Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_43008.270ON71571535840.0
AGR078C8.270ON71571625520.0
SAKL0H16852g8.270ON6445505292e-57
Kwal_56.237668.270ON7405084254e-43
KLTH0G13508g8.270ON6455223933e-39
KLLA0F19316g8.270ON6713513562e-34
TBLA0C045708.270ON6083291913e-14
Smik_4.3628.270ON6484271851e-13
KNAG0H031908.270ON6224431709e-12
Suva_2.2778.270ON6494031637e-11
KAFR0B054608.270ON6103481629e-11
TDEL0F039708.270ON6193691583e-10
CAGL0B01859g8.270ON6223831573e-10
Skud_4.3788.270ON6523621361e-07
YDR118W (APC4)8.270ON6524071361e-07
ZYRO0C01474g8.270ON5993431323e-07
TPHA0J007908.270ON6852701154e-05
NDAI0J012708.270ON7351871083e-04
Kpol_392.18.270ON424119980.003
NCAS0B037908.270ON612275890.052
KLLA0D02596g4.306ON34281820.25
Ecym_20263.25ON45171790.64
KLTH0G16346g3.201ON43589771.1
NCAS0A035904.177ON53378742.5
KLLA0E07085g3.25ON45253733.2
Suva_13.4428.810ON55363733.9
ADL184W3.25ON44953715.5
NDAI0D02340na 1ON480134716.7
TBLA0B057202.358ON26971698.9
NDAI0D03540na 2ON110787709.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4300
         (715 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...  1385   0.0  
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...   987   0.0  
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   208   2e-57
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   168   4e-43
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   155   3e-39
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...   141   2e-34
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...    78   3e-14
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...    76   1e-13
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...    70   9e-12
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...    67   7e-11
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...    67   9e-11
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...    65   3e-10
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...    65   3e-10
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...    57   1e-07
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...    57   1e-07
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...    55   3e-07
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....    49   4e-05
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....    46   3e-04
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...    42   0.003
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...    39   0.052
KLLA0D02596g Chr4 complement(218659..219586,219682..219782) [102...    36   0.25 
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    35   0.64 
KLTH0G16346g Chr7 (1424922..1426229) [1308 bp, 435 aa] {ON} simi...    34   1.1  
NCAS0A03590 Chr1 complement(715709..717310) [1602 bp, 533 aa] {O...    33   2.5  
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    33   3.2  
Suva_13.442 Chr13 complement(761934..763595) [1662 bp, 553 aa] {...    33   3.9  
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    32   5.5  
NDAI0D02340 Chr4 (541550..542992) [1443 bp, 480 aa] {ON}               32   6.7  
TBLA0B05720 Chr2 complement(1353757..1354566) [810 bp, 269 aa] {...    31   8.9  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    32   9.5  

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 1385 bits (3584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/715 (94%), Positives = 674/715 (94%)

Query: 1   MTQWKVKLTKQWDGLVDPFWNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEIL 60
           MTQWKVKLTKQWDGLVDPFWNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEIL
Sbjct: 1   MTQWKVKLTKQWDGLVDPFWNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEIL 60

Query: 61  TCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVW 120
           TCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVW
Sbjct: 61  TCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVW 120

Query: 121 NRIKWKSRGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENESNM 180
           NRIKWKSRGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENESNM
Sbjct: 121 NRIKWKSRGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENESNM 180

Query: 181 FLTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLE 240
           FLTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLE
Sbjct: 181 FLTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLE 240

Query: 241 FTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLK 300
           FTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLK
Sbjct: 241 FTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLK 300

Query: 301 DVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVK 360
           DVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVK
Sbjct: 301 DVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVK 360

Query: 361 RLQGLIKSLKLNIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDGLT 420
           RLQGLIKSLKLNIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDGLT
Sbjct: 361 RLQGLIKSLKLNIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDGLT 420

Query: 421 WIEYMIDSLLRGEEDDGNNSNGQDCALSNDVDALDTYPKEHYSTQLFLNNFVLPTQTYKW 480
           WIEYMIDSLLRGEEDDGNNSNGQDCALSNDVDALDTYPKEHYSTQLFLNNFVLPTQTYKW
Sbjct: 421 WIEYMIDSLLRGEEDDGNNSNGQDCALSNDVDALDTYPKEHYSTQLFLNNFVLPTQTYKW 480

Query: 481 IKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIKVSGPIRKLRSITGQRLKDAIMDGDVIY 540
           IKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIKVSGPIRKLRSITGQRLKDAIMDGDVIY
Sbjct: 481 IKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIKVSGPIRKLRSITGQRLKDAIMDGDVIY 540

Query: 541 MICXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXXXXXFTIIQYDSTSKELTK 600
           MIC                R                         FTIIQYDSTSKELTK
Sbjct: 541 MICSKSSSTTSQGTDQDQSREQIQEQDDHQEVDQEQDQLQDQDEEFTIIQYDSTSKELTK 600

Query: 601 QLIPLPETLSSIVSIKFVPGEPGRFLMLTEDGYLRRYLVNYSSSLGIKDPSRITIYNDLK 660
           QLIPLPETLSSIVSIKFVPGEPGRFLMLTEDGYLRRYLVNYSSSLGIKDPSRITIYNDLK
Sbjct: 601 QLIPLPETLSSIVSIKFVPGEPGRFLMLTEDGYLRRYLVNYSSSLGIKDPSRITIYNDLK 660

Query: 661 ILMEPSTLELLNKNAAENRMIVHSDMAVTILSSFTNEQGVLEPHTSYCQLAVHLM 715
           ILMEPSTLELLNKNAAENRMIVHSDMAVTILSSFTNEQGVLEPHTSYCQLAVHLM
Sbjct: 661 ILMEPSTLELLNKNAAENRMIVHSDMAVTILSSFTNEQGVLEPHTSYCQLAVHLM 715

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/716 (64%), Positives = 568/716 (79%), Gaps = 2/716 (0%)

Query: 1   MTQWKVKLTKQWDGLVDPFWNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEIL 60
           MTQWKVKLTKQWDG ++PFWNDRLSLWG+ EK  ++IFRYIDGR++G+IPLRL+ NEE+L
Sbjct: 1   MTQWKVKLTKQWDGKLEPFWNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL 60

Query: 61  TCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVW 120
            CQ EP+DG+LFAV LRSGSVK+Y+GR D + ++ ++GA++VGT+VLGRG+ F MEQFVW
Sbjct: 61  RCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVW 120

