Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_42998.271ON87487445820.0
SAKL0H16830g8.271ON86285524750.0
AGR077C8.271ON84884724140.0
KLLA0F19338g8.271ON89186623860.0
YBR294W (SUL1)na 1ON85986023070.0
Skud_2.424na 1ON86386323050.0
Smik_12.1518.271ON89388323010.0
YLR092W (SUL2)8.271ON89387622840.0
Kpol_543.438.271ON86686922800.0
Skud_12.1608.271ON89387322810.0
KLTH0G13486g8.271ON90288222770.0
TDEL0F039808.271ON86785822600.0
Kwal_56.237598.271ON86187822570.0
NCAS0B050508.271ON92392422600.0
KNAG0G020708.271ON89988322510.0
Smik_2.435na 1ON86385922480.0
Suva_10.1768.271ON89391622460.0
Suva_4.554na 1ON85086622380.0
KAFR0B027508.271ON83486322330.0
NDAI0B020208.271ON90590121940.0
CAGL0L12342g8.271ON89189921820.0
ZYRO0C01452g8.271ON90688021200.0
TPHA0J008008.271ON91792121140.0
TPHA0A017608.271ON89388720460.0
TBLA0F030508.271ON89752012001e-150
AGR213Cna 2ON6895083663e-35
Ecym_7084na 2ON6894763413e-32
KNAG0D023908.99ON7165013413e-32
NCAS0B048008.99ON7245503404e-32
ZYRO0F04796g8.99ON7354773334e-31
Kpol_467.118.99ON7444873174e-29
Suva_16.3228.99ON7425043131e-28
TDEL0C012808.99ON7274783093e-28
YPR003C8.99ON7544813093e-28
NDAI0B022108.99ON7065303041e-27
Skud_16.2868.99ON7455742986e-27
TBLA0C052708.99ON7764632971e-26
TPHA0H007208.99ON7875062952e-26
Smik_16.2418.99ON7444932915e-26
KLLA0E14059g8.99ON7064772843e-25
CAGL0L09207g8.99ON7254742782e-24
Kwal_27.110398.99ON7264882683e-23
KLTH0G16764g8.99ON7104742674e-23
SAKL0H08800gna 2ON6204742583e-22
SAKL0B03124g8.99ON7441951942e-14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4299
         (874 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...  1769   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...   957   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   934   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...   923   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...   893   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...   892   0.0  
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...   890   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...   884   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...   882   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...   883   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...   881   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...   875   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   874   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271    875   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...   871   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...   870   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...   869   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...   866   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...   864   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271    849   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...   845   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...   821   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....   818   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   792   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   466   e-150
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...   145   3e-35
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   135   3e-32
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   135   3e-32
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   135   4e-32
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   132   4e-31
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   126   4e-29
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   125   1e-28
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...   123   3e-28
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   123   3e-28
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   121   1e-27
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   119   6e-27
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   119   1e-26
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   118   2e-26
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...   116   5e-26
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   114   3e-25
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...   111   2e-24
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...   107   3e-23
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   107   4e-23
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...   103   3e-22
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    79   2e-14

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score = 1769 bits (4582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 862/874 (98%), Positives = 862/874 (98%)

Query: 1   MFILRENSDGIESQASTISDTQNLRTVDNNNRGLQDTSGLDELETDYTRFKTNEDSAGYS 60
           MFILRENSDGIESQASTISDTQNLRTVDNNNRGLQDTSGLDELETDYTRFKTNEDSAGYS
Sbjct: 1   MFILRENSDGIESQASTISDTQNLRTVDNNNRGLQDTSGLDELETDYTRFKTNEDSAGYS 60

Query: 61  GAENERSRIDKFDSVGSSLQFAKYDGNALPDFKAPPYYETTVTFMEYYDRTIRSRVGXXX 120
           GAENERSRIDKFDSVGSSLQFAKYDGNALPDFKAPPYYETTVTFMEYYDRTIRSRVG   
Sbjct: 61  GAENERSRIDKFDSVGSSLQFAKYDGNALPDFKAPPYYETTVTFMEYYDRTIRSRVGRSF 120

Query: 121 XXXXXXXXXPIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSF 180
                    PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSF
Sbjct: 121 FRSYFLSLFPIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSF 180

Query: 181 IGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSIL 240
           IGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSIL
Sbjct: 181 IGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSIL 240

Query: 241 VIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKINTRVETYRVLISTL 300
           VIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKINTRVETYRVLISTL
Sbjct: 241 VIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKINTRVETYRVLISTL 300

Query: 301 KHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALR 360
           KHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALR
Sbjct: 301 KHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALR 360

Query: 361 NAFVLFLATFVSWLVIGRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVI 420
           NAFVLFLATFVSWLVIGRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVI
Sbjct: 361 NAFVLFLATFVSWLVIGRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVI 420

Query: 421 ILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNV 480
           ILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNV
Sbjct: 421 ILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNV 480

Query: 481 KTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFD 540
           KTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFD
Sbjct: 481 KTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFD 540

Query: 541 LISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDL 600
           LISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDL
Sbjct: 541 LISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDL 600

Query: 601 DSIGNNDPELPQEISKDSKLAKDPDVHASANLMASKLDVRFHTKWVPLDNGYSRELNPEI 660
           DSIGNNDPELPQEISKDSKLAKDPDVHASANLMASKLDVRFHTKWVPLDNGYSRELNPEI
Sbjct: 601 DSIGNNDPELPQEISKDSKLAKDPDVHASANLMASKLDVRFHTKWVPLDNGYSRELNPEI 660

Query: 661 AVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDW 720
           AVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDW
Sbjct: 661 AVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDW 720

Query: 721 VPPLFLRKFFKKYRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTI 780
           VPPLFLRKFFKKYRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTI
Sbjct: 721 VPPLFLRKFFKKYRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTI 780

Query: 781 NRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEE 840
           NRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEE
Sbjct: 781 NRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEE 840

Query: 841 NQQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874
           NQQNSEISASLDVASGTNFPFFHIDMPDFTKWDI
Sbjct: 841 NQQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/855 (56%), Positives = 618/855 (72%), Gaps = 39/855 (4%)

Query: 40  LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSV-----GSSLQFAKYDGNALPDFKA 94
           LD+LE +Y  +K  E        +N R + D  +++      +  +  K DG    +   
Sbjct: 27  LDDLEAEYDNYKNAE--------QNPREKSDVVETLPPTTHQNDAKGLKNDGQTTVELYG 78

Query: 95  --------PPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSD 146
                   P Y+E TV F +YYD+++ S +             P+I+WI HYNFAWMY D
Sbjct: 79  TTSSGGVIPGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYNFAWMYGD 138

Query: 147 FIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQ 206
            +AG+TVGCVLVPQSMSYAQ+A L  +YGLYSSFIGAFIYSFFATSKDVCIGPVAVMS++
Sbjct: 139 VVAGVTVGCVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLE 198

Query: 207 VSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMT 266
            +KVI+ V + LP+ T IT P++A+AL+L    + + IG+LRLGF++ELIS+ AVAGFMT
Sbjct: 199 TAKVIARVTEHLPDDTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMT 258

Query: 267 GSALSILASQLPSLLGI-QKINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKW 325
           GSA SI+  QLP+L+G  +K+NTR  TY+V+I+TLKHL  + ++A FGLI L +L+ WK+
Sbjct: 259 GSAFSIITGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKY 318

Query: 326 TCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHKKKTSI 385
            C  +GP  + + + P+S +A+ W+SFFFYAQALRNAFV+ L T ++W  I RHKKK  I
Sbjct: 319 GCNTIGPNWVDRRMNPHSPRAKFWKSFFFYAQALRNAFVIVLFTLIAW-GITRHKKKHPI 377

Query: 386 SVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQ 445
           S+L TVPSGLK+VGV   P  L   L P+LP A IILLLEHI IAK+FGRIN+YK+VPDQ
Sbjct: 378 SLLNTVPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGRINDYKVVPDQ 437

Query: 446 ELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFY 505
           ELIAIGVTNL+G+FFNAYPATGSFSRSALKAKCNV+TPLSG+F+GACVLLALY LT AFY
Sbjct: 438 ELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFY 497

Query: 506 YIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVA 565
           YIPKA LSAVIIHAV DLIASY+ ++  W  NP D + FL T+ +TIFSSIENGIYFA+ 
Sbjct: 498 YIPKATLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAIC 557

Query: 566 FSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPE-LPQEISKDSKLAKDP 624
           +S A LL K AFPSGKFLG V+++EV N  V EDL  + + D E +    S   KL    
Sbjct: 558 WSCAILLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENINVASSTKPKLGLSA 617

Query: 625 DVHASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCS 684
           D   ++++      VRFHTKW+PL+N Y RE N  I V  PPPGVIVYRP+ESW Y+NCS
Sbjct: 618 D---NSSISTGPSRVRFHTKWIPLENNYGREYNSGIVVQPPPPGVIVYRPSESWTYINCS 674

Query: 685 RQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVVE 744
           RQ+DII D VK LTR G ++ H +KS++ W +PG W PPLFL+K FK  R K  + E+  
Sbjct: 675 RQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPLFLKKLFK--RGKRLEQELSP 732

Query: 745 QV--DNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKR 802
           ++  D RPVLKILAMDW+QVT +D+T +Q+L+DLRK IN+YADRQV FHFSGI+SPWIKR
Sbjct: 733 ELGRDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAINKYADRQVEFHFSGIISPWIKR 792

Query: 803 ALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEEN---QQNSEISASLDVASGTNF 859
           ALV  GFGT+N+ ++++ L+L +S+YH+V+     DEEN   Q    ISA    ASGTN 
Sbjct: 793 ALVAVGFGTVNDEFADESLILGHSSYHIVK-TRPQDEENHIGQGRYNISA----ASGTNM 847

Query: 860 PFFHIDMPDFTKWDI 874
           PFFH++MPDF+KW +
Sbjct: 848 PFFHVEMPDFSKWSL 862

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/847 (56%), Positives = 594/847 (70%), Gaps = 47/847 (5%)

Query: 40  LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSVGSSLQFAKYDG-NALPDFKAPPYY 98
           ++ L+ +Y + K  E  +       +   I      GS    A+Y G N       P Y 
Sbjct: 31  IEALQAEYDQLKAGEVHSAQGATHGD---IGSRQYSGSGKPAAQYLGLNVNSREAVPEYE 87

Query: 99  ETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGITVGCVLV 158
           ET V+  +YY+  +R  +             P+ +WIHHYN AWMY+D +AGITVGCVLV
Sbjct: 88  ETVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLV 147

Query: 159 PQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQL 218
           PQSMSYAQLA L P+YGLYSSF+GAFIYSFFATSKDVCIGPVAVMS++ +KVI+ V + L
Sbjct: 148 PQSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENL 207

Query: 219 PEGTPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLP 278
           PE T IT P++A+AL L    + + IG+LRLGF++E IS+TAV GFMTGSALSI++ Q+P
Sbjct: 208 PEDTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVP 267

Query: 279 SLLGI-QKINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISK 337
           SL+G  +K+NTR  TY+V+I +LKHL  +++NAAFGL+ L LLF WKW CG LGP+L+ +
Sbjct: 268 SLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDR 327

Query: 338 YLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHK-KKTSISVLGTVPSGLK 396
           YL+    +A  W + FFY QALRNA ++ + T +SW  I RHK +K  IS+LG VPSGLK
Sbjct: 328 YLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISW-GISRHKLEKPPISLLGKVPSGLK 386

Query: 397 HVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLI 456
           +VG   +P GLV KL+P+LP A IILLLEHI IAKSFGRINNYK+VPDQELIAIGVTNL 
Sbjct: 387 NVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLF 446

Query: 457 GSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVI 516
            +FFNAYPATGSFSRSALKAKCNVKTPLSGLF+GACVLLALY LT AFY+IPKA LSAVI
Sbjct: 447 ATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVI 506

Query: 517 IHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNA 576
           IHAV DLIASYK+++  W TNP D  +F+ T+++T+FSSIE+GIYF++++S A LL K A
Sbjct: 507 IHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFSISWSCAVLLCKVA 566

Query: 577 FPSGKFLGYVKITEV------SNLNVFEDLDSIGNNDPELPQEISKDSKLAKD-----PD 625
           FP GKFLGY+ + EV       ++N   DL SI N+     Q+I KD           PD
Sbjct: 567 FPDGKFLGYIDVAEVIEPAGPPSINSEADLASIDNS--ATFQQIDKDGGKLNTVESVLPD 624

Query: 626 VHASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSR 685
            H            RFH +W+PLD+ YSRELNPE  V+ PPPGVIVYRPT+SW YLNCSR
Sbjct: 625 PH-----------TRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTDSWTYLNCSR 673

Query: 686 QFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVVEQ 745
            FDII+D VK  TRPG+LVNHL   E+LWC+PG W PP   R+F    R  +A       
Sbjct: 674 HFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWRPPRIFRRFIADKRTGSA------V 727

Query: 746 VDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKRALV 805
            D RPVL++LAMDW+QV+ VDST IQ+L+DLR  +N+YADR V FHF+GIVSPWIKRALV
Sbjct: 728 ADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPVEFHFAGIVSPWIKRALV 787

Query: 806 HAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEENQQNSEISASLDVASGTNFPFFHID 865
           + GFG      ++ PL+    +YH+V+  L AD  +  +     S+  A GTN PFFH+D
Sbjct: 788 NTGFGI-----ADPPLISSRVSYHLVR--LPADPPHIVHGH---SVVFALGTNTPFFHLD 837

Query: 866 MPDFTKW 872
           MPDF  W
Sbjct: 838 MPDFETW 844

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/866 (53%), Positives = 619/866 (71%), Gaps = 36/866 (4%)

Query: 40  LDELETDYTRFKTNED-----SAGYSGAENERS----RIDKFDSV--GSSLQFAKYD-GN 87
            D+LE +Y   KT+E      S G+S + + R          DS+   ++  F K+D GN
Sbjct: 31  FDQLEQEYDDLKTSEIIAPHISNGHSISSSPRHHHLYEDRHLDSIIDTNTHGFKKHDNGN 90

Query: 88  A------------LPDFKAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWI 135
                            + P Y ET V   + YD  +R  +             P++KW+
Sbjct: 91  GKFADVNIEQIYNYDSLRVPNYEETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKWV 150

Query: 136 HHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDV 195
           HHYNF W+Y+D +AGITVGCVLVPQSMSYAQ+A L  +YGLYSSF+GAFIYSFFATSKDV
Sbjct: 151 HHYNFNWLYNDLVAGITVGCVLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKDV 210

Query: 196 CIGPVAVMSVQVSKVISHVIDQLPEGTP-ITAPMVASALALFSSILVIPIGLLRLGFILE 254
           CIGPVAVMS++ +KVI+ V++++ E  P ITAP++A+ L+L    + + +GLLRLGF++E
Sbjct: 211 CIGPVAVMSLETAKVIARVLEKVGEDNPEITAPIIATTLSLICGGVALGVGLLRLGFLVE 270

Query: 255 LISVTAVAGFMTGSALSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFG 313
            IS+ AVAGFMTGSA++I++ Q+P L+G  K +NTR  TY+V+I+TLKHL  + ++A FG
Sbjct: 271 FISLNAVAGFMTGSAINIMSGQVPGLMGYSKNVNTRDSTYKVIINTLKHLPDTKLDAVFG 330

Query: 314 LICLALLFFWKWTCGYLGPKLISKYL-RPNSKKARIWQSFFFYAQALRNAFVLFLATFVS 372
           LI L +L+ WK+ CG LGPKL+ +Y+ R + K+A  ++   FY QALRNAFV+ + T +S
Sbjct: 331 LIPLFILYSWKYFCGTLGPKLVDRYVARSDVKRAAAYKYILFYLQALRNAFVIIIFTLIS 390

Query: 373 WLVIGRHKKKTS--ISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIA 430
           W  I RHK K    IS+LGTVPSGLK+VGV  +P GLV  L  +LP A+IIL+LEHI I+
Sbjct: 391 W-GITRHKAKEDLPISLLGTVPSGLKNVGVMKLPDGLVSNLASELPSAIIILVLEHIAIS 449

Query: 431 KSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSG 490
           K+FGR+N YK+VPDQELIAIGVTNLI +FFNAYPATGSFSRSALKAKCNVKTPLSG+F+G
Sbjct: 450 KAFGRVNGYKVVPDQELIAIGVTNLISTFFNAYPATGSFSRSALKAKCNVKTPLSGIFTG 509

Query: 491 ACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILL 550
           ACVLL+LY LT AFY+IPKAALSA+IIHAV DL+ASYK ++  W  NP D + F+ T+++
Sbjct: 510 ACVLLSLYCLTDAFYFIPKAALSAIIIHAVSDLVASYKTTWNFWLMNPLDFVCFIVTVII 569

Query: 551 TIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPEL 610
           TIFSSIENGIYFAV +S A LL+K  FP+G+FLGYV+I +VSN  V E++D I  ++   
Sbjct: 570 TIFSSIENGIYFAVCWSCALLLLKVVFPTGQFLGYVEICQVSNAEVDENIDRIVLSEDSQ 629

Query: 611 PQEISKD-SKLAKDPDVHASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGV 669
           P+ I  + +K      V   AN       +++HTKW+PL+N Y RELNP++ V  PPPGV
Sbjct: 630 PKTIEDNVTKNNTAVKVGVVANESFGHSQLQYHTKWLPLNNHYQRELNPDVVVQAPPPGV 689

Query: 670 IVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKF 729
           IVYRP+ESW Y+NCSRQ+D I DRVK LTRPGKL+ H+ K +++W +PG+W PP  ++K 
Sbjct: 690 IVYRPSESWTYVNCSRQYDTIFDRVKELTRPGKLLKHVSKHDKMWNDPGEWEPPFLVKKL 749

Query: 730 FK-KYRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQV 788
           FK   +H     EV   +D RPVLKILAMDW+QVT +DST +Q+L+DLRK IN+YA+RQV
Sbjct: 750 FKLGNKHDLEGGEV---IDERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAINKYANRQV 806

Query: 789 GFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEENQQNSEIS 848
            FHFSGI+SPWIKR+L++AGFGT+NE +S++ +++ +++Y +V+N     +      E  
Sbjct: 807 EFHFSGIISPWIKRSLINAGFGTVNEEFSDESIIVGHTSYSLVKNRPDLQDPEAALPE-P 865

Query: 849 ASLDVASGTNFPFFHIDMPDFTKWDI 874
            +L  A G N PFFH++MP+F KW +
Sbjct: 866 IALHTALGVNLPFFHLEMPEFHKWHL 891

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/860 (52%), Positives = 598/860 (69%), Gaps = 33/860 (3%)

Query: 35  QDTSGLDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSVGSSLQFAKYDGNALPDF-- 92
           Q+ + ++  E++Y  ++ +E +    G  N      K   V SS Q      N L D   
Sbjct: 13  QEDADIEVFESEYRTYRESEAAENRDGLHNGDEENWK---VNSSKQKFGVTKNELSDVLY 69

