXXXNRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSS 515
             D               + ++TEMKI RK++T++SNFEI+G+  + L+ +LRK CSGS+
Sbjct: 468 MEDVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGST 527

Query: 516 TVLEPSTLQSTTEVQVQGPHGNTAINILN-EHGIPSKYIDF 555
           T+ E  T   T EVQVQGPHG   I+ LN + G+P+K+I++
Sbjct: 528 TIGETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  399 bits (1024), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/569 (40%), Positives = 349/569 (61%), Gaps = 12/569 (2%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK P IKS SNLKNSERKKLL + +AQ  + ++ F T+++KQ  F   T+ G I+TDE
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
           +  P++FKEKHSE L PT+ TCW+ P             +  + NGA+LM+ GT+PPF  
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
                 + G+A+   P  + A+GV QL++     V+G+TGVAV VLH   DG+   FKM 
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240
            + P+  +V  K +  ++A         I E+E     +  S P    N +SE+A++   
Sbjct: 181 RDIPT--IVGGKDK-SVDATENDQSPVIITEEEK---TEDDSIPEISSNDVSELAQEESA 234

Query: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300
           L++E +DHF+T+++YYTL  D  L  PI +S+FI+NH+M+NLP +    V++K++SW ++
Sbjct: 235 LTVEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKS 294

Query: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSK-NNDKHDV 359
           SKFLK+FE +GF+KLKGK E+LT+V  NK+K E+K F+PYR    S ++  K N+++ + 
Sbjct: 295 SKFLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQES 354

Query: 360 E----VVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILL 415
           E     +V+Y P  +AK  +            A ++K  + +Y+ +K+LV+  + ++  L
Sbjct: 355 ENMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANL 414

Query: 416 DDTLFSLAYKKSASDSTRKVLRAKMFDLILSTSFTEVFFIFK-DGXXXXXXXXXXXNRNV 474
           DD L+ + Y K +++  R + RA + +   + +FTE++ +FK D               +
Sbjct: 415 DDRLYDMCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRI 474

Query: 475 SVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQGP 534
            ++TEMKI RKIVTR+SNFE +G+D + L+ +LR+ CSGS+T+ E +T   TTEVQVQGP
Sbjct: 475 KIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGP 534

Query: 535 HGNTAINILNEHGIPSKYIDFDNKLNKKK 563
           H    I+ LN   IP+K+IDF+NKL  KK
Sbjct: 535 HSKIIIDHLNSLSIPTKWIDFENKLKPKK 563

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  392 bits (1006), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 206/572 (36%), Positives = 345/572 (60%), Gaps = 19/572 (3%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK  TI + SNLKNSE + +    R   +N E++F  + VKQ TF++  A G I+TD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPPFSD 120
           +N PI+FK+K+S  ++PT+ T W+YP             + K+ NGA+LM+PGT+ P  +
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180
               GK+ G+AS++ P  + AIG+C  +++ +   +G+TGVAV+VLH  +D L  +FK+ 
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDE-----DLPTAKTASGPLEEPNSLSEVA 235
           + PP+  +++  +   LE++ Q      I E E     D P   T +      ++  ++A
Sbjct: 181 LNPPT--IMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFT------SNADDLA 232

Query: 236 EQLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRS 295
           E LE+L +E +D+FLTQ++YYT+  + +L+LPI +S F++ ++MKNLP +   QV++K+S
Sbjct: 233 ETLEQLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKS 292

Query: 296 SWARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKN-- 353
           SW + +KFLK+FE +GFLKLKGK ++LT+   NK+K ++K+F PYR  + + +  SK+  
Sbjct: 293 SWKKTAKFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQ 352

Query: 354 NDKHDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERII 413
           ++K+ ++VV  Y P     +   ALG    +   + +I + +  Y+ +K L N  D+  I
Sbjct: 353 DNKNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKI 412

Query: 414 LLDDTLFSLAYKKSASDSTRKVLRAKMFDLILSTSFTEVFFIF-KDGXXXXXXXXXXXNR 472
            +DD LF L    + +++ R ++R+++ + +L  +F     +F  D              
Sbjct: 413 SMDDVLFDLVITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPP 472

Query: 473 NVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQ 532
            V ++TE     K++TR+SNFE++ +D +++S EL+  CSGS+++ E   L + +EVQVQ
Sbjct: 473 TVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEE---LPNGSEVQVQ 529