Query: 121 NRIKWKSRGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENESNM 180
           NRIKW+ R  F G+FD+ L QWLP+LTEM++S QGKL CTPL +EGPEWNA L+ +ESNM
Sbjct: 121 NRIKWRVREPFCGEFDSPLVQWLPRLTEMSISAQGKLLCTPLGYEGPEWNAGLAADESNM 180

Query: 181 FLTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLE 240
           FLT+DN TRKV++SIDGTFNFRYGEK+KFPTKVT+IL GN N+YVF+NDEDWQLQ+I+LE
Sbjct: 181 FLTFDNNTRKVVLSIDGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLE 240

Query: 241 FTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLK 300
           FTE HQ+HELMKCCS IQFL+KY+RDNH++IG KLMEPHATF  SLFP+EQ ++ +KGLK
Sbjct: 241 FTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKGLK 300

Query: 301 DVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVK 360
           DVFYLGYS +K +ENWFTLKLGRHG +IWKQRNHLFWSSSQG+LVTCMIPACERLIV+ K
Sbjct: 301 DVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAK 360

Query: 361 RLQGLIKSLKLNIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDGLT 420
           RL GL+KSLKLN+FGLDDD EL A EV +LLQM L  L  +V+QVE+FH+GEN+S DGL 
Sbjct: 361 RLLGLVKSLKLNVFGLDDDNELTAVEVQDLLQMSLGLLKGLVEQVEQFHVGENVSKDGLA 420

Query: 421 WIEYMIDSLLRGEEDDGNNSNGQDCALSNDVDALDTYPKEHYSTQLFLNNFVLPTQTYKW 480
           WIEYM+DSLL  E++D +N NGQD   S+D+D  + YPKEHYS QLFLN +++P + Y W
Sbjct: 421 WIEYMMDSLLHNEDEDAHNLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYIIPKKPYSW 480

Query: 481 IKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIKVSGPIRKLRSITGQRLKDAIMDGDVIY 540
           IK+DFP++LE L+RQFDLVQKNYTAKWIKK+IKV GP+RKL+S+ G RL+DA++DG+ IY
Sbjct: 481 IKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIKVPGPVRKLKSLVGHRLEDALVDGETIY 540

Query: 541 MICXXXXXXXXXXXXXXXXRXXXXXXXXXXX-XXXXXXXXXXXXXXFTIIQYDSTSKELT 599
           MIC                                           FT++QYD +SKELT
Sbjct: 541 MICSKRSPKRPDLDEEVECSPSRESELQQSMGKLSEETPVDGYSRIFTLVQYDVSSKELT 600

Query: 600 KQLIPLPETLSSIVSIKFVPGEPGRFLMLTEDGYLRRYLVNYSSSLGIKDPSRITIYNDL 659
           +Q IP P   + I SIKFVPGE  RFLMLTEDG +RRYLV YS +  +K+ +RITIYND 
Sbjct: 601 RQSIPPPTNRAIIASIKFVPGESSRFLMLTEDGQVRRYLVGYSGATDVKNSARITIYNDF 660

Query: 660 KILMEPSTLELLNKNAAENRMIVHSDMAVTILSSFTNEQGVLEPHTSYCQLAVHLM 715
           K++MEP+ L++ NK   +N+MIVHSDMAVTILS    E    + ++ +CQL V +M
Sbjct: 661 KVIMEPTALDITNKKYCKNQMIVHSDMAVTILSPIPVEAPA-DANSGHCQLVVQIM 715

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  208 bits (529), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 142/550 (25%), Positives = 270/550 (49%), Gaps = 51/550 (9%)

Query: 1   MTQWKVKLTKQWDGLVDPFWNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEIL 60
           M +W+V   K + G     WN  LSL+ +     + + R +DG+++ ++ +  K +  I+
Sbjct: 1   MVKWEVHSVKTFPGEQRIVWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSV--KDHGTIV 58

Query: 61  TCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVW 120
             Q E ++G +FAV   +G +++Y         D +     VG+++LG  +  ++ +F W
Sbjct: 59  DYQWEQSEGRIFAVCHSNGIIRLY---------DSSLAGKSVGSVILGDSDC-DVLKFCW 108

Query: 121 NRIKWKSRGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEF-EG-PEWNASLSENES 178
           ++  W     F   FD  +T  +P+L +  V    +LT  P +  +G P W + L  N+S
Sbjct: 109 SQDSWTFGSKFSNVFDHEITSLMPRLVKF-VKDSRQLTMLPTDVGDGVPRW-SKLDGNKS 166

Query: 179 NMFLTYDNATRKVMVSIDGTFNF------------RYGEKNKFPTKVTNILSGNANNYVF 226
            +FL YD+  +K++++IDG F              R  E +  P  V +IL  +   Y+ 
Sbjct: 167 FIFLGYDSKRQKILMAIDGAFKLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLV 226

Query: 227 LNDEDWQLQIIKLEFTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSL 286
           + D DW +Q IK +F   +   E++ CC++I+ L K L ++  ++  +L+EP+  FI  +
Sbjct: 227 ITD-DWYIQKIKFDFLNCNLTREMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERV 285

Query: 287 FPDEQASRLLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVT 346
               +   L+  L ++ + G S    +E+W +  +G   +  WK+ + + + ++  I+V 
Sbjct: 286 LGAYEGD-LIGDLTELLFTG-SVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVL 343

Query: 347 CMIPACERLIVAVKRLQGLIKSLKL-NIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQV 405
            M+P CERLI+  +RL G+IK LKL  +  L+D+ E++  E  +L+ +  + L  I+  +
Sbjct: 344 TMVPVCERLILCGERLHGIIKGLKLIGLKELEDNLEVL--EAQKLVCLSQEALENIIVSI 401

Query: 406 EKFHIGENMSIDGLTWIEYMIDSLLRGEEDDGNNSNGQDCALSNDVDALDTYPKEHYSTQ 465
           ++ ++  N+    + W   M+                   A+  D     +Y  +    Q
Sbjct: 402 KQINVDSNLHEAFIDWFHDMVME-----------------AVDEDYKRKTSYNCDPLKIQ 444