Query: 93  -KAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGI 151
              P Y E+TVT  EYYD +I++ +             PIIKW  HYNF W Y+D +AGI
Sbjct: 70  DSIPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVSLFPIIKWFPHYNFTWGYADLVAGI 129

Query: 152 TVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVI 211
           TVGCVLVPQSMSYAQ+A L PEYGLYSSFIGAFIYS FATSKDVCIGPVAVMS+Q +KVI
Sbjct: 130 TVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVI 189

Query: 212 SHVIDQLPEG-TPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSAL 270
           + V+ + PE  T +TAP++A+ L L   I+   +G+LRLGF++ELIS+ AVAGFMTGSA 
Sbjct: 190 AEVLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGILRLGFLVELISLNAVAGFMTGSAF 249

Query: 271 SILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGY 329
           +I+  Q+P+L+G    +NTR  TY+V+I+TLKHL  + ++A FGLI L +L+ WKW CG 
Sbjct: 250 NIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWWCGT 309

Query: 330 LGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVL 388
            G  L  +Y R   K A   +SF+FYAQA+RNA V+ + T +SW +   +  K   IS+L
Sbjct: 310 FGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNKSSKDRPISIL 369

Query: 389 GTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELI 448
           GTVPSGL  VGV  IP GL+  +  ++P ++I+L+LEHI I+KSFGRIN+YK+VPDQELI
Sbjct: 370 GTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVLEHIAISKSFGRINDYKVVPDQELI 429

Query: 449 AIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIP 508
           AIGVTNLIG+FF++YPATGSFSRSALKAKCNV+TP SG+F+G CVLLALY LT AF++IP
Sbjct: 430 AIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFFFIP 489

Query: 509 KAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSM 568
           KA LSAVIIHAV DL+ SYK ++  W TNP D ISF+ T+ +T+FSSIENGIYFA+ +S 
Sbjct: 490 KATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMCWSC 549

Query: 569 ATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQEISKDSKLAKDPDVHA 628
           A LL+K AFP+GKFLG V++ EV N  V ED+D++ +++ ELP E++K         V +
Sbjct: 550 AMLLLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAVISSN-ELPNELNK--------QVKS 600

Query: 629 SANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFD 688
           +  ++ +  + +F  KWVP D+GYSRELN    V  PPPGVIVYR  +S+ Y+NCSR +D
Sbjct: 601 TVEVLPAP-EYKFSVKWVPFDHGYSRELNINTTVRPPPPGVIVYRLGDSFTYVNCSRHYD 659

Query: 689 IIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVVE---- 744
           II DR+K  TR G+L+   +KS++ W +PG+W  P  L+  FK  RH A     +     
Sbjct: 660 IIFDRIKEETRRGQLITLRKKSDRPWNDPGEWKMPDSLKSLFKFKRHSATTNSDLPISNG 719

Query: 745 ----QVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWI 800
               +   +P+LK++ +D++QV  VDST++QSL+DLRK +NRYADRQV FHF+GI+SPWI
Sbjct: 720 SSNGETYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNRYADRQVEFHFAGIISPWI 779

Query: 801 KRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEENQQNSEISAS------LDVA 854
           KR+L+   FGT NE YS+D ++  +S++HV + +    +   ++S IS S      L  A
Sbjct: 780 KRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTDEDSRISTSYSNYETLCAA 839

Query: 855 SGTNFPFFHIDMPDFTKWDI 874
           +GTN PFFHID+PDF+KWD+
Sbjct: 840 TGTNLPFFHIDIPDFSKWDV 859

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/863 (51%), Positives = 603/863 (69%), Gaps = 40/863 (4%)

Query: 35  QDTSGLDELETDYTRFKTNE---DSAGYSGAENERSRID---KFDSVGSSLQFAKYDGNA 88
           Q+ + ++  E++Y  ++ +E   +   +   +++  +I+   K++   S +    YD   
Sbjct: 18  QEDTDIEVFESEYRTYRESEAAENRDNFQNGDDQSWKINGKQKYEVTKSEVSDVAYDS-- 75

Query: 89  LPDFKAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFI 148
                 P Y E+TVT  EYYD +I+S +             PIIKW+ HYNF W Y+D +
Sbjct: 76  -----IPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYSLFPIIKWLPHYNFTWGYADLV 130

Query: 149 AGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVS 208
           AGITVGCVLVPQSMSYAQ+A L PEYGLYSSFIGAFIYS FATSKDVCIGPVAVMS+Q +
Sbjct: 131 AGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTA 190

Query: 209 KVISHVIDQLPEG-TPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTG 267
           KVI+ V+ + PEG T +T P++A+AL     ++   +G+LRLGF++ELIS+ AVAGFMTG
Sbjct: 191 KVIAEVLKKYPEGQTEVTGPIIATALCFLCGVVSTALGVLRLGFLVELISLNAVAGFMTG 250

Query: 268 SALSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWT 326
           SA SI+  Q+P+L+G    +NTR  TY+V+I+TLKHL  + ++A FGLI L +L+ WKW 
Sbjct: 251 SAFSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVWKWW 310

Query: 327 CGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSI 385
           CG  G  L  +Y R   K A   +SF+FYAQA+RNA V+ + T +SW +   +  K+  I
Sbjct: 311 CGTFGITLADRYYRNQPKIANRLKSFYFYAQAMRNAVVIIVFTAISWRITRNKSSKERPI 370

Query: 386 SVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQ 445
           S+LGTVPSGL  VGV  IP GL+  +  +LP ++I+L+LEHI I+KSFGRIN+YK++PDQ
Sbjct: 371 SILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQ 430

Query: 446 ELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFY 505
           ELIAIGVTNLIG+FF++YPATGSFSRSALKAKCNV+TP SG+F+GACVLLALY LTSAF+
Sbjct: 431 ELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIFTGACVLLALYCLTSAFF 490

Query: 506 YIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVA 565
           +IPKA LSAVIIHAV DL+ SYK ++  W TNP D ISF+AT+ +T+FSSIENGIYFA+ 
Sbjct: 491 FIPKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISFIATVFITVFSSIENGIYFAMC 550

Query: 566 FSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQEISKDSKLAKDPD 625
           +S A LL+K AFP+GKFLG V++ EV N  V E ++++ +++ ELP E+SK  K   D  
Sbjct: 551 WSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEGINAVTSSN-ELPNELSKQVKSTVD-- 607

Query: 626 VHASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSR 685
                  +    + +F  KW+P D+ YSRELN    V  PPPGVIVYR  +S+ Y+NCSR
Sbjct: 608 -------VLPAPEYKFSVKWIPFDHDYSRELNRYTKVRPPPPGVIVYRLADSFTYVNCSR 660

Query: 686 QFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVV-- 743
            +DII DR+K  TR G+L++  +KS++ W +PG+W  P   +  FK  R  A     +  
Sbjct: 661 HYDIIFDRIKEETRRGQLISLRKKSDRPWNDPGEWKMPNSFKALFKFKRKSATTDNELPV 720

Query: 744 ------EQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVS 797
                 ++   +P+LK++ +D++QV  VDST++QSL+DLRK +N+YADRQV FHF+GI+S
Sbjct: 721 SSGRNNQESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIIS 780

Query: 798 PWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEENQQNSEISAS------L 851
           PWIKR+L+   FGT NE YS+D ++  +S++HV + +    +  +++S IS S      L
Sbjct: 781 PWIKRSLLSVKFGTTNEEYSDDSIIAGHSSFHVAKVLKDDVDYTEEDSRISTSYSNYETL 840

Query: 852 DVASGTNFPFFHIDMPDFTKWDI 874
             A+GTN PFFHID+PDF+KWD+
Sbjct: 841 CAATGTNLPFFHIDIPDFSKWDV 863

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/883 (51%), Positives = 612/883 (69%), Gaps = 48/883 (5%)

Query: 34  LQDTSG----LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSVG-------SSLQFA 82
            QDTS     LD+LE +Y ++K NE++  +   + E + + K ++VG       S +++ 
Sbjct: 17  FQDTSNTVPDLDDLELEYDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKGAKGSKIEYF 76

Query: 83  KYDGNALPDFKAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAW 142
                +L D     + E+TV+  EYYD +IRS +             PII W+ HYNF W
Sbjct: 77  NPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNW 136

Query: 143 MYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAV 202
             +D IAGIT+GCVLVPQSMSYAQ+A L  +YGLYSSFIGA+ YSFFATSKDVCIGPVAV
Sbjct: 137 FTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAV 196

Query: 203 MSVQVSKVISHVIDQLPEGTP-ITAPMVASALALFSSILVIPIGLLRLGFILELISVTAV 261
           MS+Q +KVI+ V  + P+G P IT P++A+ LAL   I+   IG LRLGF++ELIS+ AV
Sbjct: 197 MSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAV 256

Query: 262 AGFMTGSALSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALL 320
           AGFMTGSA +IL  Q+P+L+G    +NTR  TY+V+I TLKHL  + ++A FGLI L LL
Sbjct: 257 AGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLL 316

Query: 321 FFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-GRH 379
           + WKW CG  GP L  +Y   N +  +I +  +FYAQA RN  ++ + T + W +  G+ 
Sbjct: 317 YVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKS 376

Query: 380 KKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNY 439
           K +  IS+LG+VPSGLK VGV  +PSGL+ KL P LP ++I+LLLEHI I+KSFGRIN+Y
Sbjct: 377 KSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDY 436

Query: 440 KIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYY 499
           K+VPDQELIAIGV+NL+G+FFNAYPATGSFSRSALKAKCNV+TPLSGLFSG+CVLLALY 
Sbjct: 437 KVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYC 496

Query: 500 LTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENG 559
           LT AF+YIPKA LSAVIIHAV DL+ASY+ ++  W  NP D I F+ T+L+T+F+SIE+G
Sbjct: 497 LTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDG 556

Query: 560 IYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIG----NND----PELP 611
           IYFA+ +S A LL+K AFP+GKFLG V+I EV++  +  + D++     NN+     E  
Sbjct: 557 IYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEG 616

Query: 612 QEISKDS--KLAKDPDVHASANLMASKLD----------VRFHTKWVPLDNGYSRELNPE 659
            E  KDS  K   +       N+     D          +++HTKWVP D+ Y+RELNP+
Sbjct: 617 DEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPD 676

Query: 660 IAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGD 719
           I +  PP GV+VYR +ES+ YLNCSR ++II ++VK +TR G+L+ H +KS++ W +PG 
Sbjct: 677 IQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGP 736

Query: 720 WVPPLFLR--KFFKK------YRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQ 771
           W  P FL+  KF+KK      +   A    +  + D+RP+LKIL +D++QV   D+T++Q
Sbjct: 737 WEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQ 796

Query: 772 SLIDLRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVV 831
           SL+DLRK IN+YADRQV FHF GI+SPW+KR LV  GFGT+NE YS++ ++  +++YHV 
Sbjct: 797 SLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVA 856

Query: 832 QNVLSADEENQQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874
           +       ++++NS+   S+  ASGTN PFFHID+PDF KWDI
Sbjct: 857 RV-----PQSKENSD-KYSVYTASGTNLPFFHIDIPDFAKWDI 893

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/876 (51%), Positives = 608/876 (69%), Gaps = 50/876 (5%)

Query: 40  LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSV-------GSSLQFAKYDGNALPDF 92
           LD+LE +Y ++K NE++  ++  + E + + K ++V       GS + +      +L D 
Sbjct: 27  LDDLELEYDQYKNNENNDTFNDKDLESNSVAKHNAVNSSKGVKGSKIDYFNPSDVSLYDN 86

Query: 93  KAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGIT 152
               + ETTV+  EYYD +IRS +             PII W+ HYNF+W  +D IAGIT
Sbjct: 87  SVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLKSVFPIINWLPHYNFSWFTADLIAGIT 146

Query: 153 VGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVIS 212
           +GCVLVPQSMSYAQ+A L  +YGLYSSFIGA+ YSFFATSKDVCIGPVAVMS+Q +KVI+
Sbjct: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIA 206

Query: 213 HVIDQLPEG-TPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALS 271
            V  + P+G + IT P++A+ LAL   I+   +G LRLGF++ELIS+ AVAGFMTGSA +
Sbjct: 207 DVTAKYPDGDSAITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFN 266

Query: 272 ILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYL 330
           IL  Q+P+L+G    +NTR  TY+V+I TLKHL  + ++A FGLI L LL+ WKW CG  
Sbjct: 267 ILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTY 326

Query: 331 GPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVLG 389
           GP+L  +Y   N +  +I +  +FYAQA RN  ++ + T + W +  G+ K +  IS+LG
Sbjct: 327 GPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILG 386

Query: 390 TVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIA 449
           +VPSGLK VGV  +P GL+ KL P LP ++I+LLLEHI I+KSFGRIN+YK+VPDQELIA
Sbjct: 387 SVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIA 446

Query: 450 IGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPK 509
           IGV+NL+G+FFNAYPATGSFSRSALKAKCNV+TPLSGLFSG+CVLLALY LT AF+YIPK
Sbjct: 447 IGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPK 506

Query: 510 AALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMA 569
           A LSAVIIHAV DL+ASY+ ++  W  NP D I F+ T+L+T+F+SIE+GIYFA+ +S A
Sbjct: 507 ATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCA 566

Query: 570 TLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSI----------------GNNDPELPQE 613
            L++K AFP+GKFLG V++ EV++  V  D D +                G +D E   +
Sbjct: 567 MLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSENNNGISTLEDGGEDDKESSTK 626

Query: 614 ISKDSKLAKDPDVHA----SANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGV 669
              +S    + +V      S +   S+  +++HTKW+P D+ Y+RELNP++ +  PP GV
Sbjct: 627 YVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHTKWIPFDHKYTRELNPDVQILPPPDGV 686

Query: 670 IVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLR-- 727
           +VYR +ES+ YLNCSR ++II + VK +TR G+L+ H +KS++ W +PG W  P FL+  
Sbjct: 687 LVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNL 746

Query: 728 KFFKKYRHKAAKPEVVE---------QVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRK 778
           KF+KK   +   PE +E         + D+RP+LKIL +D++QV   D+T++QSL+DLRK
Sbjct: 747 KFWKK---RENDPESMENAPSTSVDVERDDRPLLKILCLDFSQVAQTDATALQSLVDLRK 803

Query: 779 TINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSAD 838
            IN+YADRQV FHF GI+SPW+KR L+  GFGT+NE YS++ ++  +++YHV +  +   
Sbjct: 804 AINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEEYSDESIVAGHTSYHVAR--VPQG 861

Query: 839 EENQQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874
           EEN +      S+  ASGTN PFFHID+PDF KWDI
Sbjct: 862 EENPEK----YSVYTASGTNLPFFHIDIPDFAKWDI 893

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/869 (51%), Positives = 614/869 (70%), Gaps = 47/869 (5%)

Query: 28  DNNNRGLQDTSGLDELE------TDYTRFKTNEDSAGYSGAENERSRIDKFDSVGSSLQF 81
           +  N  + D+SG D+L       T  ++F   +D  GY+   NE +R    +S  +    
Sbjct: 23  EQGNSDVGDSSGNDDLGNAGDGLTKDSKFVFEKD-LGYTDDSNELTRESFLNSSEN---- 77

Query: 82  AKYDGNALPDFKAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFA 141
                        P Y E TVT  EYY+ +IR  +             PIIKW+  YN+ 
Sbjct: 78  ------------VPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYK 125

Query: 142 WMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVA 201
           W+ SD IAGIT+GCVLVPQSMSYAQ+A L P+YGLYSSF+GA+ YS FATSKDVCIGPVA
Sbjct: 126 WLISDLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVA 185

Query: 202 VMSVQVSKVISHVIDQLPE--GTPITAPMVASALALFSSILVIPIGLLRLGFILELISVT 259
           VMS+Q +KVI HV   L E   T ITAP++A+ LAL   I+   +GLLRLGF++ELIS+ 
Sbjct: 186 VMSLQTAKVIQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLN 245

Query: 260 AVAGFMTGSALSILASQLPSLLG-IQKINTRVETYRVLISTLKHLNGSDINAAFGLICLA 318
           AV GFMTGSAL+I++ Q+P+L+G   ++NTR  TY+V+I+TLKHL  + I+A FGLI L 
Sbjct: 246 AVTGFMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLV 305

Query: 319 LLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-G 377
           +L+FWKW    +GPKL+ +Y  PNSK  +  ++F+FY  A+R+  ++ + T +SW V  G
Sbjct: 306 ILYFWKWWFSSMGPKLVDRYY-PNSKYKKYIKAFYFYGNAMRSGIIIIVMTSISWSVTRG 364

Query: 378 RHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRIN 437
           + K +  IS+LGTVPSGL+ VGV T P+GL+ K+ P+LP ++I+LLLEHI IAKSFGR+N
Sbjct: 365 KSKSERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVN 424

Query: 438 NYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLAL 497
           +YK+VPDQELIAIG++NLIG+FFN+YP TGSFSRSALKAKCNVKTPLSG+F+G+CVLLAL
Sbjct: 425 DYKVVPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLAL 484

Query: 498 YYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIE 557
           Y LT AF+YIPKA LSAVIIHAV DL+ASYK ++  W  NP D I F+ T+ +T+F+SIE
Sbjct: 485 YCLTGAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIE 544

Query: 558 NGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQEISKD 617
           +GIYF + +S A LL K AFP+GKFLGYVKI E+ N  +  D D +     E  +   + 
Sbjct: 545 DGIYFTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEIV-DSDYL----VEKAETSVQY 599

Query: 618 SKLAKDPD--VHASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPT 675
           S +  +P+    +  +  +S+  +++H KW+P D+ Y++E+NP + V  PP GVIVYR T
Sbjct: 600 STVLMNPEKGELSYLSSKSSESQLKYHIKWIPYDHAYTKEMNPNVEVTPPPDGVIVYRLT 659

Query: 676 ESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKF--FKKY 733
           ES+ Y+NCSR ++ + D+VK LTRPG+L+ H++KS++ W +PGDW PP FL+    ++K 
Sbjct: 660 ESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWKPPKFLKNIINWRKN 719

Query: 734 RHKAAKPEVVEQ--VDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFH 791
           ++K  +P   +   VD RP+LKI+ +D++QV   DST++QSL+DLR+ IN+YADRQV FH
Sbjct: 720 KNKDDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSLLDLRRAINKYADRQVEFH 779

Query: 792 FSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQ------NVLSADEENQQNS 845
           FSGI+SPW+K+ LV+ GFGT+N+ YS++ +++ +++YHVV+      N ++  EE  QNS
Sbjct: 780 FSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKTEDLENNPMTTVEEPNQNS 839

Query: 846 EISASLDVASGTNFPFFHIDMPDFTKWDI 874
             S  +   +GTNFPFFHI++PDF+KW+I
Sbjct: 840 --SYYIHAGTGTNFPFFHIEIPDFSKWNI 866

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/873 (50%), Positives = 606/873 (69%), Gaps = 44/873 (5%)

Query: 40  LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSV-------GSSLQFAKYDGNALPDF 92
           LD+LE +Y ++K NE++  +S  + E + +   ++V       GS +++      +L D 
Sbjct: 27  LDDLELEYDQYKNNENNGVFSDNDLESNSVANRNAVNDAKGVKGSKIEYFDPSDVSLYDN 86