Query: 533 GPHGNTAINILNEHGIPSKYIDFDNKLNKKKK 564
           GPHG+  +    +HGIP K+ D+ NK+  KK+
Sbjct: 530 GPHGDIVMEYFEKHGIPRKWFDYTNKVKPKKR 561

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  332 bits (851), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 207/572 (36%), Positives = 324/572 (56%), Gaps = 35/572 (6%)

Query: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60
           MFKK P IK  SNLKNSE++KL   V+ Q    EF FS   VKQ  F++ T+ GTI+ ++
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  DNKPI--FFKEKH-SEFLIPTILTCWQYPGXXXXXXXXXXXXDNKLKNGADLMLPGTIPP 117
           +  P+  FFKEKH S  L P++  CW +PG            ++ L NGA+LM+ GT+PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FS-DNCTRGKLVGVASSETPFVVEAIGVCQLNLA--GIVKVVGETGVAVKVLHTINDGLW 174
           F   +  +G+  G+A+ ++P V+ A+G  +++L       VVG +GV V+V H   DGL 
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 EVFKMSVEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEV 234
           + F++ ++ P +L  +   EV                 E+ P     + P+  P ++ ++
Sbjct: 181 DAFRLKLDIPDKLESATTQEVA----------------EEPPVEAKPTSPVTNPVAVDDL 224

Query: 235 AEQLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPR-IHKTQVSLK 293
           AE LE LS+E VD+F+T+A+YYTL  +  L LPI ASNF++ H+MK LP+ I  T+V++K
Sbjct: 225 AEVLETLSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVK 284

Query: 294 RSSWARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTE--IKSFQPYRTIQKSVSTSS 351
           +SSW + +K+LK+FE +G LKLKGK ++L VV     KT   +K F PY  +  S++ S 
Sbjct: 285 KSSWKKTAKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPY-LVGNSIAESG 343

Query: 352 KNNDKHDVEV---VVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNAT 408
             +   +  V   V  +QP +TA+  L   G          +I+ +LN+Y+T  KL    
Sbjct: 344 PKSQTTNGPVMFAVTSFQPDSTAQTALPLGGQR---YFSGPEIREVLNEYITANKLAQPN 400

Query: 409 DERIILLDDTLFSLAYKKSASDST--RKVLRAKMFDLILSTSFTEVFFIFKDGXXXXXXX 466
           + +++LL+DTLF +  K +    T  R + R ++ + ++   F  ++ +FKD        
Sbjct: 401 NPKMVLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKH 460

Query: 467 XXXXNR-NVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQS 525
                   V ++TEMKI RK+VTR+ NF+   +   E + +LRK CS S+T+ +  +   
Sbjct: 461 PQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPV 520

Query: 526 TTEVQVQGPHGNTAINILNEHGIPSKYIDFDN 557
            +E+QVQG HG   I+ L E G+PS ++ F+N
Sbjct: 521 VSEIQVQGAHGPLIIDHLRELGVPSSWVVFEN 552

>Kwal_55.19918 s55 complement(176744..177454) [711 bp, 236 aa] {ON}
           YJR099W (YUH1) - ubiquitin hydrolase [contig 159] FULL
          Length = 236

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 373 ATLHALGNNPNAMLKAKDIKAIL--NKYVTEKKLVNATDERIILLDDTLFSLAYKKSASD 430
           A LH+L NNP+ + K   +K  L  N+    K   + TD+ I+ + D      Y KS+SD
Sbjct: 99  AVLHSLSNNPDVLDKESILKQFLLKNQRAANKYADDQTDDFIVSISDL-----YNKSSSD 153

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 9/74 (12%)

Query: 178 KMSVEPPSQLL-VSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLS---E 233
           K SVEPP++ L +S+K++ E +   + +D     E +D P  K+   P EEPN  S   E
Sbjct: 21  KPSVEPPAKKLKISRKNKSEDKIEDKTED-----EVQDKPADKSEDEPTEEPNPASSELE 75

Query: 234 VAEQLEELSIETVD 247
           V + + +L ++  D
Sbjct: 76  VGDDIPDLILKNQD 89

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,887,658
Number of extensions: 2342637
Number of successful extensions: 6527
Number of sequences better than 10.0: 44
Number of HSP's gapped: 6719
Number of HSP's successfully gapped: 44
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)