Query: 466 LFLNNFVLPTQTYKWIKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIKVSGPIRKLRSIT 525
            F++  +    TY+W +  FP     L +QF+ V++ Y A W+ + +K   PI   + + 
Sbjct: 445 QFMSGSLTGVHTYEWCQYSFPAVTNRLGKQFETVEQLYVANWVVQRVKFGEPICIKKGLE 504

Query: 526 GQRLKDAIMD 535
             R+KD  +D
Sbjct: 505 KTRVKDVGVD 514

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  168 bits (425), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 135/508 (26%), Positives = 232/508 (45%), Gaps = 53/508 (10%)

Query: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79
           WN RLSL+ +     + + R IDG+++ ++ LR     EI+  Q E N+  LFAV   +G
Sbjct: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLR--DEHEIVGIQWEKNESKLFAVFQSNG 78

Query: 80  SVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKW-KSRGAFKG-DFDT 137
            V++Y      D S      +MV  +  G+     ++  VW  ++W K   +++G DFD 
Sbjct: 79  VVRIY------DCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFD- 131

Query: 138 VLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENESNMFLTYDNATRKVMVSIDG 197
            +T  +P +  + V    +L+  PL+     W       ++ +FL +D  + + MV+IDG
Sbjct: 132 -ITTLMPGMVRL-VRDSKQLSLAPLDLGKLSWLDG-KYGDAAIFLAHDCESTEYMVAIDG 188

Query: 198 TFNFRYGEKNKFPTKVTN---ILSGNANNYVFLNDEDWQLQIIKLEFTESHQMHELMKCC 254
             + R      FP+ + N   IL    +       +D  LQ + L+F E   M EL+K  
Sbjct: 189 QLSLR------FPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLKFLECALMRELVKSS 242

Query: 255 SQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLKDVFYLGYSAEKNIE 314
            QI+FL +YL +N  +   +L+EP+  F+  L    +   L   L+D+   GY  + ++E
Sbjct: 243 GQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPD-DLE 301

Query: 315 NWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLIKSLKLNIF 374
            W    +G      WKQ +   +     +L   ++PACERLI+A +R+QG+ KSLKL  F
Sbjct: 302 EWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRF 361

Query: 375 GLDDDEEL-------IAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDGLTWIEYMID 427
             D   EL       +  E   LL+  L+ +TE+ +      +          + E+  D
Sbjct: 362 CKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQV----------FAEWFYD 411

Query: 428 SLLRGEEDDGNNSNGQDCALSNDVDALDTYPKEHYSTQLFLNNFVLPTQTYKWIKNDFPN 487
            ++   ++D           S D   LD+Y  + Y +  + +     ++T +  +   P 
Sbjct: 412 VVMETVDEDYKRP-------SRDGIPLDSYGLDQYLSYCWQS-----SETIQRFETSLPE 459

Query: 488 KLESLIRQFDLVQKNYTAKWIKKMIKVS 515
                     L+ + YT +W+   I V+
Sbjct: 460 LAARPGVSAALLDRKYTREWLLADIHVT 487

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  155 bits (393), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 133/522 (25%), Positives = 235/522 (45%), Gaps = 68/522 (13%)

Query: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79
           WN RLSL+ +     V++ R IDG+++ ++ LR   + +++  Q E  +G LFA+   +G
Sbjct: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLR--GDGQLIGAQWELAEGKLFALFFGNG 78

Query: 80  SVKVYKG------RQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKWKS-RGAFK 132
           +V++Y        R+ VD  D    AD+             ++  VW+  +W   R  +K
Sbjct: 79  AVRIYDCATGGSLREVVDLVDEGQSADV------------TVDTAVWSGAQWAQFRQEYK 126

Query: 133 GDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENESNMFLTYDNATRKVM 192
           G  +  +T+ LP +  + V    +L+  PLE     W A   ++ + +FL +D  +   +
Sbjct: 127 G-LNIEITKQLPGMVRL-VRDAKQLSVVPLETGKLRWLADPGKDAA-IFLGHDEKSGDYL 183

Query: 193 VSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLEFTESHQMHELMK 252
           +++DG  + R     K   K+  IL    +        D  +Q + L F  S  M EL++
Sbjct: 184 MTVDGLLSVRVPSGIK---KMHKILRQGEDGTFVGVGADGTVQWVVLRFLNSALMRELIR 240

Query: 253 CCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLKDVFYLGYSAEKN 312
              QI+FL  YL +N  +    L+EP+  F+  +    +   L    +D+   GY  E +
Sbjct: 241 YSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPE-D 299

Query: 313 IENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLIKSLKLN 372
           +E+W    +G      WKQ +   +     +L   +IPACERLI+A ++LQG+ K LKL 
Sbjct: 300 LEDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQ 359

Query: 373 IFGLDDDEELIAPEVDELL---QMGLDTLTEIVKQVEKFHIGENMSIDGLTWIEYMIDSL 429
            FGL   +E  + EV EL+   Q  L    E+V  + +     +  +  + + ++  D +
Sbjct: 360 EFGLASPQEFESAEVTELITGCQALLHASLELVVDLNR-----DTRLHAI-FADWFYDVV 413

Query: 430 LRGEEDD----GNNSNGQDCALSNDVDALDTYPKEHYSTQLFLNNFVLPTQTYKWIKNDF 485
           +   ++D     N  + QDC   +   ALD Y                   ++ W  ++ 
Sbjct: 414 METVDEDYKRPQNRDSHQDC-YGDRALALDQYI------------------SHCWENSEV 454

Query: 486 PNKLESLIRQFDL--------VQKNYTAKWIKKMIKVSGPIR 519
             + E L+ Q           +   YT  W+ + + V+ P+R
Sbjct: 455 WTRFERLLPQLAADADISATKLDHIYTRAWVLEQVHVTSPVR 496

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score =  141 bits (356), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/351 (25%), Positives = 175/351 (49%), Gaps = 26/351 (7%)

Query: 179 NMFLTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIK 238
           ++F+  D+ T K+++SI+GT N + GEK K P  +  I+  ++  Y+ L  +DW  Q++ 
Sbjct: 158 DIFMAIDSKTNKLILSIEGTLNIKVGEKLKLPKDIKRIIKVSSGKYMCLG-KDWSYQVLD 216

Query: 239 LEFTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKG 298
           L F +   +++L+K   +   L++YL+  H+ + +KL EP+  F+ +L  +E  +     
Sbjct: 217 LTFLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEHKN----A 272