Query: 93  KAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGIT 152
               + E+ V+  EYY+ +IRS +             PII W+ HYNF W  +D IAGIT
Sbjct: 87  SVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLKSVFPIINWLPHYNFNWFIADLIAGIT 146

Query: 153 VGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVIS 212
           +GCVLVPQSMSYAQ+A L  +YGLYSSFIGA+ YSFFATSKDVCIGPVAVMS+Q +KVI+
Sbjct: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIA 206

Query: 213 HVIDQLPEG-TPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALS 271
            V  + P+G T IT P++A+ LAL   I+   +G LRLGF++ELIS+ AVAGFMTGSA +
Sbjct: 207 EVQAKYPDGDTTITGPVIATTLALLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFN 266

Query: 272 ILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYL 330
           IL  Q+P+L+G  K +NTR  TY+V+I TLKHL  + ++A FGLI L LL+ WKW CG  
Sbjct: 267 ILWGQVPALMGYNKLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTY 326

Query: 331 GPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVLG 389
           GP+L  +Y   N++  +I +  +FYAQA RN  ++ + T + W +  G+   +  IS+LG
Sbjct: 327 GPRLNDRYNSKNARLHKIVKWTYFYAQASRNGIIIIVFTCIGWAITRGKSSSERPISILG 386

Query: 390 TVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIA 449
           +VPSGLK VGV  +PSGL+ KL P LP ++I+LLLEHI I+KSFGRIN+YK+VPDQELIA
Sbjct: 387 SVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGRINDYKVVPDQELIA 446

Query: 450 IGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPK 509
           IGV+NL+G+FFNAYPATGSFSRSALKAKCNV+TPLSGLFSG+CVLLALY LT AF+YIPK
Sbjct: 447 IGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPK 506

Query: 510 AALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMA 569
           A LSAVIIHAV DL+ASY+ ++  W  NP D I F+ T+L+T+F+SIE+GIYFA+ +S A
Sbjct: 507 ATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCA 566

Query: 570 TLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSI----------------GNNDPELPQE 613
            LL+K AFP+GKFLG V+I EV++  V  D D++                G ++ E+  +
Sbjct: 567 MLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAVSYVSENNNRISTLEENGEDEKEISAK 626

Query: 614 ISKDSKLAKDPDVH----ASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGV 669
              +S    + +V     AS +    +  +++HTKW+P D+ Y+RELNP++ +  PP  V
Sbjct: 627 YITNSSKKIETNVQTKGFASPSSSIGQPRIKYHTKWLPFDHKYTRELNPDVHILPPPESV 686

Query: 670 IVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLR-- 727
           +VYR +ES+ YLNCSR ++II+D VK  TR G+++ H +KS++ W +PG W  P FL+  
Sbjct: 687 LVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQIIRHRKKSDRPWNDPGPWEAPAFLKNL 746

Query: 728 KFFKK------YRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTIN 781
           KF+KK      +   A    +  + D RP+LKIL +D++QV   D+T++QSL+DLRK IN
Sbjct: 747 KFWKKKESDLEFTQNAPNNSIDAERDERPLLKILCLDFSQVAQTDATALQSLVDLRKAIN 806

Query: 782 RYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEEN 841
           +YADRQV FHF GI+SPW+KR L+  GFGTINE YS++ ++  +++YHV +        N
Sbjct: 807 QYADRQVEFHFVGIISPWVKRGLISRGFGTINEEYSDESIVAGHTSYHVARV-----PRN 861

Query: 842 QQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874
           ++N +   S+  ASGTN PFFHID+PDF KWDI
Sbjct: 862 KENPD-KYSVYTASGTNLPFFHIDIPDFAKWDI 893

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/882 (51%), Positives = 601/882 (68%), Gaps = 60/882 (6%)

Query: 40  LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDS-----VGSSLQFAKYDGNALPDFKA 94
           LD+L+ +Y +FK  E S   +G +       +F +      GS          A P   A
Sbjct: 30  LDDLDAEYGQFKNAEHSDATAGRDLTSEYGAQFAAEFGGEPGSGSGSGSGFPEAKPVAPA 89

Query: 95  PP---------YYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYS 145
            P         ++E  VT  E+Y + +RS               PI++W+ HYN  W+Y 
Sbjct: 90  APGNVPSALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQ 149

Query: 146 DFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSV 205
           D +AGITVGCVLVPQSMSYAQ+A L P+YGLYSSF+GAFIYSFFATSKDVCIGPVAVMS+
Sbjct: 150 DLVAGITVGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSL 209

Query: 206 QVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFM 265
           Q +K ISHV+  LPE T IT+PM+A+ALAL   I+ + +G+LRLGF++ELIS TAVAGFM
Sbjct: 210 QTAKAISHVVSSLPEDTEITSPMIATALALLCGIISLGLGVLRLGFLVELISSTAVAGFM 269

Query: 266 TGSALSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWK 324
           TGSAL+I+A Q+P+L+G  K +NTR  TY+V+I++L+HL  + ++A FGL+ L +L+ WK
Sbjct: 270 TGSALNIIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWK 329

Query: 325 WTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHKKK-- 382
           W C   GP+L+ +Y    S+++R+W + F Y QALRNA V+ + T ++W +  R  K+  
Sbjct: 330 WGCSTGGPRLVQRY---GSRRSRMWDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGG 386

Query: 383 -TSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKI 441
              IS+LGTVPSGLK VGV  +PSGL+ K+ P+LP +VI+L+LEHI I+K+FGR+N+Y++
Sbjct: 387 SARISLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRV 446

Query: 442 VPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLT 501
           VPDQELIAIG TNLIG+FFNAYPATGSFSRSALKAKCNV TPLSGLFSGACVLLA+Y LT
Sbjct: 447 VPDQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLT 506

Query: 502 SAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIY 561
           SAF +IPKA LSAVIIHAV DLIASYK ++  W  +P DL+ FL T+++T+FSSIENGIY
Sbjct: 507 SAFKFIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIY 566

Query: 562 FAVAFSMATLLMKNAFPSGKFLGYVKITE--VSNLNVFEDLD-SIGNN-----DPELPQE 613
           FA+ +S+A LL + AFP+GKFLG V+I E  V+N      +  S GN+     + E  +E
Sbjct: 567 FAMCWSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGAGVGMSSGNSAGTAVNREKERE 626

Query: 614 -------ISKDSKLAKDPDVHASANLM---------------ASKLDVRFHTKWVPLDNG 651
                  +S +S     P    +AN                  S    RFHTKWVP D  
Sbjct: 627 TTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFDR- 685

Query: 652 YSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSE 711
           Y+RELNPE+ V  PPPGVIV+RP+ESW Y+NCSRQ+D I D V  LTR G+     + S 
Sbjct: 686 YTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKSSS 745

Query: 712 QLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQ 771
           + W +PG+W PP FLRK FK          V    D RPVL+++AMDW+QV  VDST +Q
Sbjct: 746 RPWNDPGEWHPPKFLRKLFKSSSEDLENRAVAR--DERPVLRVIAMDWSQVAQVDSTGLQ 803

Query: 772 SLIDLRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVV 831
           +L DLRK +N+YADRQV FHF+GI+ PW+KR L+++GFGT+N+ ++++ LL+ + + H+ 
Sbjct: 804 TLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESLLVGHKSCHIA 863

Query: 832 QNVLSADEENQQNSEISASLDVASGTNFPFFHIDMPDFTKWD 873
           +   SA+    + S ++     A+GTN PFFH+++PDF++WD
Sbjct: 864 R---SAEPTEDEESRLAHP---ATGTNLPFFHLELPDFSEWD 899

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/858 (50%), Positives = 598/858 (69%), Gaps = 30/858 (3%)

Query: 40  LDELETDYTRFKTNE----DSAGYSGAENERSRIDKFDSVGSSLQFAKYDGNALPDF--- 92
           LD+LE +Y  +K NE    +    +G+E++       D V  +    +Y G+  P+    
Sbjct: 17  LDDLEAEYDLYKANEQLEDNEVTVNGSEDDYGNKKGIDLVKETE--VRYYGSPGPEAIGG 74

Query: 93  KAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGIT 152
             P + E+TV+  +YY++ IR ++             PI+KW  HYN  W Y+D +AGIT
Sbjct: 75  NIPGFEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGIT 134

Query: 153 VGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVIS 212
           VGCVLVPQSMSYAQ+A L P+YGLYSSFIGAFIYS FATSKDVCIGPVAVMS+Q +KVI+
Sbjct: 135 VGCVLVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 194

Query: 213 HVIDQLPEGTPI-TAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALS 271
            V  + PE  PI TAP++A+AL+L   I+ I +GLLRLGF++ELIS+ AVAGFMTGSA +
Sbjct: 195 QVSAKYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFN 254

Query: 272 ILASQLPSLLGIQ-KINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYL 330
           IL  Q+P+L+G   K+NTR  TY+V+I +LKHL  + ++A FGL+ L LL+ WKW CG  
Sbjct: 255 ILWGQVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTY 314

Query: 331 GPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVLG 389
           GPKL  + L  + KK RI + F+FY+ A+RNA ++ + T +SW +   + K+   I VLG
Sbjct: 315 GPKLADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLG 374

Query: 390 TVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIA 449
           TVPSGL+ VGV  IP GL+ K+ P +P ++I+LLLEHI I+KSFGRIN+YK+VPDQELIA
Sbjct: 375 TVPSGLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELIA 434

Query: 450 IGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPK 509
           IG TNLIG+FFNAYPATGSFSRSALKAKC V+TP SG+F+G CVL+A+Y LT AF++IP 
Sbjct: 435 IGATNLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPS 494

Query: 510 AALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMA 569
           A LSAVIIHAV DL+ASYK ++  W  NP D  +F+ T+L+T+FSSIENGIYFA+ +S A
Sbjct: 495 ATLSAVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCA 554

Query: 570 TLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQEISKDSKLAKDPDVHAS 629
            LL+K+AFP+G+FLG V++ EV N  V ED+++I  ND ++   + K   L  D      
Sbjct: 555 MLLLKHAFPAGQFLGRVEVAEVINPTVVEDVEAISIND-QIEGSVGKSKSLKAD----KG 609

Query: 630 ANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDI 689
           A   +S  + +FH+KWV     Y+RELNP++ +  PPPGV+VYR ++S+ Y+NCSR +D 
Sbjct: 610 AISASSGSNYKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYRMSDSFTYINCSRHYDT 669

Query: 690 IVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVVEQ---- 745
           I D +K  TR G+L++  +KS++ W +PG+W     ++KFFK  +      E  ++    
Sbjct: 670 IFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLGKKNQNDIESQDEDVAI 729

Query: 746 ---VDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKR 802
               D RP+LKI+ +D++QV  VDST+IQSL+DLRK +++YADRQV FHF+GI+S W+KR
Sbjct: 730 DNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYADRQVEFHFTGIISSWVKR 789

Query: 803 ALVHAGFGTINENYSNDPLLLKYSTYHVVQNV------LSADEENQQNSEISASLDVASG 856
           +L+  GFGT+N +YS++ ++  +S+YH+ +         + D       + S  +  A+G
Sbjct: 790 SLLSMGFGTVNASYSDESIIAGHSSYHIAKTTKPLADDFTTDSSGSSQLQQSQEIYAATG 849

Query: 857 TNFPFFHIDMPDFTKWDI 874
           TN PFFH+D+PDF+KWD+
Sbjct: 850 TNMPFFHLDIPDFSKWDL 867

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/878 (52%), Positives = 596/878 (67%), Gaps = 55/878 (6%)

Query: 30  NNRGLQDTSGLDELETDYTRFKTNEDSA-GYSGAENERSRIDKFDSVGSSLQFAKYDGNA 88
           +N   Q +  LD+L+ +Y  FK  E S  G   + N  + +     VG+S +  + D N 
Sbjct: 2   SNLERQTSLDLDDLDAEYGHFKNTEHSEIGGGPSSNPGAAV----GVGASTKLGQ-DQNG 56

Query: 89  ---------------LPDFKAP-PYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPII 132
                          L  + +P  YYE  VTF EYYD TIR  +             P+I
Sbjct: 57  DKSGATGGGNGANEPLALYDSPEAYYEDKVTFREYYDTTIRPSLTASNVRQYLRDLLPVI 116

Query: 133 KWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATS 192
            W+ HYN  W Y D +AGITVGCVLVPQSMSYA +A L P++GLYSSF+GA IYSFFATS
Sbjct: 117 NWLPHYNGRWFYQDMVAGITVGCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATS 176

Query: 193 KDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLRLGFI 252
           KDVCIGPVAVMS+Q +K +S V+ +LP  T ITAP+VA+ALA    ++ + +G+LRLGF+
Sbjct: 177 KDVCIGPVAVMSLQTAKAVSKVMAELPADTDITAPVVATALAFLCGLISLGLGVLRLGFL 236

Query: 253 LELISVTAVAGFMTGSALSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAA 311
           +ELIS TAVAGFMTGSAL+I++ QLP+L+G  K +NTR  TY+V+I TLKHL  + ++A 
Sbjct: 237 VELISSTAVAGFMTGSALNIISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAV 296

Query: 312 FGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFV 371
           FGLI L +L+ WKW C   GP+L+ +Y    S+K RIW +  FY QALRNA ++ + T +
Sbjct: 297 FGLIPLVMLYTWKWLCNSGGPRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAI 356

Query: 372 SWLVIGRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAK 431
           +W  I  HKKK  IS+LG VPSGLK VGV  +P GL  K+ P+LP +VI+LLLEHI IAK
Sbjct: 357 AW-SISHHKKKAPISLLGPVPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAK 415

Query: 432 SFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGA 491
           +FGR+N+Y++VPDQELIAIG TNL+G+FFNAYPATGSFSRSALKAKCNV TPLSG+FSGA
Sbjct: 416 AFGRVNDYRVVPDQELIAIGATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGA 475

Query: 492 CVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLT 551
           CVLLA+Y LTSAF YIPKA LSAVIIHAV DLIASYK ++ +W  NP DL+ FLAT+ + 
Sbjct: 476 CVLLAIYCLTSAFQYIPKATLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIA 535

Query: 552 IFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELP 611
           +FSSIENGIYFA+ +S+A LL K AFP  +FLG V+I E++      +  S G+    L 
Sbjct: 536 VFSSIENGIYFAMCWSVAVLLFKVAFPRAQFLGRVEIAELAT----NEGVSAGSEFAPLS 591

Query: 612 QEISKDSKLAKDPDVHASANLMASKLDVR----------------FHTKWVPLDNGYSRE 655
           ++  K   ++      +S +  A K  +                 FHTKWVP +  Y+RE
Sbjct: 592 KDFEKGKGVSYASGSVSSESFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFEP-YTRE 650

Query: 656 LNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWC 715
           LNP++ V  PPPGVIV+RP+ESW Y+NC+RQ++ I D V   TR GK V    KS + W 
Sbjct: 651 LNPQVPVAQPPPGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWN 709

Query: 716 EPGDWVPPLFLRKFFKKYRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQSLID 775
           +PG+W PP FLRK+F K   ++ +  VV   D+RPVL+++AMDW+QV  VDST +Q+L D
Sbjct: 710 DPGEWHPPKFLRKWFGKKYSESLEQGVVS--DDRPVLRVIAMDWSQVAQVDSTGLQTLHD 767

Query: 776 LRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVL 835
           LRK +++YADRQV FHFSGI+SPWIKR L++ GFGT+NE ++++ LL+ + TY V +   
Sbjct: 768 LRKAVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVARGGA 827

Query: 836 SADEENQQNSEISASLDVASGTNFPFFHIDMPDFTKWD 873
           + DEE             A+G N PFFH +MPDF+KWD
Sbjct: 828 TGDEEALLPQP-------ATGVNMPFFHAEMPDFSKWD 858

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/924 (49%), Positives = 623/924 (67%), Gaps = 60/924 (6%)

Query: 2   FILRENSDGIESQASTISD-TQNLRTVDNNNRGLQDTSGLDELETDYTRFKTNEDSAGYS 60
           F  RE+ + + +    I + T N+ +  N+      T  LD+LE +Y ++K +E +    
Sbjct: 9   FNTRESENDLSNDQYEIPNYTSNIPSSGNS------TQNLDDLELEYDQYKVSETNNNDD 62

Query: 61  GAENERSRIDKFDSVGS-------SLQFAKYDGNALPDFKA---------PPYYETTVTF 104
              N  +  +  +++          +QF+    N    ++          P Y E TV+ 
Sbjct: 63  VINNNNNNNNNNNNIPELETQQNLDVQFSNTTNNKENQYRIVSTVNPVIIPNYDEKTVSI 122

Query: 105 MEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSY 164
            +YYD +IR  V             PI +W+ HYN  W  SD IAGITVGCVLVPQSMSY
Sbjct: 123 KDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITVGCVLVPQSMSY 182

Query: 165 AQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTP- 223
           AQ+A L  +YGLYSSFIGAF YS FATSKDVCIGPVAVMS++ +KV++ V+ + P+  P 
Sbjct: 183 AQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTKVLAKYPDNDPT 242

Query: 224 ITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLGI 283
           ITAP+VA+AL+L   I+   +G+LRLGF++ELIS+ AV GFMTGSAL+IL  Q+P L+G 
Sbjct: 243 ITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNILWGQVPGLMGY 302

Query: 284 Q-KINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPN 342
             K+NTR   Y+V+I TLKHL  + ++A FGLI L LL+ WKW C  +GPKL+ K+  P 
Sbjct: 303 NSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMGPKLVDKWF-PK 361

Query: 343 SKKARI---WQSFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVLGTVPSGLKHV 398
           +K  R    ++ F+FYAQA +NA ++ + T +SW +  G+ K    IS+LGTVP GLK V
Sbjct: 362 NKNERANFYFKKFYFYAQAAKNAIIIIVFTAISWSITRGKAKADRPISILGTVPKGLKEV 421

Query: 399 GVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGS 458
           GV  +P GL+ KL P+LP +VI+LLLEHI IAKSFGRIN+YK+VPDQELIAIGVTNLIG+
Sbjct: 422 GVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGT 481

Query: 459 FFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIH 518
           FFNAYPATGSFSRSALKAKC V+TPLSG+F+GACVLLALY LT AF+YIPKA LSAVII 
Sbjct: 482 FFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIPKATLSAVIIQ 541

Query: 519 AVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFP 578
           AV DLIASYK+++  W  NP D + FL T+ +T+FSSIENGIYFAV +S A LL+K  FP
Sbjct: 542 AVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSCAILLLKVCFP 601

Query: 579 SGKFLGYVKITEVSNLNVFEDLDS------------IGNNDPELPQEISKDSKLAKDPDV 626
           +GKFLG +++ EV +  V   ++S              +N+ +  ++I K S ++   D 
Sbjct: 602 AGKFLGRIEVAEVIDGYVDNSIESATTAEYSSASSPSSDNETDT-KKIQKTSSISFGKDA 660

Query: 627 HASANLMASKLD----VRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLN 682
            A A +  S +D    VR++TKWVP D+ Y+RELNP + +  PPPGVIVYR T+S+ Y+N
Sbjct: 661 KAVA-VSTSPVDCNPKVRYYTKWVPFDHAYTRELNPSVNILPPPPGVIVYRLTDSFTYIN 719

Query: 683 CSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAKPEV 742
           CSR +D+I D VK  TR G+L+ H +K+++ W +PG+W  P FL+  F + +  +   E 
Sbjct: 720 CSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKNLFHRKKKNSTDEES 779

Query: 743 VEQV-------DNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGI 795
              V       DNRP+LKI+ +D++QV  +D+++IQSL+DLRK+INRYADRQV FHF+GI
Sbjct: 780 AVDVSDNSSIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKSINRYADRQVEFHFAGI 839

Query: 796 VSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSAD---EENQQNSEISASLD 852
           VSPW+KR L++ GFGTIN+ +S+  ++  +S+YH+ + +  +D   E N +++   +   
Sbjct: 840 VSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDFDLESNFRDTYSRSQYH 899

Query: 853 V--ASGTNFPFFHIDMPDFTKWDI 874
           V  A+GTN PFFHID+PDF+KWD+
Sbjct: 900 VFAATGTNLPFFHIDIPDFSKWDL 923

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/883 (49%), Positives = 596/883 (67%), Gaps = 46/883 (5%)

Query: 29  NNNRGLQDTSGLDELETDYTRFKTNE----DSAGYSGAENERSRIDKFDSVGSSLQFAKY 84
           NN   +  T  LD LE +Y ++K +E     +   + A+ +R +I        S++ +  
Sbjct: 26  NNANEVSSTPDLDNLELEYDQYKADELHPQRTILSNQADTDREKIANVFVEEQSVRDSNI 85

Query: 85  DGNALPDFK-----------APPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIK 133
              ++ + +            P Y E  VT +E+++ ++RS+              PII 
Sbjct: 86  PSASIEELQYFAHESDGAKVIPSYVEGNVTELEFFNHSLRSKFTLNAAKNYILSIFPIIH 145

Query: 134 WIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSK 193
           W+ HYN  W   D IAGITVGCVLVPQSMSYAQ+A L P+YGLYSSFIGAFIYS FATSK
Sbjct: 146 WLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFIYSLFATSK 205

Query: 194 DVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLRLGFIL 253
           DVCIGPVAVMS++ +K+I+ V+ + P    +  P++A+  AL    +   +G LRLGF++
Sbjct: 206 DVCIGPVAVMSLETAKIIARVMKRFPNDPDVQGPIIATTTALLCGGIAAGVGFLRLGFLV 265

Query: 254 ELISVTAVAGFMTGSALSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAF 312
           ELIS+ AVAGFMTGSAL+I++ Q+P+L+G  K +NTR  TY+V+++TLKHL  + ++A F
Sbjct: 266 ELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYKVIVNTLKHLPDTKLDAVF 325

Query: 313 GLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVS 372
           GLI L +L+FW+W C   GPKL  +Y    S+   +W+ F+FYAQA R+  ++ + T +S
Sbjct: 326 GLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYFYAQASRSGIIIIVFTAIS 385

Query: 373 WLVIGRH--KKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIA 430
           W  I RH   K+  IS+LGTVP GLK VG   +P  L  K+ P+LP AVI+LLLEHI I+
Sbjct: 386 W-SITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAPELPAAVIVLLLEHIAIS 444

Query: 431 KSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSG 490
           KSFGRIN+YK+VPDQELIAIGVTNLIG+FF+AYP TGSFSRSALKAKCNVKTPLSGLF+G
Sbjct: 445 KSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSALKAKCNVKTPLSGLFTG 504

Query: 491 ACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILL 550
           +CVLLALY LT AF+YIPKA LSAVIIH+V DL+ASY  ++  +  NP D + FL TI++
Sbjct: 505 SCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNFYKMNPLDFVCFLTTIII 564

Query: 551 TIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPEL 610
           T+FSSIENGIYFA+ +S A LL K AFP+GKFLG V+I EV +  +  D   +   D + 
Sbjct: 565 TVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVDGEIINDNSVVMTTD-DC 623

Query: 611 PQEISKDSKLAKDPDVHASANLMASKLD------------VRFHTKWVPLDNGYSRELNP 658
             E   + + +KD     S  ++  KLD            ++++TKWVP D+ Y+RELNP
Sbjct: 624 VSEFGGNKEFSKDKLNGKSDFIVKDKLDSTASSSSIAENKLKYYTKWVPFDHAYTRELNP 683

Query: 659 EIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPG 718
           ++ +  PPPGVIVYR ++S+ Y+N S  +DII+D +K +TR G+L+ H +KS++ W +PG
Sbjct: 684 DVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDEIKRVTRRGQLLQHRKKSDRPWNDPG 743

Query: 719 DWVPPLFLRKFF----KKYRHKAAKPEVVEQ---VDNRPVLKILAMDWTQVTHVDSTSIQ 771
           +W PP FL         K +++ A  E +E     D RPVLK+L +D++QV  VDSTS+Q
Sbjct: 744 EWKPPKFLSNVLHWRKNKKKNQTADVESLETGIVRDERPVLKVLCLDFSQVAQVDSTSLQ 803

Query: 772 SLIDLRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVV 831
           SL+DLRK +N YADRQV FHF+GI+SPWIKR LV  GFGT+NE +S++ ++  +S+YH+V
Sbjct: 804 SLVDLRKAVNAYADRQVEFHFAGIISPWIKRGLVKIGFGTVNEEFSDESIIAGHSSYHLV 863

Query: 832 QNVLSADEENQQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874
           +N +   E   Q       +  A+GTN PFFHID+PDF KWDI
Sbjct: 864 KNTIGDIENGYQ-------VKTATGTNLPFFHIDIPDFKKWDI 899

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/859 (51%), Positives = 599/859 (69%), Gaps = 32/859 (3%)

Query: 35  QDTSGLDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSVGSSLQFAKYDGNALPDF-- 92
           QD + ++  E++Y  ++  E +      +N+ ++  K   V S L     +      F  
Sbjct: 18  QDDADIEVFESEYRTYREAEAAENREEIQNDDNQDWK---VPSKLNLELTNSKVSEVFYD 74

Query: 93  KAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGIT 152
             P Y E TVT  +YYD TI+  +             PIIKW+ HYNF W Y+D +AGIT
Sbjct: 75  SIPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHYNFTWGYADLVAGIT 134

Query: 153 VGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVIS 212
           VGCVLVPQSMSYAQ+A L PEYGLYSSFIGAFIYS FATSKDVCIGPVAVMS+Q +KVI+
Sbjct: 135 VGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIA 194

Query: 213 HVIDQLPEG-TPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALS 271
            V+ + PE    +T P++A+ L L   ++   +G+LRLGF++ELIS+ AVAGFMTGSA S
Sbjct: 195 EVLKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELISLNAVAGFMTGSAFS 254

Query: 272 ILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYL 330
           I+  Q+P+L+G  K +NTR  TY+V+I+TLKHL  + ++A FGLI L +L+ WKW CG  
Sbjct: 255 IIWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYLWKWWCGSF 314

Query: 331 GPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVLG 389
           G KL+ ++     K A   +SF+FYAQA+RNA V+ + T +S+ +   + K+K  IS+LG
Sbjct: 315 GIKLVDRHYSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRITRNKSKEKRPISILG 374

Query: 390 TVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIA 449
           TVPSGL  VGV  IP GL+  +  +LP ++I+L+LEHI I+KSFGRIN+YK++PDQELIA
Sbjct: 375 TVPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVIPDQELIA 434

Query: 450 IGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPK 509
           IGVTNLIG+FF++YPATGSFSRSALKAKCNV+TP SG+F+GACVLLALY LTSAF+YIPK
Sbjct: 435 IGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLLALYCLTSAFFYIPK 494

Query: 510 AALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMA 569
           A LSAVIIHAV DL+ASY+ ++  W  NP D ISF+ T+L+T+FSSIENGIYFA+ +S A
Sbjct: 495 ATLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSSIENGIYFAMCWSCA 554

Query: 570 TLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQEISKDSKLAKDPDVHAS 629
            LL+K AFP+GKFLG V++ EV N  +   +DSI + + E P E SK         V +S
Sbjct: 555 MLLLKQAFPAGKFLGRVEVAEVLNPTIQGHIDSIVSPN-ESPNEFSK--------QVKSS 605

Query: 630 ANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDI 689
            + + S  + +F  KWVP D+ Y+RELN    V  PPPGVIVYR ++S+ Y+NCSR +D+
Sbjct: 606 VDALPSS-EYKFSVKWVPFDHAYTRELNSYTRVRPPPPGVIVYRFSDSFTYVNCSRHYDV 664

Query: 690 IVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAKPEVVEQVDN- 748
           I DR+K  TR G+LV+  +KS++ W +PG+W  P   +  F+  R  A K   +  V++ 
Sbjct: 665 IFDRIKEETRRGQLVSLRKKSDRPWNDPGEWKLPNSFKNIFRVKRGLATKNSELPAVNDN 724

Query: 749 -------RPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIK 801
                  +P+LK++ +D++QV  VDST++QSL+DLRK +N+YADRQV FHF+GI+SPWIK
Sbjct: 725 TNSESYEKPLLKVVCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIK 784

Query: 802 RALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEENQQNSEISA------SLDVAS 855
           R+L+   FGTINE +S+  ++  +S++H+ + +    +   ++S IS       +L  A+
Sbjct: 785 RSLLSVKFGTINEEFSDTSIITGHSSFHIAKVLKDEVDYTDEDSPISVTCSNYDTLCAAT 844

Query: 856 GTNFPFFHIDMPDFTKWDI 874
           GTN PFFHID+PDF+KWD+
Sbjct: 845 GTNLPFFHIDIPDFSKWDV 863

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/916 (49%), Positives = 613/916 (66%), Gaps = 71/916 (7%)

Query: 5   RENSDGIESQASTISDTQNLRTVDNNNRGLQDTSGLDELETDYTRFKTNEDSAGYSGAEN 64
           RE    IE +   I D Q+  TV +          LD+LE +Y ++K NE++  ++  + 
Sbjct: 3   RETHSNIE-EVVEIPDFQDSTTVPD----------LDDLELEYDQYKNNENNGAFNDNDL 51

Query: 65  ERSRIDKFDSV-------GSSLQFAKYDGNALPDFKAPPYYETTVTFMEYYDRTIRSRVG 117
           E + +   ++        GS +++      +L D     + E TV+F EYYD +IRS + 
Sbjct: 52  ESNSLTNHNTASEAKGVKGSKVEYFNTSDISLYDNSVSQFDEPTVSFKEYYDHSIRSHLT 111

Query: 118 XXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLY 177
                       PII W+ HYN  W  +D IAGIT+GCVLVPQSMSYAQ+A L  +YGLY
Sbjct: 112 LKAAGNYLKSVFPIIYWLPHYNVNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLY 171

Query: 178 SSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLPEG-TPITAPMVASALALF 236
           SSFIGA+ YSFFATSKDVCIGPVAVMS+Q +KVI+ V  + P+G T IT P++A+ LAL 
Sbjct: 172 SSFIGAYAYSFFATSKDVCIGPVAVMSLQTAKVIADVTARYPDGDTTITGPIIATTLALL 231

Query: 237 SSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLGIQK-INTRVETYRV 295
             I+   +G LRLGF++ELIS+ AVAGFMTGSA +IL  Q+P+L+G  K +NTRV TY++
Sbjct: 232 CGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRVATYKI 291

Query: 296 LISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARI-----WQ 350
           +I +LKHL  + ++AAFGLI L +L+ WKW CG  GP+L  ++   NSKK R+     W 
Sbjct: 292 VIDSLKHLPDTTLDAAFGLIPLFILYTWKWWCGTYGPRLNDRF---NSKKPRLHKIVKWT 348

Query: 351 SFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVH 409
            F  YAQA RN  ++ + T ++W +  G+      IS+LG+VPSGLK VGV  +P GL+ 
Sbjct: 349 CF--YAQASRNGIIIIVFTCIAWAITRGKSSADRPISILGSVPSGLKEVGVFHVPPGLMS 406

Query: 410 KLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSF 469
           KL P LP ++I+LLLEHI I+KSFGR+N+YK+VPDQELIAIGV+NL+G+FFNAYPATGSF
Sbjct: 407 KLGPNLPASIIVLLLEHIAISKSFGRVNDYKVVPDQELIAIGVSNLLGTFFNAYPATGSF 466

Query: 470 SRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKL 529
           SRSALKAKCNV+TPLSGLFSG+CVLLALY LT AF+YIPKA LSAVIIHAV DL+ASY+ 
Sbjct: 467 SRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQT 526

Query: 530 SFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKIT 589
           ++  W  NP D I F+ T+L+T+FSSIENGIYFA+ +S A  ++K AFP+GKFLG V+I 
Sbjct: 527 TWNFWKMNPLDFICFIVTVLITVFSSIENGIYFAMCWSCAIFILKVAFPAGKFLGRVEIA 586

Query: 590 EVSNLNVFEDLDSI-----GNNDPELPQEISKDSKLAKDPDVHASANLMASKLD------ 638
           EV++  V  D DS+      NN     +E     K      +  S   + +K+       
Sbjct: 587 EVTDAYVRADSDSVSFTSENNNRISTLEEDGVGEKEGPTNYIINSFKKLETKVQTKGFES 646

Query: 639 ---------VRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDI 689
                    +++HTKW+P D+ Y++ELNP++ +  PP GV+VYR +ES+ Y+NCSR +++
Sbjct: 647 PSASIGQPRIKYHTKWLPFDHKYTKELNPDVNILPPPEGVLVYRLSESYTYINCSRHYNV 706

Query: 690 IVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLR--KFFKKYRHKAAKPEVVEQV- 746
           I D +K +TR G+L+ H +KS++ W +PG W PP F +  KF+KK   K    E  E   
Sbjct: 707 ITDEIKKVTRRGQLIRHRKKSDRPWNDPGPWEPPTFFKNLKFWKK---KETDIESSENAV 763

Query: 747 --------DNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSP 798
                   D+RP+LKIL +D++QV   D+T++QSL+DLRK IN+YADRQV FHF GI+SP
Sbjct: 764 NNPTDAVRDDRPLLKILCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISP 823

Query: 799 WIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEENQQNSEISASLDVASGTN 858
           W+KR L+  GFGT+NE YS++ ++  +++YHV +  +  +EE         S+  ASGTN
Sbjct: 824 WVKRGLISRGFGTLNEEYSDESIVAGHTSYHVAR--VPQNEETPDK----YSVYTASGTN 877

Query: 859 FPFFHIDMPDFTKWDI 874
            PFFHID+PDF KWDI
Sbjct: 878 LPFFHIDIPDFAKWDI 893

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/866 (50%), Positives = 600/866 (69%), Gaps = 51/866 (5%)

Query: 35  QDTSGLDELETDYTRFKTNEDSAGYSGAENERS-RID---KFDSVGSSLQFAKYDGNALP 90
           Q+   ++  ++ Y+ ++ +E +A    + NE+S +++   KF+   +      YD     
Sbjct: 10  QENLNIEIFDSKYSSYRESEAAANRDDSHNEQSWKVNGNRKFEHTKTESSDVSYDS---- 65

Query: 91  DFKAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAG 150
               P Y E+TVT  EYY  +I++ +             PI+KW+ HYNF W Y+D +AG
Sbjct: 66  ---IPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCYADLVAG 122

Query: 151 ITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKV 210
           ITVGCVLVPQSMSYAQ+A L PEYGLYSSF+GAFIYS FATSKDVCIGPVAVMS+Q +KV
Sbjct: 123 ITVGCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMSLQTAKV 182

Query: 211 ISHVIDQLPEG-TPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSA 269
           I+ V+ + P+  T +T P++A+AL L   I+   +G+LRLGF++ELIS+ AVAGFMTGSA
Sbjct: 183 IAEVLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAGFMTGSA 242

Query: 270 LSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCG 328
            SI+  Q+P+L+G  K +NTR  TY+V+I+TLKHL  + ++A FGLI L +L+ WKW CG
Sbjct: 243 FSIIWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYVWKWWCG 302

Query: 329 YLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHK--KKTSIS 386
             G  L +++ + + K A   +SF+FYAQA+RNA V+ + T +SW  I R+K  +   IS
Sbjct: 303 TYGITLANRHYQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISW-SITRNKASEDRPIS 361

Query: 387 VLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQE 446
           +LGTVPSGL  VGV  IP GL+  +  +LP ++I+L+LEHI I+KSFGRIN+YK+VPDQE
Sbjct: 362 ILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKVVPDQE 421

Query: 447 LIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYY 506
           LIAIGVTNL+G+FF++YPATGSFSRSALKAKCNV+TP SGLF+G CVLLALY LT AF++
Sbjct: 422 LIAIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLTDAFFF 481

Query: 507 IPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAF 566
           IPKA LSAVIIHAV DL+ SY+ ++  W TNP D +SF+ T+ +T+FSSIENGIYFA+ +
Sbjct: 482 IPKATLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIYFAMCW 541

Query: 567 SMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQEISKDSKLAK-DPD 625
           S A LL+K AFP+G+FLG V++ E+ N              P L   +S    L + +  
Sbjct: 542 SCAILLLKQAFPAGRFLGRVEVAEILN--------------PTLQNNVSAVVSLNESNKQ 587

Query: 626 VHASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSR 685
           V  + +++ S  + RF TKWVP D+ YSRELN    +  PPPGVIVYR ++S+ Y+NCSR
Sbjct: 588 VKTTVDVLRSS-EYRFTTKWVPFDHEYSRELNRCAKICPPPPGVIVYRLSDSFTYVNCSR 646

Query: 686 QFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAA---KPEV 742
            +DII D VK  TR G+LVN  +KS++ W +PG+W  P  L+  F+  R       +P V
Sbjct: 647 HYDIIFDHVKEETRRGQLVNLRKKSDRPWNDPGEWKMPTSLKTLFRFKRKSVTENEEPSV 706

Query: 743 VEQVDNR-----PVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVS 797
                NR     P+LK++ +D++QV  VDST+IQSL+DLRK +N+YADRQV FHF+GI+S
Sbjct: 707 SNGSTNRGSYEKPLLKVICLDFSQVAQVDSTAIQSLVDLRKAVNKYADRQVEFHFAGIIS 766

Query: 798 PWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEE---NQQNSEISA----- 849
           PWIKR+L    FGT+NE YS++ ++  +S+ HV +   S+D++     + S ISA     
Sbjct: 767 PWIKRSLSSVDFGTVNEEYSDESVIAGHSSVHVTK--FSSDDDADYTDEESHISAPYSNY 824

Query: 850 -SLDVASGTNFPFFHIDMPDFTKWDI 874
            +L  A+GTN PFFHID+PDF+KWDI
Sbjct: 825 GTLCAATGTNLPFFHIDIPDFSKWDI 850

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/863 (50%), Positives = 589/863 (68%), Gaps = 47/863 (5%)