Query: 299 LKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVA 358
           L+++FY+G +  + +E    ++L    +  W   ++   S+S G++V C IP  ER+IV 
Sbjct: 273 LQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLERMIVL 332

Query: 359 VKRLQGLIKSLKLNIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDG 418
              ++ L +++    F    +E  +  ++ E     ++TL  +  Q +     +     G
Sbjct: 333 AASIEALCEAITWIKFP---NEIWVGSKLRE---RTVETLKSVRSQTDSIMKNKKTQELG 386

Query: 419 LTWIEYMIDSLLR----------GEEDDGNNSN-----GQDCALSNDVDALDTYPKEHYS 463
           L WI  + DSL +           E +  N SN     G    ++ +         +  +
Sbjct: 387 LMWIRSLSDSLSKMERNRDQISPPEPETTNGSNNFSFFGSSTGITGEDSKTLQKRADINT 446

Query: 464 TQLFLNNFVLPTQTYKWIKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIKV 514
            + FL   +LP + Y+W+K  FPN +     +FD + K+YT KW+K+ + V
Sbjct: 447 VEKFLAKDLLPEKQYEWVKTSFPNLILETQAEFDKIIKDYTLKWLKRQMSV 497

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/329 (24%), Positives = 148/329 (44%), Gaps = 32/329 (9%)

Query: 49  IPLRLKSNEEILTCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVGTIVLG 108
           I  ++++  +I+  Q E N G+  A+  + G+V +Y            DG      + + 
Sbjct: 39  INYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVMIY------------DGIKTSRLLAML 86

Query: 109 RGEWFNMEQFVWNRIKWKSRGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPE 168
            G   N++  +W+R  + +    K  FD+ +T ++P L ++    + K    P  +  P 
Sbjct: 87  NGGKPNVDAGIWDRYYFPNDNE-KDIFDSDITLYMPTLIQI---IRDKEKICPGTYFPPH 142

Query: 169 --WNASLSENESNMFLTYDNATRKVMVSIDGTFNFRY-GE-KNKFPTKVTN-----ILSG 219
             W A   E+  N FL        +  S+D +F F   GE K  FP+  T+     I+ G
Sbjct: 143 STWRAKKEESLKNEFLD----IHLLHHSVDDSFTFILNGELKLPFPSNSTSGRAIGIIKG 198

Query: 220 NANNYVFLNDEDWQLQIIKLEFTESHQMHE-LMKCCSQIQFLMKYLRDNHKIIGVKLMEP 278
             N ++    +D  +++I        + +E L+    +I  L+KYL+++   I   +  P
Sbjct: 199 ENNCFICFY-QDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMFIKDNMSTP 257

Query: 279 HATFINSLFPDEQASRLLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWS 338
              F+ S+  +     +++ L  +   GY + + +E W    +G   ++ W     +F+ 
Sbjct: 258 FNEFLTSVKGEATQEMMMENLITMLVSGYISTE-LEEWIRNTIGIKNLTRWATLGGIFYE 316

Query: 339 SSQGILVTCMIPACERLIVAVKRLQGLIK 367
               I+   +IPACER ++ V RLQGLI+
Sbjct: 317 KGVDIITLMVIPACERFMILVARLQGLIE 345

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 88/427 (20%), Positives = 179/427 (41%), Gaps = 45/427 (10%)

Query: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLR---LKSNEEILTCQLEPNDGDLFAVVL 76
           +N R  ++       + I R  D  ++ +IP+R   L +N    T       G   ++  
Sbjct: 12  YNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVT-----GKFLSIFF 66

Query: 77  RSGSVKVYKGRQDVDSSDPTDGADMVGTIV-LGRGEWFNMEQFVWNRIKWKSRGAFKGDF 135
           + G+++++   +D             G +V   R     + +  W+RI  +S     G+ 
Sbjct: 67  KDGTIRIHDIFKD-------------GRLVSFLRIPSTKISKGTWDRIPLESESG-NGNL 112

Query: 136 DTVLTQWLPKLTEMNVSPQGKLTCTPLE-----FEGPEWNASLSENESNMFLTYDNATRK 190
              +  +LPKL    V    ++   P       + GP+ +   +  + ++ + ++    K
Sbjct: 113 AYNIIDYLPKLIRY-VKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDK 171

Query: 191 VMVSIDGTFNF----RYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKL-EFTESH 245
           + V  +G +         E  +F   +  I  G  + +     +D  ++ + L     S 
Sbjct: 172 ITVFFNGDYAIFVPVGADENERFVKSIVKIQDGFYHCFY----DDGTVRTLNLGPLLRSE 227

Query: 246 QMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQA-SRLLKGLKDVFY 304
               ++K    I+ L+ YL ++ + I  +L+ P+  F+N L  +     +L+  L+ +F 
Sbjct: 228 PSMNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFL 287

Query: 305 LGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQG 364
           LG     ++E+W    +G      WK      +  +  IL    +PACER+I+ V++L+G
Sbjct: 288 LG-EVSCDLEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRG 346

Query: 365 LIKSLKL-NIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDGLTWIE 423
           ++++  + N F  +D  +L A  VD LL+   + LT  +K +      E +      W+ 
Sbjct: 347 ILEAFSIQNKF--NDSSDLTA--VDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLN 402

Query: 424 YMIDSLL 430
             I  +L
Sbjct: 403 DRIHEVL 409

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 89/443 (20%), Positives = 196/443 (44%), Gaps = 46/443 (10%)

Query: 21  NDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSGS 80
           N+ L L+       + + R  D   + S  +R  S  ++++ Q +   G++ +V+ + GS
Sbjct: 16  NNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPS--QVVSYQWDTIGGEIISVMFQDGS 73

Query: 81  VKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKWKSRG-AFKGDFDTVL 139
           +++         +D    A +V    L R +   ++  +W+RI+  SR  + + D D ++
Sbjct: 74  IRI---------NDVMYDAKLVA---LLRTQRTGLDCVLWDRIRLPSRAQSMEWDPD-II 120

Query: 140 TQWLPKLTEM---NVSPQGKLTCTPLEFEGPEW---NASLSENESNMFLTYDNATRKVMV 193
           TQ LP+L +    + SP    + +P       W   N+  +    ++   +      ++ 
Sbjct: 121 TQSLPRLVKFMGSDASP----SMSPYLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVA 176