Query: 28  DNNNRGLQDTSGLDELETDYTRFK-----------TNEDSAGYSGAENERSRIDKFDSVG 76
           + ++  L D S LD+LE ++ ++K             E  +   G  ++  +   FDS+ 
Sbjct: 3   NQHDTELTDFSNLDDLEQEFNQYKKIELTISSTRQNEEVDSKRQGKSDKNVKSSSFDSIF 62

Query: 77  SSLQFAKYDGNALPDFKAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIH 136
           S  Q            + P Y E ++T  +YY  ++R                PI  W+ 
Sbjct: 63  SLTQ----------QQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFHWLP 112

Query: 137 HYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVC 196
           HYN  W  SD IAGITVGCVLVPQSMSYAQ+A L P++GLYSSFIGAF YS FATSKDVC
Sbjct: 113 HYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSKDVC 172

Query: 197 IGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLRLGFILELI 256
           IGPVAVMS+Q +KVI+ V D+LP  T ITA  +A+ LAL   I+   +GLLRLGF++ELI
Sbjct: 173 IGPVAVMSLQTAKVIARVQDKLPSDTDITASEIATTLALLCGIIATGVGLLRLGFLVELI 232

Query: 257 SVTAVAGFMTGSALSILASQLPSLLGIQ-KINTRVETYRVLISTLKHLNGSDINAAFGLI 315
           S+ AVAGFMTGSAL+I++ Q+P L+G   ++NTR  TY+V+I TLKHL  + ++A FGLI
Sbjct: 233 SLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAVFGLI 292

Query: 316 CLALLFFWKWTCGYLGPKLISKYLR--PNSKKARIWQSFFFYAQALRNAFVLFLATFVSW 373
            L LLF WKW C  LGP+L  ++     N +  RI ++F+FYAQ  +NA ++ + T +SW
Sbjct: 293 PLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFTCISW 352

Query: 374 LVI-GRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKS 432
            +  G+  +   ISVLG+VP GLK V   T+PSGL+ KL P+LP ++I+LLLEHI IAKS
Sbjct: 353 AITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIAIAKS 412

Query: 433 FGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGAC 492
           FGRIN+YKIVPDQE++AIG+TNL+G+FF+AYPATGSFSRSALKAKCNV+TPLSGLFSGAC
Sbjct: 413 FGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLFSGAC 472

Query: 493 VLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTI 552
           VLLALY LT AF+YIPKA L AVIIHAV +LIASYK +   W  NP D   FL T+++T+
Sbjct: 473 VLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTVIITV 532

Query: 553 FSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQ 612
           F+SIE+GIYFA+ +S+A LL K AFP GKFLG ++ITEV +  +  D   + ++D     
Sbjct: 533 FASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDEN--S 590

Query: 613 EISKDSKLAKDPDVHASANLMASKLDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVY 672
           EI   +K     +V ++ N      +  ++TKWVP D  Y++ELNP+  +  PPPGVIVY
Sbjct: 591 EILPTTKAGYSVEVVSNHN-----ENTNYYTKWVPFDFSYTKELNPDAHIKPPPPGVIVY 645

Query: 673 RPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKFFKK 732
           R  +S+ Y+NCSR FDI+ D +K  T+ GKL   +RKS++ W +PG W P +F++K+ ++
Sbjct: 646 RMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMRKSDRPWNDPGKWEPRVFIKKYLRR 705

Query: 733 YRHKAAKPEVVEQV-DNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFH 791
             +     ++ ++V D+RP LKI+ +D++QV+ +D+T+IQ L DLRK++N+YADRQV FH
Sbjct: 706 ENYDEDNVDIEDRVIDDRPFLKIICLDFSQVSQIDATAIQCLYDLRKSVNKYADRQVEFH 765

Query: 792 FSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEENQQNSEISASL 851
           F GI+SPWIK++L + GFGTIN  YS++ +++ +S+YH+ ++V                +
Sbjct: 766 FVGIISPWIKKSLRNFGFGTINNEYSDESIIMGHSSYHLTKDV--------------DGI 811

Query: 852 DVASGTNFPFFHIDMPDFTKWDI 874
             A+GTN PFFHID+P+F KWDI
Sbjct: 812 KAATGTNLPFFHIDIPNFNKWDI 834

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/901 (49%), Positives = 608/901 (67%), Gaps = 44/901 (4%)

Query: 12  ESQASTISDTQNLRTVDNNNRGLQDTSGLDELETDYTRFKTNE-DSAGYSGAENERSRID 70
           E+  + I +   L +  N++   Q+   L +LE +Y ++K +E ++    G + E + +D
Sbjct: 11  ENNTNDIENQYELPSFPNSDTSSQN---LADLELEYDQYKASETNNKSNHGPDLETNNLD 67

Query: 71  -KFDSV---GSSLQFAKYDGNALPDFKA-----PPYYETTVTFMEYYDRTIRSRVGXXXX 121
            +F +    G      K     +  F A     P + E  ++F +YY  +++        
Sbjct: 68  VQFSNTYNTGDKKNSIKNHQIQINTFNADSVIIPSFEEHAISFKDYYRHSLKENFSLKSV 127

Query: 122 XXXXXXXXPIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFI 181
                   PII+W+ HYN AW  SD IAGITVGCVLVPQSMSYAQ+A L P+YGLYSSFI
Sbjct: 128 KEYALSIFPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFI 187

Query: 182 GAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTP-ITAPMVASALALFSSIL 240
           GAF YS FATSKDVCIGPVAVMS++  KVI+ V+ + PE  P ITAP++A+ LA    ++
Sbjct: 188 GAFTYSLFATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVI 247

Query: 241 VIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLGI-QKINTRVETYRVLIST 299
              IG LRLGF++ELIS+ AV GFMTGSAL+I+  Q+P+L+G   K+NTR  TY+V+I +
Sbjct: 248 TAGIGFLRLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIES 307

Query: 300 LKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQAL 359
           LKHL  + ++A FGLI L +L+ WKW CG +GP++  K+   N K     + F+FYAQA 
Sbjct: 308 LKHLPDTKLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAA 367

Query: 360 RNAFVLFLATFVSWLVI-GRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPA 418
           +NA ++ + T ++W +  G+ K +  IS+LG+VP GLK VGV  +P GL  K+ P+LP +
Sbjct: 368 KNAVIIIVFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPAS 427

Query: 419 VIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKC 478
           VI+LLLEHI IAKSFGRIN+YK+VPDQELIAIGVTNLIG+FFNAYPATGSFSRSALKAKC
Sbjct: 428 VIVLLLEHIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKC 487

Query: 479 NVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNP 538
            V+TPLSGLF+G+CVLLALY LT  F YIPKA LSAVIIHAV DLIASY  ++  W  NP
Sbjct: 488 EVRTPLSGLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNP 547

Query: 539 FDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNV-- 596
            D  SF+ T+ +T+FSSIENGIYFA+ +S A L++K AFP+GKFLG V+I EV N  V  
Sbjct: 548 LDCFSFIVTVFITVFSSIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDD 607

Query: 597 -FEDLD-SIGNNDPELPQEISKDSKLA----------KDPDVHASANLMASKLDVRFHTK 644
            FE  D S  +N       I+ + KL           KD  + +  + +  K  +R++TK
Sbjct: 608 SFEVTDYSSNSNLSLSADTINHNKKLKILHIPLLKTLKD-QLFSDISSIQGKSKIRYYTK 666

Query: 645 WVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLV 704
           W+P D+ Y++ELNP + +  PPPGVIVYR T+S+ Y+NCS+ +D+I + +K  T+ G+L+
Sbjct: 667 WLPFDHAYTKELNPNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLI 726

Query: 705 NHLRKSEQLWCEPGDWVPPLFLRKFFKKYRHKAAK----------PEV-VEQVDNRPVLK 753
            H +KS++ W +PG+W  P F  K +KK   +  K          P+V V + D+RP+LK
Sbjct: 727 RHRKKSDRPWNDPGEWEAPNF-SKLWKKLSFRRNKNNNDNEETHIPDVPVSKRDDRPLLK 785

Query: 754 ILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTIN 813
           +L +D++QV  VD+T++QSL+DLRK IN+YADRQV FHF+GIVSPWIK+ L++ GFGTIN
Sbjct: 786 VLCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTIN 845

Query: 814 ENYSNDPLLLKYSTYHVVQNVLSADEENQQNSEISASLDVASGTNFPFFHIDMPDFTKWD 873
           E YS++ ++  +++YH+ + +   D E       +  +  A+GTN PFFHID+PDF +WD
Sbjct: 846 EEYSDESIIAGHTSYHLAR-IPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWD 904

Query: 874 I 874
           +
Sbjct: 905 V 905

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/899 (48%), Positives = 589/899 (65%), Gaps = 75/899 (8%)

Query: 40  LDELETDYTRFKTNED-SAGYSGAENERSRIDKFDSVGSSLQFAKYDGNALPD------- 91
           LD LE +Y +FK NE  S   +GA+ E+            L   KY   ++ D       
Sbjct: 4   LDNLELEYNQFKNNERPSNTNAGADIEKG-----------LDTKKYFERSITDNSTYGKK 52

Query: 92  -FKAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAG 150
            +  P Y E T+T  +YYD  +R                P++ W+  YN  W  SD IAG
Sbjct: 53  SYSIPSYEEDTITLKDYYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAG 112

Query: 151 ITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKV 210
           ITVG VLVPQSMSYAQ+A L PEYGLYSSFIGA +YSFFATSKDVCIGPVAVMS+Q +KV
Sbjct: 113 ITVGTVLVPQSMSYAQIATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKV 172

Query: 211 ISHVIDQLPEGTP-ITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSA 269
           I+ V ++ P+  P IT P++A+ LA    I+   +GLLRLGF++ELIS+ AVAGFMTGSA
Sbjct: 173 IARVKEKHPDLDPSITGPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSA 232

Query: 270 LSILASQLPSLLGI-QKINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCG 328
            +I+  Q+P L+G  +K+NTR  TY V+I +LKHL  + ++AAFGLI L  LFFWKW C 
Sbjct: 233 FNIIWGQIPGLMGYSKKVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCN 292

Query: 329 YLGPKLISKYLRPNSK--KARIWQSFFFYAQALRNAFVLFLATFVSW-LVIGRHKKKTSI 385
            +GPKL  +Y   NS+    + W++F+FY QA RN  ++ L T VS+ +  G  K K  I
Sbjct: 293 SMGPKLTDRYFPANSRPRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRI 352

Query: 386 SVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQ 445
           SVLGTVP GL+H GV  +P G+++ +  ++P ++I+LLLEHI I+KSFGR+N+YKI P+Q
Sbjct: 353 SVLGTVPKGLRHTGVMKLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQ 412

Query: 446 ELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFY 505
           E+IAIGV+NL+G+FFNAYPATGSFSRSALKAKCNV TPLSG+FS ACVLLA+Y LT AF+
Sbjct: 413 EIIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFF 472

Query: 506 YIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVA 565
           YIPKA LSAVIIHAV DLIASY  ++ LW  N FD I F+ T+ +T+FSSIENGIYFAV 
Sbjct: 473 YIPKATLSAVIIHAVFDLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVC 532

Query: 566 FSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLD-SIGNNDPELPQE-ISKDSKLAKD 623
           +S A LL  NAFP+GKFLG ++I EV N  + +D D S  N++     E I  D+ +A+D
Sbjct: 533 WSCAILLYNNAFPAGKFLGRIEIAEVVNPKIVDDDDFSFENSNESFDDEGIYFDNSVAED 592

Query: 624 PDVHASANLMA------------------SKLDVRFHTKWVPLDNGYSRELNPEIAVHMP 665
               +S +L                    +  D+R++TKWVP D+ YS+ELNP + +  P
Sbjct: 593 KLGTSSNDLKKFNAGVKTRSINGELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPP 652

Query: 666 PPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPP-- 723
           PPGVIVYR ++S+ Y+NCSR +D+I D +K +TR G+L+ H  K ++ W +PG+W  P  
Sbjct: 653 PPGVIVYRLSDSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDL 712

Query: 724 ---LFLRKFFKKYRHKAAKPEVVEQ-----------------VDNRPVLKILAMDWTQVT 763
                ++KF   ++ K    +  E                   D RP+L+++ +D++QV 
Sbjct: 713 KKFFNVKKFVSVFKRKVTDVDTFENENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVA 772

Query: 764 HVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLL 823
           + D+T++QSL DLRK +N+YADRQV FHF GI SPWIKR L + GFGT NE YS++ ++ 
Sbjct: 773 NTDATALQSLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIA 832

Query: 824 KYSTYHVVQNVLSADE--------ENQQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874
            +S+YH+ +   S  +        E+Q+N      +  ASGTN PFFH+D+PDF+KWDI
Sbjct: 833 GHSSYHLSRFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/880 (49%), Positives = 592/880 (67%), Gaps = 42/880 (4%)

Query: 34  LQDTSGLDELETDYTRFKTNEDSAGYSGAENERS----RIDKFDSVGSSLQFAKYDGNAL 89
           L + S LD+LE +Y ++K  ED     G  ++      R  K D   + L++        
Sbjct: 30  LSEVSNLDDLEQEYDQYKAAEDRERVVGRGDDEYDDDLRKGKVDYKETELEYWNSTNGTT 89

Query: 90  ----PDFKAPPYYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYS 145
               P    P Y E  V   + +   ++ R+             PIIKW+  YN+ W Y+
Sbjct: 90  NLLAPKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKWLPFYNWKWGYA 149

Query: 146 DFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSV 205
           D +AGITVGCVLVPQSMSYAQ+A L P+YGLYSSF+GAFIYSFFATSKDVCIGPVAVMS+
Sbjct: 150 DLVAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSL 209

Query: 206 QVSKVISHVIDQLP-EGTPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGF 264
           + +KVI   +++ P E   +T P++A+ALAL   I+ +  G+LRLGF++ELIS+ AVAGF
Sbjct: 210 ETAKVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGVLRLGFLVELISLNAVAGF 269

Query: 265 MTGSALSILASQLPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFW 323
           MTGS+L+I++ Q+P+L+G +K ++TR  TY+++I++LK+L  + ++A FGLI L LL+ W
Sbjct: 270 MTGSSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVFGLIPLVLLYTW 329

Query: 324 KWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHKKKT 383
           KW C   GPKL  ++ + N KK  I ++F+FYAQA+R+A ++ + T +S+  I + +K  
Sbjct: 330 KWWCSSYGPKLADRHFKNNPKKRDILKTFYFYAQAMRSAVIIIVFTAISY-GITKGRKTP 388

Query: 384 SISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVP 443
            ISVLG VP GLK V V  IP GL+ K+   +P A+IILLLEHI+IAKSFGR+NNYK+VP
Sbjct: 389 RISVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSFGRVNNYKVVP 448

Query: 444 DQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSA 503
           DQELIAIG TNLIG+FFNAYPATGSFSRSALKAKCNV+TPLSG+FSGACVLLALY LT  
Sbjct: 449 DQELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFSGACVLLALYCLTQT 508

Query: 504 FYYIPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFA 563
           FYYIP A LSAVIIHAV DL ASYK S+  +  NP D I+F+ T+ +T+FSSI+ GIYFA
Sbjct: 509 FYYIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVFSSIDYGIYFA 568

Query: 564 VAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNN-----DPELPQEISKDS 618
           + +S A  L+KN F  G+FLG V++ EV N  V  +++S+  +     D    Q   + S
Sbjct: 569 MCWSAAMFLLKNMFAPGRFLGRVEVAEVVNAQVDPNVESVSESAGSHLDGFQAQSSIESS 628

Query: 619 KLAKDP----DVHA---------SANLMASKLDVR--FHTKWVPLDNGYSRELNPEIAVH 663
               DP     VH+         S N + +++  +  +HTKW+  D  YSRE NPE+ + 
Sbjct: 629 SKKLDPLDKSAVHSNYLNGGDDGSDNNINNQIGQKLVYHTKWISYDRSYSREFNPEVPIQ 688

Query: 664 MPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPP 723
            PPPGVIVYR  +S+ YLNCSR +DII D V+  TR G++++ ++K ++ W +PG+W  P
Sbjct: 689 PPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQMISAVKKVDRPWNDPGEWEAP 748

Query: 724 LFLRKFFKKYR-------HKAAKPEVVEQ--VDNRPVLKILAMDWTQVTHVDSTSIQSLI 774
            + +K   K +        +A + +  EQ   DNRP+LKI+ +D++Q +  D+T+IQ+L 
Sbjct: 749 RWFKKLTSKKKTAEEWAETEAQESKAAEQKLQDNRPLLKIICLDFSQCSQTDATAIQNLT 808

Query: 775 DLRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNV 834
           DLRK +NRYADRQV FH  G+ +PW+KRALV+ GFGT+NE YS++ LL  + +YHV +  
Sbjct: 809 DLRKQVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVNEEYSDESLLAGHRSYHVARAP 868

Query: 835 LSADEENQQNSEISASLDVASGTNFPFFHIDMPDFTKWDI 874
            S   E+   S    S+  ASGTN PFFH+++PDF+KWD+
Sbjct: 869 TSL--EDGLGSPAQYSVYPASGTNLPFFHVEIPDFSKWDL 906

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/921 (46%), Positives = 592/921 (64%), Gaps = 65/921 (7%)

Query: 12  ESQASTISDTQNLRTVDNNNRGLQDTSGLDELETDYTRFKTNEDSAGYSGAENERSRIDK 71
           + +  T  D ++L  ++ ++    +T  L+ LE +Y ++K  E+    SG     S    
Sbjct: 4   DKKNDTTVDNRDLDNIELSSYSNSNTVDLEALEEEYDQYKKEEEIEYISGNYLNSSPTQN 63

Query: 72  FDSVGSSLQFAKYDG--------NALP------DFKAPPYYETTVTFMEYYDRTIRSRVG 117
            + V S+ ++ +Y          N +       D+  P + E  +TF EYY+ +++    
Sbjct: 64  IN-VTSNPKYEEYKKLKHLDQSYNYVSTEYLDTDYLIPAHNENIITFKEYYNHSLKEYFT 122

Query: 118 XXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLY 177
                       PII W+  YNF W  SD IAGIT+GCVLVPQSMSYAQ+A L P+YGLY
Sbjct: 123 FNAAKNYALSIFPIIHWLPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIATLDPQYGLY 182

Query: 178 SSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFS 237
           SSFIGAF+Y+ FATSKDVCIGPVAVMS++ +KVI+ V         +T P++A+ LAL  
Sbjct: 183 SSFIGAFVYALFATSKDVCIGPVAVMSLETAKVIADVSSHFQNDPDVTGPIIATTLALLC 242

Query: 238 SILVIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLGIQK-INTRVETYRVL 296
             +   +G LRLGF++ELIS+ AV GFMTGSA +IL  Q+P L+G  K +NTR  TY+V+
Sbjct: 243 GGIAAAVGFLRLGFLVELISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYKVV 302

Query: 297 ISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYA 356
           I TLKHL  + ++A FGLI L +L+  KW C   G +L  K    N +     + F+FY 
Sbjct: 303 IDTLKHLPDTKLDAVFGLIPLFILYVVKWWCTNYGLQLAEKQFSSNERYRFYLKKFYFYT 362