Query: 194 SIDGTFNFRY-GEKNKFPTKVTNILS-GNANNYVF--LNDEDWQLQIIKLEFTESHQMHE 249
            ++G +  +  G   +  +++  I++  ++  +V+          Q+    F E     +
Sbjct: 177 LLNGEYQLQLTGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIK 236

Query: 250 LMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDE-QASRLLKGLKDVFYLGYS 308
           L++     Q  + Y   + + I  + +EP+  FI  L  D     +L + L D F +G S
Sbjct: 237 LLERFLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVG-S 295

Query: 309 AEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLIKS 368
            ++ + +W    LG   +  WK   +  +  +  +++ C++P  ERLI+  ++LQ L+ +
Sbjct: 296 MDEELRDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLT 355

Query: 369 LKLNIFGLDDDEEL-----IAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDGLTWIE 423
            +L+   + D  E+     +     ELLQ+ L T+ ++ K ++   +        L W+E
Sbjct: 356 AQLSEGMVGDSLEISEFTDLLENCQELLQLVLQTVKQLAKDIKDIKV-------FLLWLE 408

Query: 424 YMIDSLLRGEEDDGNNSNGQDCA 446
            ++ + +   +D   N N  +C 
Sbjct: 409 NVLKTTI--NKDYPPNFNVSECG 429

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 75/403 (18%), Positives = 165/403 (40%), Gaps = 31/403 (7%)

Query: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79
           +N R  ++ I     + I R  D  ++  IP+R  +   +     + + G   ++  + G
Sbjct: 8   YNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVR--NIALVANYNWDVSTGKFLSIFFKDG 65

Query: 80  SVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKWKSRGAFKGDFDTVL 139
           +++++   +D           +V  + + R +   + + +W+RI  K   + + +F   +
Sbjct: 66  TIRIHDIFKD---------GRLVSFLRIPRTK---ISRGIWDRIPLKYESSNR-NFANNV 112

Query: 140 TQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENESN-----MFLTYDNATRKVMVS 194
              LPKL    V    ++T  P       W     ++  N     + + ++    K+ V 
Sbjct: 113 IDVLPKLIRF-VKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVF 171

Query: 195 IDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLE-FTESHQMHELMKC 253
            +G +       +    K+   +    N +      D  +    LE   +S    +L++ 
Sbjct: 172 FNGDYAILLPVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRY 231

Query: 254 CSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQA-SRLLKGLKDVFYLGYSAEKN 312
              I+ L+ YL  + + I  +L  P+  F+  +  +    S+L   LK +F LG     +
Sbjct: 232 MMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLG-EVPSD 290

Query: 313 IENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLIKSLKLN 372
           +++W    +G      WK      +  +  +     +P CER+I+ V++L+G++++  + 
Sbjct: 291 LDDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQ 350

Query: 373 IFGLDDDE----ELIAPEVDELLQMGLDTLTEIVKQ---VEKF 408
                  +    EL+  +  ELL + L ++ ++ K     EKF
Sbjct: 351 XXXXXXXDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKF 393

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score = 67.0 bits (162), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 72/348 (20%), Positives = 153/348 (43%), Gaps = 28/348 (8%)

Query: 69  GDLFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVGTIV-LGRGEWFNMEQFVWNRIKWKS 127
           G   ++  R GS+++    +D             G +V   R ++ N++   W+RI+ ++
Sbjct: 61  GKYLSIFFRDGSIRIIDVFKD-------------GKLVAFLRTQFKNVDCTYWDRIEEQT 107

Query: 128 RGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEW---NASLSENES-NMFLT 183
               K  F+  +   +P L +  VS   KL+  P       W   +A   +N   +M   
Sbjct: 108 TNEMK-QFNKNIVDLMPSLIQF-VSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCL 165

Query: 184 YDNATRKVMVSIDGTF--NFRYGEKNKFPTKVTNILSGNANN-YVFLNDEDWQLQIIKLE 240
           + + T   ++ ++G +    +  E +         L  +AN+ Y  +  +    +I    
Sbjct: 166 HQSETDSFLMVLNGDYYLTLKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSS 225

Query: 241 FTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQA-SRLLKGL 299
           F  S    +L++C   ++ + KY R++  ++   +++P+  F+  +        +L+  L
Sbjct: 226 FLSSKSCIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINEL 285

Query: 300 KDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAV 359
           K  F LG  +++ +++W    +G   ++ W+   H  +  +  +    ++ ACER+I+  
Sbjct: 286 KITFLLGTISDE-LQDWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLS 344

Query: 360 KRLQGLIKSLKLNIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQVEK 407
           +R  GLI + +    G DD+  L   E++EL+    D L  I+   E+
Sbjct: 345 ERCFGLIMAFQFE-SGADDNSRL--HELNELMSNLQDMLKSIIYTAEE 389

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 76/369 (20%), Positives = 140/369 (37%), Gaps = 44/369 (11%)

Query: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79
           +N   SL+       ++I R  D  K+ ++ +R      +   Q +P  G    V  + G
Sbjct: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVR--DLNVLAQFQWDPITGKRMTVFYKDG 68

Query: 80  SVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKWKSRGAFKGDFDTVL 139
           + ++Y            D       + L R     ++  +W+RI+  SR      FD  +
Sbjct: 69  NARIY------------DAFQAGKLLALLRISKTRVDGAIWDRIEL-SRQEVTFKFDHFV 115

Query: 140 TQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENES--------NMFLTYDNATRKV 191
              +PK+       + ++   P E     W  +  E +         ++ L +      V
Sbjct: 116 LNSMPKMIRFARDTR-QIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDNGLV 174

Query: 192 MVSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLEFTESHQMHELM 251
           ++ +DG F  R       P     +++     + F  D             ES  + +L+
Sbjct: 175 LM-LDGDFILRLAAGPSGPALKDIVVADRGLYHCFYEDAT----------VESLSLDQLI 223

Query: 252 KCCSQIQF---------LMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLKDV 302
           +C + IQ          L  YL+D+  +I   L+ P+  F+  +        +L    + 
Sbjct: 224 QCDATIQLIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELES 283

Query: 303 FYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRL 362
             LG      +ENWF   +G      WK+     +  +  IL    IPACER+I+  +R 
Sbjct: 284 LLLGGGLSVELENWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERC 343

Query: 363 QGLIKSLKL 371
           +  +K+L+L
Sbjct: 344 RACLKALQL 352

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 77/383 (20%), Positives = 169/383 (44%), Gaps = 50/383 (13%)