Query: 357 QALRNAFVLFLATFVSWLVIGRHKKKTS--ISVLGTVPSGLKHVGVPTIPSGLVHKLMPQ 414
            A+RNA V+ + T +SW  I R+K  +   I+VLGTVPSGLK +GV    + +V K+ PQ
Sbjct: 363 NAMRNAVVIIIFTAISW-SITRNKSSSERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQ 421

Query: 415 LPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSAL 474
           LP ++I+LLLEHI IAKSFGRIN+YKIVPDQELIAIG++NL+G+FF+AYPATGSFSRSAL
Sbjct: 422 LPASIIVLLLEHIAIAKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYPATGSFSRSAL 481

Query: 475 KAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLSFYLW 534
            AKCNVKTPLSG+F+G CVLLALY LT AF+YIPKA LSAVIIHAV DLIASY+ +   W
Sbjct: 482 NAKCNVKTPLSGIFTGGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFW 541

Query: 535 NTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNL 594
           N NP D + FL T+L+T+FSSIENGIYFA+ +S A  + ++AFP+GKFLG ++I EV N 
Sbjct: 542 NMNPLDTLCFLVTVLITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEVINA 601

Query: 595 NVFED--LDSIGNNDPELPQEISKDSKLAK----DPDVHASANLMASKLDVRFHTKWVPL 648
              +D  +D+    +         D    K    + + H   +   SK    F+TKWVP 
Sbjct: 602 TPKDDFQMDNFNGFETSEYNNFPADQSYGKFDIANKNTHKYNSPHCSK---NFYTKWVPF 658

Query: 649 DNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLR 708
           D+ Y++ELN ++ +  PPPGVIVYR ++S+ YLNCSR FD I D VK  T+ GK + +++
Sbjct: 659 DHTYTKELNKDVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFIGNIK 718

Query: 709 KSEQLWCEPGDWVPPLFL------RKFFKKYRHKAAKPEVVEQ---------------VD 747
           KS++ W +PG+W  P ++      R  FK  R + A+  V  +               +D
Sbjct: 719 KSQRPWNDPGEWEAPTWMTKKFSIRNLFK--RKQEAESNVPNEDASTDLDISNNKDIDMD 776

Query: 748 NRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKRALVHA 807
           +RPVL+++ +D++QV+  D+T++QSL DLRK++N YADRQV FHF GI+SPW+KR L+  
Sbjct: 777 HRPVLQVICLDFSQVSQTDNTALQSLFDLRKSVNSYADRQVEFHFCGIISPWVKRGLIKL 836

Query: 808 GFGTINENYSNDPLLLKYSTYHVVQNV----------LSADEENQQNSEI----SASLDV 853
           GFGT+NE YS+   ++ + +YH+V+N            S D  +  N E     + S++ 
Sbjct: 837 GFGTVNEAYSDASTIVGHVSYHIVKNPTFRNKSFSSHTSEDTISDMNIEAKDYNNYSIEA 896

Query: 854 ASGTNFPFFHIDMPDFTKWDI 874
           ASGTN+PFFHID+P+F+KWD+
Sbjct: 897 ASGTNYPFFHIDIPNFSKWDV 917

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/887 (48%), Positives = 567/887 (63%), Gaps = 56/887 (6%)

Query: 40  LDELETDYTRFKTNEDSAGYSGAENERSRIDKFDSVGSSLQFAKYDG--NALPDFKAPPY 97
           L+  E +Y   K  +D+     A +  S++D  + V  + Q   Y G  +       P Y
Sbjct: 11  LERFELEYDHGKRGDDTHDRVEARDLYSKVD-IEEV--TFQCDNYSGRLDVNSSLSIPMY 67

Query: 98  YETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGITVGCVL 157
            E  VT  ++Y   I                 P++KW+ HYN  W+  D IAGITVGCVL
Sbjct: 68  NEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGITVGCVL 127

Query: 158 VPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQ 217
           VPQSMSYAQ+A L P+YGLYSSFIGAFIYSFFATSKDVCIGPVAVMS+Q +KVI  V   
Sbjct: 128 VPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIERVTSG 187

Query: 218 LP--EGTPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILAS 275
           L   E T  TAP++A+ALAL   I+   IG LRLGF++E IS+ AVAGFMTGSA +I+  
Sbjct: 188 LTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAFNIICG 247

Query: 276 QLPSLLGI-QKINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKL 334
           Q+P+L+G  +K+NTR  TY V+I+TLKHL  + ++A FGLI L++L+  KW    LGP+ 
Sbjct: 248 QVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSSLGPQY 307

Query: 335 ISKY------LRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHKKKTS--IS 386
           ++K            K  +   ++FFY+ A+RN  V+ + T +SW  I R K  TS  IS
Sbjct: 308 LNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISW-AITRGKSSTSVPIS 366

Query: 387 VLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQE 446
           +LGTVP GLK V V  +P GL  KL P LP ++IILLLEHI I+KSFGR+N+YKIVPDQE
Sbjct: 367 ILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYKIVPDQE 426

Query: 447 LIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYY 506
           LIAIGVTNLIG+FF AYPATGSFSRSALKAKC+VKTPLSGLFSGACVLLALY LT AFYY
Sbjct: 427 LIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTGAFYY 486

Query: 507 IPKAALSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAF 566
           IPKA LSAVIIHAV DL+ASYK +   +  NP D + F+ T+ +T+FSSIE GIYFA+ F
Sbjct: 487 IPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYFAICF 546

Query: 567 SMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPE--LPQEISKD----SKL 620
           S A L+ KN FP G FLGY+KI EV N  +  +  +I  +D    L +E +KD    ++L
Sbjct: 547 SCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSVKNRL 606

Query: 621 AKDPDVHASAN--------LMASK---LDVRFHTKWVPLDNGYSRELNPEIAVHMPPPGV 669
            ++ +  +S           M+S     ++ ++ +WVP+ N Y RE+NP I +  PPPG+
Sbjct: 607 DQNENPKSSEKEYSEFKSYEMSSNSKTTNLSYYVRWVPMKNDYHREVNPLIKITPPPPGI 666

Query: 670 IVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLRKF 729
           IVYR  +S+ YLNCSR +DII D VK  TR G    + RK ++ W + G+W  P  L+  
Sbjct: 667 IVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRPWNDVGEWECPKSLKNL 726

Query: 730 F--------------KKYRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQSLID 775
           F              K               DN+P LKI+  D++QV   D+T+IQSL D
Sbjct: 727 FNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDFSQVVQTDATAIQSLND 786

Query: 776 LRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQ-NV 834
           LRK +NRY+++Q+ +HFSGI+S W+K++L+  GFGT+N+NYS+  +++ + +YHV + N 
Sbjct: 787 LRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDKSIIIGHQSYHVSKINN 846

Query: 835 LSADEENQQNSEISA-------SLDVASGTNFPFFHIDMPDFTKWDI 874
                ENQ N +           +   +GTN+PFFHID+PDF+ W++
Sbjct: 847 QEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSNWEL 893

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  466 bits (1200), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 248/520 (47%), Positives = 339/520 (65%), Gaps = 24/520 (4%)

Query: 97  YYETTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGITVGCV 156
           Y E  VT +E ++  +                 PI KWI HYN  W  SD IAGITVGCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 157 LVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVID 216
           LVPQSMSYAQ+A L P+YGLYSS +G FIY+ FATSKD+CIGPVA+MS+Q +K I+HV  
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 217 QLPEGTPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILASQ 276
           + P+   I A ++AS +A+    + + IG+LRLGF ++LI VTAV GF +GSA +IL  Q
Sbjct: 123 KHPD---IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWGQ 179

Query: 277 LPSLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLI 335
           +P L+G  K +NTR +TY+V++ TLK L  ++INA  GLI L  LF WK+ C Y    L 
Sbjct: 180 IPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCDY---ALR 236

Query: 336 SKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHKKKTSISVLGTVPSGL 395
              L+P  K+        FY  +LR   V+ + +  ++       K  S+ VLG +P G 
Sbjct: 237 RGNLKPWPKR------IVFYLLSLRVTIVIIICSAAAY-----GAKNPSLKVLGKIPKGF 285

Query: 396 KHVG---VPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGV 452
                  + +IPS LV  +  ++P +VI+L+LEH++IAKSF R+NNY++  DQEL AIGV
Sbjct: 286 AAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELTAIGV 345

Query: 453 TNLIGSF-FNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAA 511
           +N++G+    AYP TGSFSR+ALKA+C V+TPL  +FSG CV++A+  LTSA  +IPKA 
Sbjct: 346 SNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWIPKAT 405

Query: 512 LSAVIIHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATL 571
           LSAVIIHAV  LI+SYK++  L+   P D + FL TI +T+FS IE G+YFAV ++   L
Sbjct: 406 LSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWACFLL 465

Query: 572 LMKNAFPSGKFLGYVKITEV--SNLNVFEDLDSIGNNDPE 609
           +++ AFP G FLGYV++ E+  S++ + E +D    ND E
Sbjct: 466 MIRIAFPYGAFLGYVRVREISRSSITMIEPMDYESGNDKE 505

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/223 (38%), Positives = 132/223 (59%), Gaps = 28/223 (12%)

Query: 645 WVPLDNGYSRELNPEIAVHMPPPGVIVYRPTESWHYLNCSRQFDIIVDRVKTLTRPGKLV 704
           W+P  + ++RELNP + +H PPPGV+VYR ++S  Y+NCSR +D I+D +K  T+PG+ +
Sbjct: 688 WIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNYDNIIDYIKDNTKPGE-I 746

Query: 705 NHLRKSEQL--WCEPGDWVPPLFLRKFFKKYRHKAAKPEVVEQ---VDNRPVLKILAMDW 759
           + L  +  +  W  PG W  P    KF++      A PE+  +    D RP L+IL +D+
Sbjct: 747 DVLSDALYVKPWNNPGPWEKPKL--KFWEH-----ADPEIARKKRMADKRPTLRILCLDF 799

Query: 760 TQVTHVDSTSIQSLIDLRKTINRYADRQVGFHFSGIVSPWIKRALVHAGFGTINENYSND 819
           +QV  +DST++Q+LIDLR  +N Y    V +HF GI+SPW++R L+  GFG IN+ +   
Sbjct: 800 SQVAQIDSTALQALIDLRHEVNAYTCSLVEWHFCGIISPWVRRNLIEIGFGKINKEFF-- 857

Query: 820 PLLLKYSTYHVVQNVLSADEENQQNSEISASLDVASGTNFPFF 862
           P +   ST  V+             S++  + ++A G N PFF
Sbjct: 858 PKVNDSSTVEVI-------------SDLEYNGELALGENVPFF 887

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score =  145 bits (366), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 127/508 (25%), Positives = 230/508 (45%), Gaps = 42/508 (8%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFF 189
           PI++W+  Y++  M  D +AG+T+    +P ++S   +A + P  GLY+  I   IY+ F
Sbjct: 49  PILRWLPEYSWGKMAKDMLAGLTLTSFQIPLAISLTTMAHVSPYAGLYALVIPPLIYAVF 108

Query: 190 ATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLRL 249
            +   + +GP  V S+    V+    D     + +   M  + +   S +LV  +G+ RL
Sbjct: 109 GSVPTMVVGPQTVASL----VVGQSCDAWAHKS-LEPLMTVAVIGCISGVLVFAMGIFRL 163

Query: 250 GFILELISVTAVAGFMTGSALSILASQL-PSLLGIQKINTRVETYRVLISTLKHLNGSDI 308
           GFI   IS   + GF +  A+ +L ++L P L    +I+ R +        LK   G   
Sbjct: 164 GFIDNAISKAFLKGFTSALAVVMLITELLPQL----QIDDRYK------QALKE--GKVG 211

Query: 309 NAAFGLICLALL--------FFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALR 360
           +AA+  +  AL         F  K +       L+SKYL+        W    F+   L 
Sbjct: 212 SAAWDKLVFALENAREYSNPFSVKLSVAAFSILLLSKYLKKYLTAKYGWTKLTFFPDLLL 271

Query: 361 NAF-VLFLATFVSWLVIGRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAV 419
                + L+ +  W        K ++ ++G +P    H+ VP         L        
Sbjct: 272 VVLGSILLSFYYDW------DNKYNLPIVGDLPPNKDHIKVPIQSFQEFKDLFDASFLVA 325

Query: 420 IILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCN 479
           I+ L E  T  KS     +  +  ++EL+++G+ N++GS F++ PA G + RS L   C 
Sbjct: 326 ILGLFESATAFKSISATFDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCG 385

Query: 480 VKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLS-FYLWNTNP 538
            +TP++G+F     +  + +L   F+Y+P   L+ +I     +L+       F+ W+ + 
Sbjct: 386 AQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSG 445

Query: 539 F-DLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVF 597
           + +LI+F A +L T+  S + G+   +  +M  LL        + LG   IT+    N++
Sbjct: 446 YQELITFSAVVLSTLIWSPQFGLVMGLGLTMIRLLKHTTQSRIQILGKDPITKKFR-NIY 504

Query: 598 EDLDSIGNNDPELPQEISKDSKLAKDPD 625
            +      ++ E+P E  + + + K P+
Sbjct: 505 SE------HNEEIPLEEIEKTMVIKVPE 526

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  135 bits (341), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 113/476 (23%), Positives = 211/476 (44%), Gaps = 41/476 (8%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYAQLAGLKPEYGLYSSFIGAFIYSFF 189
           PI+KW   Y+   +  D +AGI++    +P ++S + +A + P  GL+S  I   IY+ F
Sbjct: 49  PILKWFPEYDRKKLGKDLLAGISLTAFQIPFAISLSTMAHVSPYAGLFSLVIPPLIYAVF 108

Query: 190 ATSKDVCIGPVAVMSVQVSKVISHVIDQLPEG---TPITAPMVASALALFSSILVIPIGL 246
            +   + +GP          V+S V+ Q  E      + + +  + +A  S  +++ +GL
Sbjct: 109 GSVPTMVVGP--------QTVVSLVVGQSCEAWSHKSVDSLVTVAVIACTSGFILLSMGL 160

Query: 247 LRLGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKI--------NTRVETYRVLIS 298
            R+GFI   IS   + GF+   A+ +L ++L   L ++ +        N    T+     
Sbjct: 161 FRMGFIDNAISKAFLRGFIFALAIMMLITELLPELQLEDLYRDEVAQGNAGTTTWDKFNF 220

Query: 299 TLKH--LNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYA 356
            LK+   +    +     I  ++L   K+   Y   K  SK  R            FF  
Sbjct: 221 ILKYGPEHADSFSMKLSFIAFSILMVCKYVKKYFTEKRGSKLCR------------FFPD 268

Query: 357 QALRNAFVLFLATFVSWLVIGRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVHKLMPQLP 416
             L  A  ++L+ +  W             ++G +P    H  VP        +L     
Sbjct: 269 LLLVVAGFIYLSYYNDW------SSTMGTRIIGNLPPNKNHFKVPITSFKEFKELFDISF 322

Query: 417 PAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKA 476
              I+ L +  T  K+ G   +  I  ++EL+++G+ N++ S F+A PA G + RS L  
Sbjct: 323 LVAILGLFDSATAFKAIGEKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNI 382

Query: 477 KCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASYKLS-FYLWN 535
            C+ +TP++G+      +  + Y+  AF+Y+P   L+ +I +   +L+       F+ W+
Sbjct: 383 LCSAQTPMAGIVVSVAAIFCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWS 442

Query: 536 TNPF-DLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITE 590
              + +L++F+A ++ T+  S + G+   V  +M  LL        + LG   +T+
Sbjct: 443 VGGYQELLTFVAVVVTTLVWSPQFGVSIGVGLTMIRLLKHTTQSRVQILGRDPVTK 498

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  135 bits (341), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 129/501 (25%), Positives = 230/501 (45%), Gaps = 47/501 (9%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P + WI +YN+     DFIAG+++    +P  +S+A  LA ++P  GLYS  +  FIY+ 
Sbjct: 73  PCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAVTPFIYAL 132

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
           F +   + +GP + +S+ V + +  +         +    +A+ ++  S + ++  G+ R
Sbjct: 133 FGSVPHMIVGPESAISLVVGQAVETLTSH---DLSLETVDIATMISFMSGLTLLFGGIFR 189

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKI--------NTRVETYRVLIS-- 298
           LGF+  ++S   + GF++     ++ + L + L + K+        +T  E    L+   
Sbjct: 190 LGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEKILFLVRYG 249

Query: 299 -TLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQ 357
            +  HL  S ++ A     + +  F K                   K  R  +   F  +
Sbjct: 250 PSNYHLPTSFLSLAVFTTLMTIRIFKK-------------------KMMRRIKWIVFIPE 290

Query: 358 ALRNAFVLFLATFVSWLVIGRHKKKTSISVLGTVPS-GLKHVGVP--TIPSGLVHKLMPQ 414
            L    V+  +  +S++     KKK  ISV+G   + G      P      GL+  L   
Sbjct: 291 ILS---VVIFSIVLSYMC--DLKKKYDISVIGDFNTDGFDDFRNPLSKCNRGLIPALRDV 345

Query: 415 LPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSAL 474
              + ++  LE IT +KS G   N     ++EL+A+G+ N IGS F   PA G + RS +
Sbjct: 346 SLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFGIIPAFGGYGRSKI 405

Query: 475 KAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLI--ASYKLSFY 532
            A    +T ++G+F G+  L  + +L    +YIP   LS +     V L+  A + + F+
Sbjct: 406 NAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGVSLLEEAPHDIKFH 465

Query: 533 LWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITE-- 590
           +      +LI F+ T L T F SIE GI     +S+ +++  +A    + L  V+ T+  
Sbjct: 466 IRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISIVKHSAQSRIQILARVEGTDHF 525

Query: 591 -VSNLNVFEDLDSIGNNDPEL 610
             +N  +  DLDS   + P++
Sbjct: 526 INANEYLQLDLDSDNCSAPDI 546

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  135 bits (340), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 140/550 (25%), Positives = 238/550 (43%), Gaps = 57/550 (10%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   W+  Y       D IAGIT+    +P ++SYA  LA ++P  GLYS  I  F+Y  
Sbjct: 82  PCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAITPFVYCV 141

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
           F +   + +GP + +S+ V + +  ++    +   I   +V + L+   +IL+I  G+ R
Sbjct: 142 FGSVPQMIVGPESAISLVVGQAVEKLVTHNEKVGTINISVVVTFLS--GAILLI-FGITR 198

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKINTRV-ETYRVLISTLKHL---N 304
           LGF+  ++S   + GF++   L ++ + L + L + K+   V E Y      ++ L    
Sbjct: 199 LGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEKVQFLFKYG 258

Query: 305 GSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFV 364
             +++    ++ L   F    T  +L  KL+ +Y           +S  F+ +       
Sbjct: 259 PENLHKPTAILSLCS-FIILMTLRFLKKKLMKRY-----------KSVIFFPE------- 299

Query: 365 LFLATFVSWLVIGRH---KKKTSISVLGTVP-SGLKHVGVPTIPS--GLVHKLMPQLPPA 418
             L   +S L+I  +   KK   IS+LG    SG   +  P       L H+L+      
Sbjct: 300 -ILLIVISSLIISVNFNLKKDFDISMLGDFSTSGFDKLNNPLGKDNRSLCHELLSVGLMC 358

Query: 419 VIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKC 478
            I+   E  T +KS G I +  I  ++EL+A+G  NL+GS F A P+ G + RS + A  
Sbjct: 359 AILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLFGALPSFGGYGRSKINALS 418

Query: 479 NVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLI--ASYKLSFYLWNT 536
             +T +SG   G   L  + +L    +Y P   LS +     + L+  A   + F++   
Sbjct: 419 GAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCH 478

Query: 537 NPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFL------------- 583
              +LI F    + TI  S+E GI     +S+ +++  +A    + L             
Sbjct: 479 GYNELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRIQILTRVIGTNQFVPVD 538

Query: 584 GY---VKITEVSNLNVFEDLDSIGNNDPELPQEISKDSKLAKDPDVHASANLMASKLDVR 640
           GY   +K  ++   +  E+LD     D  L  +I +        D+    N +     VR
Sbjct: 539 GYYPGLKTIDLRESSALEELD-----DSTLIVKIPEPLTFTNTEDLKERLNRLERFRSVR 593

Query: 641 FHTKWVPLDN 650
            H    PL N
Sbjct: 594 IHPGRRPLHN 603

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  132 bits (333), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 128/477 (26%), Positives = 217/477 (45%), Gaps = 44/477 (9%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   W+ +YN +    D IAG+++    +P ++S+A  +A ++P  GLYS     FIY+ 
Sbjct: 91  PFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYAI 150

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
             +   + +GP + +S+ V + +  +I   P+   +    +++ +   S   +   GL R
Sbjct: 151 LGSVPQMIVGPESAISLVVGQAVEKMISHNPD---LHTLQLSAVITFISGGFLFFFGLCR 207

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKI--------NTRVETYRVLISTL 300
           LGF+  ++S   + GF++   L ++ + + S   + KI        +T  E    L++  
Sbjct: 208 LGFLGNVLSRALLRGFISSVGLVMIINSMISEFKLDKILKDLPVHYHTPFEKILFLVTYA 267

Query: 301 KHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALR 360
            + N      A  L C  +L   K         +I K L P  +    W  F      + 
Sbjct: 268 PN-NYHGPTTALSLSCFFILIMTK---------IIKKKLMPRCR----WIVF------VP 307

Query: 361 NAFVLFLAT-FVSWLVIGRHKKKTSISVLGTVPS-GLKHVGVPTIPSGLVHKLMPQLPPA 418
           +  +L + T F+S  +  R K   SIS +G   + GL  +  P   S     L+PQL  A
Sbjct: 308 DILLLIIGTIFLS--IKYRFKHNYSISTVGDFNTKGLDKLLNPL--SAENRGLIPQLLSA 363

Query: 419 VIILLL----EHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSAL 474
             I  +    E  T +KS G   +  I  ++EL+A+G  NL  S   + PA G + RS +
Sbjct: 364 GFITAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSILGSLPAFGGYGRSKI 423

Query: 475 KAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLI--ASYKLSFY 532
            A    +T +SG F G  VLL + +L    +YIP   LS V     + L+  A   L F+
Sbjct: 424 NAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVGISLLEEAPADLMFH 483

Query: 533 LWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKIT 589
                  +L+ F  T+L T+F S+E GI     +S+ +++  +A    + L  V+ T
Sbjct: 484 FRCFGYDELLVFTLTVLTTMFYSVEVGICIGCGYSVISIIKHSAKSRIQILARVQGT 540

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  126 bits (317), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 132/487 (27%), Positives = 235/487 (48%), Gaps = 31/487 (6%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   WI  Y +  + SDF+AGI++    +P ++SYA  +A ++P  GLYS  I  FIY+ 
Sbjct: 90  PCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYAV 149

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
           F +   + +GP + +S+ V + +  +       + +    ++  L   S   ++ +G+LR
Sbjct: 150 FGSVPQMIVGPESAISLVVGQSVELLKSH---DSALEIINISVVLTFISGAALLILGILR 206

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKINTRVETYRVLISTLK-HLNGSD 307
           LGF+  ++S + + GF++   L ++   L + L + K          L++ LK H + S 
Sbjct: 207 LGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNK----------LLAGLKVHCHTSF 256

Query: 308 INAAFGLICLALLFFWKWTCGYLGPKLISKY-LRPNSKKARIWQSFFFYAQALRNAFVLF 366
               F LI  A   + K T        ++ + +R   K+      +  +   +    ++ 
Sbjct: 257 EKVQF-LIKYAPTNYHKPTALLSAIAFVTLFSIRLLKKRWMAKHRWLAFIPEILMVVIIS 315

Query: 367 LATFVSWLVIGRHKKKTSISVLGTVPS-GLKHVGVPTIPSGLVHKLMPQL-PPAVIILLL 424
           +    +W      KK+  I ++G   +  +  +  P   S    K+MPQL    V+I LL
Sbjct: 316 IYLSATW----EFKKQYGILIVGDFNTHAIDKLKNPI--SKENRKIMPQLLNTGVLISLL 369

Query: 425 ---EHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVK 481
              E +T +KS G   +  I  ++EL+A+G  N+I S F A P+ G + RS + A    K
Sbjct: 370 GFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSK 429

Query: 482 TPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLI--ASYKLSFYLWNTNPF 539
           T +SG+F G+  L+ + YL    +YIP   LS +     + L+  A  +L F+       
Sbjct: 430 TVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYD 489

Query: 540 DLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKIT-EVSNLNVFE 598
           +L  F  T+L T+  S+E GI     +S+ +++  +A    + LG V+ T E +N++ + 
Sbjct: 490 ELFVFAITVLATLLYSVEMGICIGCGYSIISIVKHSAKSRIQILGRVQGTREFANIDEYL 549

Query: 599 DLDSIGN 605
           D D IG+
Sbjct: 550 DSDPIGD 556

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 130/504 (25%), Positives = 221/504 (43%), Gaps = 45/504 (8%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   W+  Y F  ++ D IAGI++    +P ++SY   +A + P  GLYS  I  F+Y  
Sbjct: 96  PCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYGI 155

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGT----PITAPMVASALALFSSILVIPI 244
             +   + +GP + +S+ V + +  +       +     I    V+ A+ LFS       
Sbjct: 156 LGSVPQMIVGPESAISLVVGQAVESITLHKDNVSLIDISIVITFVSGAILLFS------- 208

Query: 245 GLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKINTRVETYRVLISTLKHLN 304
           G+ R GF+  ++S   + GF++   L ++ + L S L + K          L+S  +H +
Sbjct: 209 GISRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKF---------LVSLPQHYH 259

Query: 305 GSDINAAFGLICLALLFFWKWTCGYLGPK-LISKYLRPNSKK-ARIWQSFFFYAQALRNA 362
            +       LI  A   + K T  + G   +I   +R   KK  +  +S  F+   L   
Sbjct: 260 -TPFEKVLFLIDYAPAQYHKPTAIFSGCCFIILIVMRLLKKKLMKRHKSAVFFPDILLVV 318

Query: 363 FVLFLATFVSWLVIGRHKKKTSISVLGTVPSGLKHVGVPTIPSGLVH---KLMPQLPPAV 419
            V  L +    L     K++  IS++G             + + L H   KLMP L  A 
Sbjct: 319 IVTILISMKLSL-----KQRYGISIVGD----FSMDNFDKLKNPLTHSRRKLMPDLFSAS 369

Query: 420 IILLL----EHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALK 475
           +I+ +    E  T +KS G   N  +  ++EL+A+G  N+  S F A P+ G + RS + 
Sbjct: 370 LIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYGRSKIN 429

Query: 476 AKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASY--KLSFYL 533
           A    ++ +SG+F G   L+ +  L    +YIP   LS +     + L+      + F+L
Sbjct: 430 ALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKFHL 489

Query: 534 WNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSN 593
                 +L  F  T  +TIF SIE+GI     +S+  ++  +A    + L   +I   SN
Sbjct: 490 QCGGYSELFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRIQILA--RIAGTSN 547

Query: 594 LNVFED-LDSIGNNDPELPQEISK 616
               +D L +   N P +   I +
Sbjct: 548 FTNLDDYLRTTKKNPPAVEGRIEE 571

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score =  123 bits (309), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 127/478 (26%), Positives = 211/478 (44%), Gaps = 46/478 (9%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   WI  Y ++    D +AGIT+    +P ++SYA  LA ++P  GLYS     FIY+ 
Sbjct: 83  PCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYSLAFTPFIYAI 142

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALF-SSILVIPIGLL 247
           F +   + +GP + +S+    V+   +++L       + M  S L  F S + +   G+ 
Sbjct: 143 FGSVPQMIVGPESAISL----VVGQAVEKLRAHNHEISTMSISVLVTFISGMFLFVFGIC 198

Query: 248 RLGFILELISVTAVAGFMTGSALSILASQLPSLLGIQ--------KINTRVETYRVLIST 299
           R GF+  ++S   + GF++   + ++ + L S L +           +T  +  R +I  
Sbjct: 199 RFGFLGNVLSRALLRGFISSVGVVMIVNSLISELKLHKLLLETKGHFHTPFQKIRFIIK- 257

Query: 300 LKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQAL 359
               N     A   L C  +L         +  ++I K L     + R W  F      L
Sbjct: 258 YAPANYHIPTAVLSLTCFIIL---------VTARVIKKKL----MRRRRWPVFVPEILIL 304

Query: 360 RNAFVLFLATFVSWLVIGRHKKKTSISVLGTVPS-GLKHVGVPTIPSGLVHKLMPQLPPA 418
               ++    F       + KK   IS++G   + GL +   P   S    +L P L  A
Sbjct: 305 IITTIILSHKF-------KFKKHYEISIVGDFDTDGLVNFYNPISKSN--RELAPNLMNA 355

Query: 419 ----VIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSAL 474
                I+   E  T AKS G    + I  ++EL+A+G  NL  S   A PA G + RS +
Sbjct: 356 GFIVAILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGALPAFGGYGRSKI 415

Query: 475 KAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLI--ASYKLSFY 532
            +    +T +SG+  G  VLL + +  S   YIP   LS +     + L+  A   L F+
Sbjct: 416 NSFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLEEAPADLRFH 475

Query: 533 LWNTNPFD-LISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKIT 589
            +N+  +D L+ F  T+L T F S+E G+     +S+ +++  +A    + L  V+ T
Sbjct: 476 -FNSRGYDELLVFAVTVLTTFFYSLEMGVCIGCGYSVISIIKHSAKSRIQILARVEST 532

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  123 bits (309), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 122/481 (25%), Positives = 211/481 (43%), Gaps = 34/481 (7%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   W+  Y F  ++ D IAGI+V    +P ++SY   +A + P  GLYS  I  F+Y  
Sbjct: 106 PCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYGI 165

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
             +   + +GP + +S+ V + +  +       + I    +++ +   S  +++  G+ R
Sbjct: 166 LGSVPQMIVGPESAISLVVGQAVESITLHKENVSLID---ISTVITFVSGTILLFSGISR 222

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKINTRVETYRVLISTLKHLNGSDI 308
            GF+  ++S   + GF++   L ++ + L S L + K          L+S  +H + +  
Sbjct: 223 FGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKF---------LVSLPQHYH-TPF 272

Query: 309 NAAFGLICLALLFFWKWTCGYLGPKLISKYLRP--NSKKARIWQSFFFYAQALRNAFVLF 366
                LI  A   +   T  + G  LI  +L      K  +  +S  F+   L    V  
Sbjct: 273 EKILFLIDYAPAQYHIPTAIFSGCCLIVLFLTRLLKRKLMKYHKSAIFFPDILLVVIVTI 332

Query: 367 LATFVSWLVIGRHKKKTSISVLGTVP-SGLKHVGVP-TIPSGLVHKLMPQLPPAVIILLL 424
           L +    L     K +  IS++G         +  P T P     KL+P L  A +I+ +
Sbjct: 333 LISMKFNL-----KHRYGISIIGDFSMDNFDELKNPLTRPR---RKLIPDLFSASLIVAM 384

Query: 425 ----EHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNV 480
               E  T +KS G   N  +  ++EL+A+G  N++ S F A PA G + RS + A    
Sbjct: 385 LGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYGRSKINALSGA 444

Query: 481 KTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASY--KLSFYLWNTNP 538
           ++ +SG+F G   L+ +  L    +YIP   LS +     + L+      + F+L     
Sbjct: 445 QSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGF 504

Query: 539 FDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFE 598
            +L  F  T   TIF SIE GI     +S+  ++  +A    + L   ++   SN    +
Sbjct: 505 SELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILA--RVAGTSNFTNLD 562

Query: 599 D 599
           D
Sbjct: 563 D 563

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 129/530 (24%), Positives = 227/530 (42%), Gaps = 73/530 (13%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   W+ +Y       D  AG++V    +P ++SYA  LA ++P  GLYS  I  FIY+ 
Sbjct: 61  PCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVEPLSGLYSLAITPFIYAI 120

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
           F +   + +GP + +S+ V + +  +++     + I+  +V +     S   ++ +G+ R
Sbjct: 121 FGSVPQMIVGPESAISLVVGQAVEPMVNHDERISTISISIVVT---FISGSFLLFLGIFR 177

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKI--------NTRVETYRVLISTL 300
           LGF+  ++S   + GF+      ++ + L S L + K+        +T  E    LI   
Sbjct: 178 LGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATSPEHYHTPFEKILFLIKYG 237

Query: 301 KHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALR 360
           +H N     A   L    +L   K                    K R+ + F        
Sbjct: 238 QH-NYHAPTAILSLYSFIILMLMKVM------------------KKRLMKRF-------- 270

Query: 361 NAFVLF----LATFVSWLVIGRH---KKKTSISVLGTVP-SGLKHVGVPTIPSGLVHKLM 412
             +V+F    L   V  ++   H   K K  IS++G    +G   +  P   +  +  L 
Sbjct: 271 -KWVIFVPEILIVIVGTIMFSFHFDIKHKFDISIIGDFKVNGFDSLHNPLDKTNRL-LLK 328

Query: 413 PQLPPAVIILLL---EHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSF 469
           P L   ++  +L   E  T +K+ G   +  +  ++EL+A+G  N++GS F A PA G +
Sbjct: 329 PLLDAGIVCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSMNIVGSLFGALPAFGGY 388

Query: 470 SRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLI----A 525
            RS + A    +T +SG+  G+  L  + +     +  P   LS  ++ +VV L     A
Sbjct: 389 GRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLS--VVTSVVGLTLLEEA 446

Query: 526 SYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGY 585
              L FY  +    +LI    T + TIF S+E GI     +S+ +++  +A    + L  
Sbjct: 447 PTDLKFYFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYSIISIIKHSAQSRIQILAK 506

Query: 586 VKITEVSNLNVFEDLDSIGNNDPE----------LPQEISKDSKLAKDPD 625
            K       N F + D +G  D E          L +++ +D  + K P+
Sbjct: 507 RK-----GDNRFSNADELGIFDGENNNNNTFFEPLLEDLDEDRLVVKIPE 551

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  119 bits (298), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 140/574 (24%), Positives = 240/574 (41%), Gaps = 78/574 (13%)

Query: 46  DYTRFKTNEDSAGYSGAENERSRI-----DKFDSVGS-SLQFAKYDGNALPDFKAPPYYE 99
           DY +  +   S  + G  N  S +      +F+S  S S   + YD N +  F+  PYY 
Sbjct: 38  DYDKDSSKYQSRTHVGTSNSASEVFPVNVSRFESFNSMSNNDSVYDNNTI--FETVPYY- 94

Query: 100 TTVTFMEYYDRTIRSRVGXXXXXXXXXXXXPIIKWIHHYNFAWMYSDFIAGITVGCVLVP 159
                                         P   W+  Y F  ++ D IAGI++    +P
Sbjct: 95  -----------------------------LPCFSWLPEYTFNKLWGDIIAGISLASFQIP 125

Query: 160 QSMSYA-QLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQL 218
            ++SY   +A + P  GLYS  I  F+Y    +   + +GP + +S+ V + +  +    
Sbjct: 126 LALSYTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHK 185

Query: 219 PEGT----PITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILA 274
              +     +    V+ A+ LFS       G+ R GF+  ++S   + GF++   L ++ 
Sbjct: 186 DNVSLIDISVVITFVSGAILLFS-------GISRFGFLGNVLSKALLRGFISSVGLVMII 238

Query: 275 SQLPSLLGIQKINTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKL 334
           + L S L + K          L+S  +H + +       LI  A   + K T  + G  L
Sbjct: 239 NALISELKLDKF---------LLSLPQHYH-TPFEKVLFLIDYAPAQYHKPTAIFSGCCL 288

Query: 335 ISKY-LRPNSKKARIWQ-SFFFYAQALRNAFVLFLATFVSWLVIGRHKKKTSISVLGTVP 392
           I  + +R   KK      S  F+   L    V+ +A F+S     +H+    I+++G   
Sbjct: 289 IVLFSMRLLKKKLVKHHKSAIFFPDIL---LVVIVAIFISMKFSLKHRY--GITIIGDFS 343

Query: 393 -SGLKHVGVPTIPSGLVHKLMPQLPPAVIILLL----EHITIAKSFGRINNYKIVPDQEL 447
                 +  P   S    KL+P L  A +I+ +    E  T +KS G   N  +  ++EL
Sbjct: 344 MDNFDKLKNPFTHSR--RKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNREL 401

Query: 448 IAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYI 507
           +A+G  N++ S F A P+ G + RS + A    ++ +SG+F G   L+ +  L    +YI
Sbjct: 402 VALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQFVHYI 461

Query: 508 PKAALSAVIIHAVVDLIASY--KLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVA 565
           P   LS +     + L+      + F+L      +L  F  T  +TI  SIE GI     
Sbjct: 462 PNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGVTILCSIEAGICIGCV 521

Query: 566 FSMATLLMKNAFPSGKFLGYVKITEVSNLNVFED 599
           +S+  ++  +A    + L   ++   SN    +D
Sbjct: 522 YSILNIIKHSAKSRIQILA--RVAGTSNFTNLDD 553

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 107/463 (23%), Positives = 210/463 (45%), Gaps = 42/463 (9%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P + W+ +Y    +  D +AGIT+    +P ++SYA  +A + P  GLY+  +  F Y+ 
Sbjct: 111 PCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAVSPFFYAI 170

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
           F ++  + +GP   +S+ + + +       P+  PI   ++  A+ L S  +++  G+ R
Sbjct: 171 FGSTPQMIVGPEGAISLVIGQCVQSCKKHNPDLDPI---LIVIAVTLISGTILLISGIFR 227

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKINTRVETYRVLISTLKHLNGSDI 308
           LG++  +++   + GF+      ++   L + L +  I         L  T +H N    
Sbjct: 228 LGYLGNILNKALLHGFIGSVGFVMIIDSLINELKLGDI---------LADTPEHYNTP-- 276