Query: 13  DGLVDPF--WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGD 70
           D ++D F  +N +  L+G++E  +  + R      +G + + +++   +L    +P DG 
Sbjct: 4   DIVLDRFLKYNPKYGLFGMNEDNHSLVIRRT-SDNVGIVKINVRNIVLLLDYFWDPIDGK 62

Query: 71  LFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVG-----TIVLGRGEWFNMEQFVWNRIKW 125
             A+ L+ GSV++Y         D  +G  ++       +VLG  +  +++  +W+RI  
Sbjct: 63  YLALFLKDGSVRIY---------DIFNGGKLISFLRVLPVVLGSNKP-SLDCCLWDRIII 112

Query: 126 KSRGAFKGDF-DTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLSENES---NMF 181
              G+ +    +  LT+ +P L +  V    ++   P       W  S+  NE    ++ 
Sbjct: 113 PKSGSSELRIPNNDLTESMPTLVKF-VQDAKQIDIIPNRSITKLWR-SIGNNEKKVVDVH 170

Query: 182 LTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLEF 241
           L Y  ++ +V + I+G +             V++I        + LN +++   I ++ F
Sbjct: 171 LGYSCSSAQVTILINGEY--------LIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHF 222

Query: 242 TESHQMH-------------ELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFP 288
            +  ++              +L++   ++      ++D+  +I   ++ P+  F+ S+  
Sbjct: 223 DDYSRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESI-- 280

Query: 289 DEQASRLLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCM 348
                  L  L+ +F +G   +  + NWF   +    +  W +  + F+S+ + +L+   
Sbjct: 281 --GGINDLDVLERLFLIG-ELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVF 337

Query: 349 IPACERLIVAVKRLQGLIKSLKL 371
           +P CERL+V   R+ G+IK + L
Sbjct: 338 VPICERLMVLTNRINGMIKGIDL 360

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/362 (18%), Positives = 144/362 (39%), Gaps = 30/362 (8%)

Query: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79
           +N R  ++       + I R  D  ++  IP+R  +   +     +   G   ++  + G
Sbjct: 12  YNPRFPIFATRITKGLAIHRVSDHARIAIIPVR--NIALVANYSWDRTSGKFLSIFFKDG 69

Query: 80  SVKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKWKSRGAFKGDFDTVL 139
           +V+++    D+           V +  + RG        +W+RI  K R      F   +
Sbjct: 70  TVRIH----DIFKDGRLVSFLRVPSTKISRG--------IWDRIPLK-REYDSETFAYNV 116

Query: 140 TQWLPKLTEMNVSPQGKLTCTPLE-----FEGPEWNASLSENESNMFLTYDNATRKVMVS 194
              LPKL    V    +++  P       + GP+ +   S    ++ + ++    K+ + 
Sbjct: 117 IDILPKLIRF-VKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIF 175

Query: 195 IDGTFNFRYG----EKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKLE-FTESHQMHE 249
            +G +         E  +    V  +  G    + F ND    ++ + L+    S    +
Sbjct: 176 FNGDYTILLPMDDIENERILESVVKVQDGFY--HCFYND--GSVRTLNLQPLLRSKPSVD 231

Query: 250 LMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLKDVFYLGYSA 309
           L+     I+ L+ YL  + ++I  +L+ P+  F+  +  +      LK   +  +L    
Sbjct: 232 LLHYIMVIKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEV 291

Query: 310 EKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLIKSL 369
             ++E+W    +G   +  WK      +  +  IL    +P CER+I+ V++L+G +++ 
Sbjct: 292 SCDLEDWLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAF 351

Query: 370 KL 371
            +
Sbjct: 352 SV 353

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 78/407 (19%), Positives = 163/407 (40%), Gaps = 35/407 (8%)

Query: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79
           +N    ++       + I+R  D  ++  IP+R  +   +     +   G   ++  + G
Sbjct: 12  YNPLFPIFATRIAKGLAIYRVSDHARLAVIPIR--NINLVANYDWDTTTGKFLSIFFKDG 69

Query: 80  SVKVYKGRQDVDSSDPTDGADMVGTIV-LGRGEWFNMEQFVWNRIKWKSRGAFKGDFDTV 138
           +++++   +D             G +V   R     + + +W+RI  +     + DF   
Sbjct: 70  TIRIHDIFKD-------------GRLVSFLRIPSTKISKGIWDRIPLRYEPNNR-DFACN 115

Query: 139 LTQWLPKLTEMNVSPQGKLTCTPLE-----FEGPEWNASLSENESNMFLTYDNATRKVMV 193
           +   LPKL    V    ++   P       + GP+ +   S  + ++ + ++    K+ V
Sbjct: 116 IIDDLPKLIRF-VKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITV 174

Query: 194 SIDGTFNFRYGEKN-KFPTKVTNILSGNANNYVFLNDEDWQLQIIKL-EFTESHQMHELM 251
             +G +       N +    + +I+      Y     ED  +Q + L    +S     L+
Sbjct: 175 FFNGDYAVFLSVDNIENENSLKSIIKVQDGFYQCFY-EDGTVQTLNLGPLLQSKSSVNLL 233

Query: 252 KCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLKDVFYLGYSAEK 311
                I+ L+ Y+  + + I  +L  P+  F+  L  +      LK   +  +L      
Sbjct: 234 NYIMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISC 293

Query: 312 NIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLIKSLKL 371
           ++E+W    +G      WK      +  +  IL    +PACER+I+ V++L+ ++++  +
Sbjct: 294 DLEDWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSI 353

Query: 372 NIFGLDDDEELIAPEV-----DELLQMGLDTLTEIVKQ---VEKFHI 410
               L    +L A EV      +LL M L+++  + +     EKF I
Sbjct: 354 Q-NKLSYTSDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFI 399

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/343 (20%), Positives = 140/343 (40%), Gaps = 41/343 (11%)

Query: 36  NIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDP 95
           ++ R  D  ++ +I +R  S  ++   Q +P  G   ++  + G+V++Y G +       
Sbjct: 24  SVHRMADDARIATIIVRDMS--QVAGYQWDPITGKFLSIFYKDGTVRIYDGFRS------ 75

Query: 96  TDGADMVGTIV-LGRGEWFNMEQFVWNRIKW-KSRGAFKG-DFDTVLTQWLPKLTEMNVS 152
                  G +V L R         +W+RI+   S    K    D  +T+ +PK+ +    
Sbjct: 76  -------GRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMVKFARD 128

Query: 153 PQGKLTCTPLEFEGPEWNASLSEN-----ESNMFLTYDNATRKVMVSIDGTFNFRYGEKN 207
            + +L   P       W    +++     ++++   +D+ +    V  DG F     +  
Sbjct: 129 SR-QLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLS----VMFDGEFTISI-QLA 182

Query: 208 KFPTKVTNILSGNANNYVFLND---EDWQL-QIIKLEFTESHQMHELMKCCSQIQFLMKY 263
             P+ +   +S       F  D   E + L  ++K  F+       L+K    ++ L +Y
Sbjct: 183 AIPSPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSL-----RLLKNVITMRQLHRY 237

Query: 264 LRDNHKIIGVKLMEPHATFINSLFPDEQASR--LLKGLKDVFYLGYSAEKNIENWFTLKL 321
           L+D+ ++I   L++P+  F+             L + L D+  +G      +E+W    +
Sbjct: 238 LQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVG-DVTPELEDWLVNSM 296

Query: 322 GRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQG 364
           G   +  W++     +  +  +L    +PACERLI   +R  G
Sbjct: 297 GEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTG 339

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/270 (21%), Positives = 112/270 (41%), Gaps = 25/270 (9%)

Query: 135 FDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEW-------NASLSENESNM------- 180
           FD  LT  +P L +    PQG L   P+      W       N  L  +++ +       
Sbjct: 116 FDYDLTNSMPTLVKFVKDPQG-LQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLD 174

Query: 181 --FLTYDNATRKVMVSIDGTFNFR-YGEKNKFPTKVTNILSGNANNYV-FLNDEDWQLQI 236
              L  ++      V ++G ++       N+ P KV  ++  +   Y+ F  +  ++L I
Sbjct: 175 IHLLYTESGMDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRL-I 233

Query: 237 IKLEFTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPD--EQASR 294
               F+ +     L+     ++  +  L++  +II  +L+ P  +FIN +  D  E    
Sbjct: 234 DVTPFSSNDIRVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDN 293

Query: 295 LLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACER 354
           L + + ++   G  +E+  E+W    +G   +  WK            IL    IP  E+
Sbjct: 294 LYRSMTNLLLTGEISEE-FEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEK 352

Query: 355 LIVAVKRLQGLIKSLKL--NIFGLDDDEEL 382
            I+  +R+Q  I +++L  N   L++D E+
Sbjct: 353 FIITAERIQNYITAMRLSDNSKILENDSEI 382

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 89/187 (47%), Gaps = 9/187 (4%)

Query: 193 VSIDGTFNFRYGEKNKFPT---KVTNILSGNANNYVFLNDEDWQLQIIKLEFTESHQMH- 248
           ++I+GT+      K    T   K+  IL    +       E+  ++ +      S  +H 
Sbjct: 219 IAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLYFSHFTSSTLHV 278

Query: 249 ELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFI-NSLFPDEQ---ASRLLKGLKDVFY 304
           EL++   +I  ++KY + +  +I   L++    F+  ++F ++Q    + +L+ LK    
Sbjct: 279 ELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGGGNSMLQQLKLSLL 338

Query: 305 LGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQG 364
            G  +E+ IE W TL +G   +  WK+ +   +S S  I    +IPACE  ++  ++   
Sbjct: 339 SGEMSEELIE-WLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPACELTLLLSQKCLA 397

Query: 365 LIKSLKL 371
           ++ ++++
Sbjct: 398 ILNAIEI 404

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 57/119 (47%), Gaps = 2/119 (1%)

Query: 250 LMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLKDVFYLGYSA 309
           L+    +I+ L +Y+ D+  +I  +L+ P++ F+  +  D  A  + K   ++  L  + 
Sbjct: 241 LLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTG 300

Query: 310 EKNIE--NWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLI 366
           E N E  +W    +G      W++     +     IL   +IP+CER ++ ++R  G +
Sbjct: 301 EINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYL 359

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 57/275 (20%), Positives = 115/275 (41%), Gaps = 24/275 (8%)

Query: 115 MEQFVWNRIKWKSRGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPEWNASLS 174
           M+  +W++++ + +   +G+FD  ++  +P   +  V+  G+L   P      +W     
Sbjct: 95  MDTGIWSKLEVRQKPN-EGEFDRDISGLMPSPIKF-VNNAGQLEVVPYVVTQTQWRNVDK 152

Query: 175 ENESN----MFLTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNIL------SGNANNY 224
             E N    + + +++ T + ++ I+G +     + N      +N L         A  +
Sbjct: 153 PLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTI-QPNSTDENASNQLHKIIHLEKTAIFH 211

Query: 225 VFLNDEDWQLQIIKLE-FTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFI 283
            F  D   +   I L    ES     L+   ++++ L +Y+ D+  II   L +P   F+
Sbjct: 212 CFYKDR--KTSTIDLTTLMESTPHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFL 269

Query: 284 ---NSLFPDEQASRLLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSS 340
              N L        L K LK     G  A K++ +W    +G   +  WK+ +   +   
Sbjct: 270 EVTNIL----NIKDLSKSLKSFILYGLMA-KSLNHWLCNVVGEKNLKKWKRLSETKYQKI 324

Query: 341 QGILVTCMIPACERLIVAVKRLQGLIKSLKLNIFG 375
             I+   ++PA E+L +   R + L+ ++ L   G
Sbjct: 325 IQIISLAVLPALEKLSLLSIRCEALVVAIALPASG 359

>KLLA0D02596g Chr4 complement(218659..219586,219682..219782) [1029
           bp, 342 aa] {ON} similar to uniprot|Q06417 Saccharomyces
           cerevisiae YLR426W Hypothetical ORF
          Length = 342

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 6/81 (7%)

Query: 637 YLVNYSSSLGIKDPSRITIYNDLKILM----EPSTLELLNKNAAENR--MIVHSDMAVTI 690
           Y+VN +S+LGI  P+R + Y   K  +    E  T ELLN NA   R  +++   M   +
Sbjct: 207 YVVNIASALGIMSPARASTYAASKAALISYHESWTYELLNDNAMNVRTLLVLPGQMDTQM 266

Query: 691 LSSFTNEQGVLEPHTSYCQLA 711
              F   +  L P     +LA
Sbjct: 267 FQGFEPPRQFLAPVIKAPELA 287

>Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to
           Ashbya gossypii ADL184W
          Length = 451