Query: 309 NAAFGLICLALLFFWKWTCG--YLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLF 366
                   L ++F WK+     ++   LIS          R ++    +    R+ +++F
Sbjct: 277 -------FLKIVFLWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMH----RHRWLIF 325

Query: 367 LATFV---SWLVIGRHK----KKTSISVLGTVPSG---LKHVGVPTIPSGLVHKLMPQLP 416
           +   +   + ++I  +K        I +LG   S    + H  +     GL+H +     
Sbjct: 326 IPEILIVLTTVLILSYKLDFADTYDIDILGDFKSNENSIFHNPLSNKNRGLIHVVFNIGI 385

Query: 417 PAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKA 476
              I    E  T +K+ G  +   +  ++EL+A+G++N++ S   A P+ G + RS + A
Sbjct: 386 ITAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGALPSFGGYGRSKINA 445

Query: 477 KCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASY--KLSFYLW 534
               KT LSG+F G   +LA+ +L    +YIP   LS +       L+     ++SF+ W
Sbjct: 446 LSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLEEIPKEVSFH-W 504

Query: 535 NTNPF-DLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNA 576
               + +L   + T + +IF S+E  +Y    +S+  ++  +A
Sbjct: 505 RCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYSILNIIKHSA 547

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 131/506 (25%), Positives = 231/506 (45%), Gaps = 63/506 (12%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P ++W+  YN +  +SD I+GI++    +P ++SYA  +A +KP  GLYS  I   IY  
Sbjct: 115 PCLRWLPIYNCSDFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITPVIYGI 174

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQL--------PEGTPITAPMVASALALFSSIL 240
             +   + +GP   +S+    V+   +D+L         E   I+   ++  +   S ++
Sbjct: 175 LGSVPPMIVGPEGAISL----VVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGLV 230

Query: 241 VIPIGLLRLGFILELIS-------VTAVAGFMTGSALSILASQLPSLL--GIQKINTRVE 291
           +   GLLRLGF+  ++S       +++V G M   AL I   +L  +L    +  +T  E
Sbjct: 231 LFICGLLRLGFLGSVLSKPLLRSFISSVGGVMVIDAL-ITEMKLNCILIDNDRHYHTAFE 289

Query: 292 TYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQS 351
               +I    + N         ++C ++L+F +    Y   K I K+           +S
Sbjct: 290 KIMFIIKYAPN-NFHKPTTVLSVVCFSILYFVR----YCKKKYIIKH-----------KS 333

Query: 352 FFFYAQALRNAFVLFLATFV---SWLVIGRHKKKTSISVLGTVPSGLKHVGVPTIPSGLV 408
             F  + L    ++ ++T +   S+      K    IS++G V S   ++    + + L 
Sbjct: 334 LIFLPEIL----IVVISTGILSASY----NFKDNYGISIIGDVNSNNSNLIAGNLQNPLS 385

Query: 409 ---HKLMPQLPP---AVIIL-LLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFN 461
               +L P L     A+  L   E  T +KS G      I  ++EL+A+GV NL  S   
Sbjct: 386 SSNKELFPILMNTGFAIAALGFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLG 445

Query: 462 AYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVV 521
             P+ G + RS + A    KT +SG+  G   +L + +L +  ++IP   LS +     +
Sbjct: 446 GLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGL 505

Query: 522 DLI--ASYKLSFYLWNTNPF-DLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFP 578
            LI  A  ++ F+ W    + +LI F  T   TIF S+E GI    ++S+ +++  +A  
Sbjct: 506 SLIEEAPGEVKFH-WRCKGYNELIIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKS 564

Query: 579 SGKFLGYVKITE--VSNLNVFEDLDS 602
             + LG +  +   V+  + FED D+
Sbjct: 565 RIQILGRIPGSRNFVNIDDYFEDTDN 590

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score =  116 bits (291), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 122/493 (24%), Positives = 208/493 (42%), Gaps = 58/493 (11%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   W+  Y F+ ++ D IAGI++    +P ++SY   +A + P  GLYS  I  F+Y  
Sbjct: 96  PCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYGV 155

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGT----PITAPMVASALALFSSILVIPI 244
           F +   + +GP + +S+ V + +  +       +     I    V+ A+ LFS       
Sbjct: 156 FGSVPQMIVGPESAISLVVGQAVESITLHKDNVSLIDISIVITFVSGAILLFS------- 208

Query: 245 GLLRLGFILELISVTAVAGFMTGSALSILASQLPSLLGI--------QKINTRVETYRVL 296
           G+ R GF+  ++S   + GF++   L ++ + L S L +        Q  +T  E    L
Sbjct: 209 GISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFL 268

Query: 297 IS---TLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFF 353
           I       H+      A F   CL +LF  +                   K  +  +   
Sbjct: 269 IDYAPAQYHMP----TAIFSGCCLIILFLMRLL---------------KRKLLKYHKGAI 309

Query: 354 FYAQALRNAFVLFLATFVSWLVIGRHKKKTSISVLGTVP-SGLKHVGVPTIPSGLVHKLM 412
           F+   L    V  L +    L     K +  I+++G         +  P   S    KL+
Sbjct: 310 FFPDILLVVIVTILISMKFDL-----KHRYGITIVGDFSMDNFDKLKNPLTRSR--RKLI 362

Query: 413 PQLPPAVIILLL----EHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGS 468
           P L  A +I+ +    E  T +KS G   N  +  ++EL+A+G  N++ S F A P+ G 
Sbjct: 363 PDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGG 422

Query: 469 FSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASY- 527
           + RS + A    ++ +SG+F G   L+ +  L    +YIP   LS +     + L+    
Sbjct: 423 YGRSKINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVP 482

Query: 528 -KLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYV 586
             + F+L      +L  F  T  +TIF SIE GI     +S+  ++  +A    + L   
Sbjct: 483 SDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGICIGCVYSILNIIKHSAKSRIQILA-- 540

Query: 587 KITEVSNLNVFED 599
           ++   SN    +D
Sbjct: 541 RVAGTSNFTNLDD 553

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  114 bits (284), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 128/477 (26%), Positives = 210/477 (44%), Gaps = 42/477 (8%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   WI  Y+      DFIAG+++    +P +MSYA  +A + P  GLYS      +Y+ 
Sbjct: 75  PCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYSLVFSPAVYTV 134

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
             +   + +GP + +S+ + + I   + + P+   I   +V   +   S ++++  GLLR
Sbjct: 135 LGSVPQMIVGPESAISLILGQAIEARLSEDPKLKAINICLV---ITFISGLVLLTGGLLR 191

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKIN-TRVETYR------VLISTLK 301
           LGF+  ++S   + GF++G  + ++ + L   L +  +  TR E Y       + I    
Sbjct: 192 LGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPFEKVLFIMKYG 251

Query: 302 HLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRN 361
             N     A   L+   +L   +      G K     L P+                   
Sbjct: 252 PENYHKPTAILSLVAFVILMSLRIFKKRYGKKFKWLVLLPDI------------------ 293

Query: 362 AFVLFLATFVSWLVIGRHKKKTSISVLGTVPS-GLKHVGVP--TIPSGLVHKLMPQLPPA 418
             V+ L+ FVS+ +    K +  I ++  +P   +KH+  P   +       L       
Sbjct: 294 LVVVALSIFVSYKM--HLKSRYGIEIINDIPKDSMKHLKNPFSNVNVATFKDLFSTGFMV 351

Query: 419 VIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKC 478
            ++   E  T +KS G   N  I  ++ELIA+G  N++GS F   PA G + RS + A  
Sbjct: 352 AMLGFFESATASKSLGTSYNLAISSNRELIALGSMNVVGSMFAILPAFGGYGRSKINAYS 411

Query: 479 NVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLI----ASYKLSFYLW 534
             +T +SG F G   L  + +L     YIP   LS  +I  VV L     A + L F+ W
Sbjct: 412 GAQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILS--VITTVVGLTLLEEAPHDLKFH-W 468

Query: 535 NTNPF-DLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKITE 590
               + +L  F  T+L T+F S+E GIY   A S+  ++  +A    + LG V  TE
Sbjct: 469 RCKGYSELTVFTVTLLATLFYSLEAGIYIGCACSIINVIKHSAKSRIQILGRVPGTE 525

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 110/474 (23%), Positives = 206/474 (43%), Gaps = 48/474 (10%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P + WI HY++   + D +AGI++    +P ++SYA  +A ++P  GLYS  I   IY+ 
Sbjct: 75  PCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPLIYAI 134

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
           F +   + +GP + +S+ V +          E + +T  M+   +   S +++  +G +R
Sbjct: 135 FGSVPQMIVGPESAISLVVGQATEKFSAHDSEISTVTITMM---ITFISGVVLFFLGSVR 191

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKINTRVETYRVLISTLKHLNGSDI 308
           LGF+  ++S   + GF++   L ++   + SL+   K+N ++               +D+
Sbjct: 192 LGFLGNILSKALLRGFISSVGLVMI---INSLIIELKLNHKL---------------ADV 233

Query: 309 NAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQAL------RNA 362
              +      ++F +++   Y        Y +P +  + I        +        R  
Sbjct: 234 AGHYHTPVGKIMFLFRYASEY--------YHKPTAILSLICFLVLISTRIAKKKLMNRYR 285

Query: 363 FVLF-----LATFVSWLVIGRHKKKTS--ISVLGTVPS-GLKHVGVPTIPS--GLVHKLM 412
           F++F     L   V+ L+  ++  K S  IS +G   + G   +G P       L   L 
Sbjct: 286 FLIFVPEILLVVSVTILLSLKYDFKHSYGISTIGEFNADGFGSIGNPLSNENRALYSSLW 345

Query: 413 PQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRS 472
            +     ++   E  T +KS G   N     ++ELIA+G  N++GS F A P+ G + RS
Sbjct: 346 NEGLAVAMLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYGRS 405

Query: 473 ALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLIASY--KLS 530
            +      KT +SG   G   LL    L    +Y P   LS +     + L+      + 
Sbjct: 406 KVNVFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSDIK 465

Query: 531 FYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLG 584
           F++  +   +L  F  T + T+  S+E G+     +S+  ++  +A    + L 
Sbjct: 466 FHIHCSGYSELTVFTLTFIATLSQSVELGVTVGCIYSLILIVKHSALSRIQILA 519

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 120/488 (24%), Positives = 206/488 (42%), Gaps = 47/488 (9%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   W+  Y+      D IAG ++    +P +MSY+  +A + P  GL +      +Y+ 
Sbjct: 86  PCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYAV 145

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
           F +   + +GP + +S+ V + I  +         +    +   L   S  ++   GL+R
Sbjct: 146 FGSVPHMIVGPESAISLVVGQAIEKLTKH---DASLNVTNLCVVLTFISGSILFSFGLMR 202

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKINTRVETYR-------VLISTLK 301
            GF+  ++S   + GF++   L ++ + L S L ++        +        V +    
Sbjct: 203 FGFLDSVLSRALLRGFISAVGLIMVINSLISELKLKDTFKNAPGHYHAPFQKVVFLVHYA 262

Query: 302 HLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISKYLRPNSKKARIWQSFFFYAQALRN 361
             N     A   L+C A L                       K  + ++   F+   L  
Sbjct: 263 PANYHLPTALVSLVCFAAL---------------GALKVIKKKLVKRFKKVIFFPDIL-- 305

Query: 362 AFVLFLATFVSWLVIGRHKKKTSISVLGTVPSGLKH-VGVPTIPSGLVHKLMPQLPPAVI 420
             V+  AT VS+      K + +I ++G + +G  + +  P     L  KL   L  A  
Sbjct: 306 -VVVAFATLVSYCY--DFKVRYNIDIVGDIETGSSNTIKNPISKDNL--KLFNDLFHAGF 360

Query: 421 ILLL----EHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKA 476
           ++ L    E  T +KS G   +  I  ++EL+A+G  NL+GS F A P+ G + RS + A
Sbjct: 361 LVALLGFFESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINA 420

Query: 477 KCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLI--ASYKLSFYLW 534
                T +SG+F G   L+   +L +A  +IP   LS +     + L   A   L F+  
Sbjct: 421 YSGAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKFHFR 480

Query: 535 NTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSG-KFLGYVKITEVSN 593
                +L++F  T+L T F S+E GI     +S+   + KN+  SG + LG      +S 
Sbjct: 481 CRGYNELLTFAITVLTTFFYSVEAGITLGCGYSIIRAI-KNSTQSGIQILG-----RISG 534

Query: 594 LNVFEDLD 601
            N F + D
Sbjct: 535 TNRFVNAD 542

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 112/474 (23%), Positives = 206/474 (43%), Gaps = 59/474 (12%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   W+  Y+ + +  DFIAG ++    +P +MSY+  +A + P  GL +     F+Y+ 
Sbjct: 71  PCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYAV 130

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
           F +   + +GP + +S+ V + I     Q+     +    +   L   S  ++   G++R
Sbjct: 131 FGSVPHMIVGPESAISLVVGQAIE---KQMKHDKSLDVVNLCLILTFISGAILFCFGIMR 187

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKINTRVETYRVLISTLKHLNGSDI 308
            G++  ++S   + GF++   L ++ + L + L ++K+      +               
Sbjct: 188 FGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGH--------------Y 233

Query: 309 NAAFGLICLALLFFWKWTCG-YLGP---------------KLISKYLRPNSKKARIWQSF 352
           +A F      L+F + +  G Y  P               +L+ K L      +R+++  
Sbjct: 234 HAPFQ----KLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRL------SRVYKKV 283

Query: 353 FFYAQALRNAFVLFLATFVSWLVIGRHKKKTSISVLGTVPSG-LKHVGVPTIPSGLVHKL 411
            F  + L    V+ L T  S+      K + +I ++G +  G       P     L   L
Sbjct: 284 IFVPEIL---IVVALVTLGSYHF--SFKLRYNIDIVGDIEVGDTSKFRNPLSKKNL--SL 336

Query: 412 MPQLPPAVIILLL----EHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATG 467
             +L  A  ++ L    E  T +KS G      +  ++EL+A+G  NL+GS F A P+ G
Sbjct: 337 FSELFHAGFMVALLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFG 396

Query: 468 SFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLI--A 525
            + RS + A     T +SG+F G    +   +L +A ++IP   LS +     + L   A
Sbjct: 397 GYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEA 456

Query: 526 SYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPS 579
              L ++       +L+ F  T+L T F S+E GI     +S+  ++ KN+  S
Sbjct: 457 PADLRYHFRCRGYNELLIFALTVLTTFFYSVEAGITLGCGYSVIRVI-KNSTKS 509

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 113/474 (23%), Positives = 205/474 (43%), Gaps = 51/474 (10%)

Query: 160 QSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLP 219
            S+S + LA L P  GLYS  I   IY    T     +GP  V+S+ V +       +  
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCEWWSHRSL 60

Query: 220 EGTPITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLPS 279
           E  P++     + +   S  ++  +G+ R+GFI   +S   + GF++  AL +L ++L  
Sbjct: 61  E--PLST---VAVIGCVSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELLP 115

Query: 280 LLGIQKI-----------NTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCG 328
            L ++++            T  E +R ++   K    SD             F W  +  
Sbjct: 116 ELKLEELYAHYVAQGYIGTTTWEKFRFILE--KAPENSDT------------FTWNLSLF 161

Query: 329 YLGPKLISKYLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVIGRHKKKTS---I 385
                +  +YL+ +  +   W+   F+ +         L   V  + +   +K +    I
Sbjct: 162 TFILLMTIRYLKRHLAEKCGWKKCIFFPE--------ILIVVVGSITLSNTQKWSELKGI 213

Query: 386 SVLGTVPSGLKHVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQ 445
            ++G +P    H+ VP        +L        ++ L E   + KS    +N     ++
Sbjct: 214 KIIGDIPPNSDHIKVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNVDASSNR 273

Query: 446 ELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFY 505
           EL+++GV NL+ S F+A PA G + RS +   C  +T  SG+F     ++ + +L +AF+
Sbjct: 274 ELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNAFH 333

Query: 506 YIPKAALSAVIIHAVVDLI--ASYKLSFYLWNTNPF-DLISFLATILLTIFSSIENGIYF 562
           ++P   L+ +I      L+  A   L FY W+   + +L  F+  ++ T+  S + G+  
Sbjct: 334 HLPICILAVIISTVAFSLLEEAPADLMFY-WSVGGYQELFIFIIIVVTTLVWSPQFGVTM 392

Query: 563 AVAFSMATLLMKNAFPSGKFLGYVKITEVSNLNVFEDLDSIGNNDPELPQEISK 616
            +  +M  LL  +     + LG   IT       F+++D   N+D  L +EI K
Sbjct: 393 GMCLTMIRLLKHSTRSRVQILGRDPIT-----YTFKNIDDDENSDIPL-EEIEK 440

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 94/195 (48%), Gaps = 5/195 (2%)

Query: 423 LLEHITIAKSFGRINNYKIVPDQELIAIGVTNLIGSFFNAYPATGSFSRSALKAKCNVKT 482
             E  T +KS G   +  +  ++EL+A+G  NLIGS F A P+ G + RS + A    +T
Sbjct: 379 FFESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQT 438

Query: 483 PLSGLFSGACVLLALYYLTSAFYYIPKAALSAVIIHAVVDLI--ASYKLSFYLWNTNPFD 540
            +SG   G   +  + +L     YIP   LS +     + L+  A   L F++      +
Sbjct: 439 VVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNE 498

Query: 541 LISFLATILLTIFSSIENGIYFAVAFSMATLLMKNAFPSGKFLGYVKIT-EVSNLNVFED 599
           LISF+ T+L T F S+E GI     +S+  ++  +     + LG +  T +  N + +E 
Sbjct: 499 LISFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSRIQILGKLAGTNKFVNADEYEG 558

Query: 600 LDSIGNN--DPELPQ 612
            +S      +P+L +
Sbjct: 559 KNSTSERRVNPQLEE 573

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 82/158 (51%), Gaps = 4/158 (2%)

Query: 130 PIIKWIHHYNFAWMYSDFIAGITVGCVLVPQSMSYA-QLAGLKPEYGLYSSFIGAFIYSF 188
           P   W+  Y+    + DFIAG+++    +P +MSYA  +A ++P  GLY+     F Y+ 
Sbjct: 98  PCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAFTPFFYAI 157

Query: 189 FATSKDVCIGPVAVMSVQVSKVISHVIDQLPEGTPITAPMVASALALFSSILVIPIGLLR 248
           F +   + +GP + +S+ V + I  +I   P  + +   ++   +   S +++   G+ R
Sbjct: 158 FGSVPQMIVGPESAISLVVGQAIEPMIRHDPSLSSLDLCVI---ITFISGVVLFTFGVFR 214

Query: 249 LGFILELISVTAVAGFMTGSALSILASQLPSLLGIQKI 286
            GF+  ++S   + GF++   + ++ + L   L ++K+
Sbjct: 215 FGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKV 252

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,094,841
Number of extensions: 4020245
Number of successful extensions: 11712
Number of sequences better than 10.0: 53
Number of HSP's gapped: 11811
Number of HSP's successfully gapped: 64
Length of query: 874
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 756
Effective length of database: 39,950,811
Effective search space: 30202813116
Effective search space used: 30202813116
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)