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSG 79
           W+ R  L  I      N+ ++ D R   ++   L     I+  + +P  G+L AVV +  
Sbjct: 213 WHPRFGL--IVSGSKDNLIKFWDPRTGRNVSTILGLKHTIIKTKFQPTQGNLLAVVAKDK 270

Query: 80  SVKVYKGRQDV 90
           S K+Y  RQ++
Sbjct: 271 STKIYDIRQNM 281

>KLTH0G16346g Chr7 (1424922..1426229) [1308 bp, 435 aa] {ON} similar
           to uniprot|P38211 Saccharomyces cerevisiae YBR004C GPI18
           Functional ortholog of human PIG- V which is a
           mannosyltransferase that transfers the second mannose in
           glycosylphosphatidylinositol biosynthesis the authentic
           non-tagged protein was localized to mitochondria
          Length = 435

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 36/89 (40%), Gaps = 18/89 (20%)

Query: 436 DGNNSNGQDCALSNDVDALDTY-----PKEHY--STQLFLNNFVLPTQTYKWIKNDFPNK 488
            GN S G+ C     + A+  +     PK  +  ST L L  F   +QT  W+   F NK
Sbjct: 5   SGNMSLGRICLFFAGIKAIQFFIVLACPKSQFDTSTSLLLERFSHQSQTQSWLNTRFWNK 64

Query: 489 LESLIRQFDLVQKNYTAKWIKKMIKVSGP 517
           L S           + A +  K + V GP
Sbjct: 65  LLS-----------WDAAYFLKCVIVGGP 82

>NCAS0A03590 Chr1 complement(715709..717310) [1602 bp, 533 aa] {ON}
           Anc_4.177
          Length = 533

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 9/78 (11%)

Query: 622 PGRFLMLTEDGYLRRYLVNYSSSLGIKDP-----SRITIYNDLKILMEPSTLELLNKNAA 676
           PG    L++D    +Y   Y  SL  +DP      R   Y+DL + MEP  LEL  ++ +
Sbjct: 415 PGAIADLSKDEIKEKYPAEYKESL--RDPYHYRFPRAESYHDLAVRMEPLLLEL--EHTS 470

Query: 677 ENRMIVHSDMAVTILSSF 694
            N +I+  +  + +L  +
Sbjct: 471 NNVLIIAHESTIRVLFGY 488

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 27/53 (50%)

Query: 36  NIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSGSVKVYKGRQ 88
           N+ ++ D R    +   L     I++ + +P  G+L +V+ +  + KVY  RQ
Sbjct: 229 NLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQ 281

>Suva_13.442 Chr13 complement(761934..763595) [1662 bp, 553 aa] {ON}
           YMR258C (REAL)
          Length = 553

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%)

Query: 635 RRYLVNYSSSLGIKDPSRITIYNDLKILMEPSTLELLNKNAAENRMIVHSDMAVTILSSF 694
           + Y+  Y S L   D + I +Y+ ++ L+E S L+L+ +   +N +  H +  + +L   
Sbjct: 66  KTYVSGYRSVLKTGDKNDIFVYDRVERLLEASHLKLIKQITIDNDIFHHREEGLQLLQRL 125

Query: 695 TNE 697
            NE
Sbjct: 126 VNE 128

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%)

Query: 36  NIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSGSVKVYKGRQ 88
           N+ +  D R   ++   L     ++  + +P  G+L AVV +  S+K+Y  RQ
Sbjct: 227 NLIKLWDPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQ 279

>NDAI0D02340 Chr4 (541550..542992) [1443 bp, 480 aa] {ON} 
          Length = 480

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 20/134 (14%)

Query: 415 SIDGLTWIEYMIDSLLRGEEDDGNNSNGQD-----CALSNDVDALDTYPKEHYSTQLFLN 469
           S   LT +   + SLL  + +D NN+N Q+       LS D+  L T+P    S +L L 
Sbjct: 177 SSSSLTTVHNDVSSLLSQQNNDANNTNVQEDDPQQLMLSQDISHLTTFPSS-LSKRLSL- 234

Query: 470 NFVLPTQTY--KWIKNDFPNKL-------ESLIRQF-DLVQKNYTAKWIKKMIKVSGPIR 519
             ++P++T   K   N F   +       ++LI QF D    N  +    K+IK+S    
Sbjct: 235 --IIPSKTTLKKKSANTFAKFIFAEDRYSDNLICQFYDPNNTNEDSSICNKIIKMSSKSI 292

Query: 520 KLRSITGQRLKDAI 533
           K R+   ++ KD +
Sbjct: 293 KRRT-QARKCKDHL 305

>TBLA0B05720 Chr2 complement(1353757..1354566) [810 bp, 269 aa] {ON}
           Anc_2.358 YMR157C
          Length = 269

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 5/71 (7%)

Query: 472 VLPTQTYKWIKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIKVSGPIRKLRSITGQRLKD 531
           V+P +  + I+ D  NK ++L++++     + T+K+ + +     P+  + S+ GQ LK+
Sbjct: 146 VIPLEVAESIRKDENNKYQALLQEYYEKYNDDTSKYFENL-----PVGMMASLLGQYLKN 200

Query: 532 AIMDGDVIYMI 542
               GD I +I
Sbjct: 201 NSKPGDNIALI 211

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {ON}
           
          Length = 1107

 Score = 31.6 bits (70), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 388 DELLQMGLDTLTEIVKQVEKFHIGENMSIDGLTWIEYMIDSLLRGEEDDGNNSNGQDCAL 447
           DE+LQ  L  L  +V+Q+EK H  ++   + +  I+  I+ L+     D + +   D   
Sbjct: 204 DEVLQEELSILQTMVRQLEKLHKSDSHRNNTIANIKLQINDLIDSWTPDVDFTRLSDVP- 262

Query: 448 SNDVDALDTY-PKEHYSTQLFLNNFVL 473
            +D+ +L+++  K  Y+ Q+ + NF +
Sbjct: 263 EDDILSLESHLMKNKYTEQVCITNFSI 289

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,537,569
Number of extensions: 3492458
Number of successful extensions: 10177
Number of sequences better than 10.0: 40
Number of HSP's gapped: 10468
Number of HSP's successfully gapped: 41
Length of query: 715
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 598
Effective length of database: 40,065,477
Effective search space: 23959155246
Effective search space used: 23959155246
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)