Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_42988.272ON67867831090.0
AGR076C8.272ON68667012721e-166
SAKL0H16808g8.272ON65766711391e-147
TDEL0F039908.272ON63167010251e-130
Kpol_543.448.272ON64366210121e-128
KLTH0G13464g8.272ON5936059931e-126
Kwal_56.237548.272ON5896109861e-125
ZYRO0C01430g8.272ON5906119821e-124
KLLA0A04631g8.272ON5795019421e-118
TPHA0A017508.272ON6366359281e-115
TBLA0F030408.272ON9064768981e-108
Kwal_26.6669singletonON5904888671e-107
KLLA0F17776gna 1ON5535065974e-68
SAKL0C02178gsingletonON5655115643e-63
SAKL0E04246gna 1ON5654285371e-59
Kwal_26.6697singletonON5774893452e-33
KLTH0E16720gsingletonON5745133256e-31
SAKL0A07480gsingletonON5733173256e-31
KLTH0H05456gna 2ON5683203132e-29
CAGL0J01375g2.473ON5643132991e-27
Kwal_14.1585na 2ON5703192982e-27
SAKL0E02992g2.473ON5703162954e-27
ZYRO0G03234g2.473ON5622912945e-27
NCAS0A078102.473ON5683162911e-26
Kpol_467.242.473ON3703152803e-26
Smik_13.2722.473ON5613152848e-26
Smik_4.3638.272ON7655002878e-26
Suva_13.2652.473ON5613142849e-26
YMR088C (VBA1)2.473ON5623152831e-25
Skud_13.2442.473ON5623152821e-25
TDEL0A024902.473ON5543152822e-25
NDAI0H022002.473ON5713172768e-25
ZYRO0A00330gsingletonON5761982714e-24
Ecym_73992.473ON5631442661e-23
KNAG0E025602.473ON5783162662e-23
Skud_2.423na 3ON5603962652e-23
TDEL0C00120singletonON5694902634e-23
Smik_2.434na 3ON4744212571e-22
Skud_4.3798.272ON7594922583e-22
Suva_2.2798.272ON7755852564e-22
KLLA0F13684g2.473ON5711572545e-22
TPHA0G031502.473ON6001442537e-22
Suva_4.553na 3ON5621802455e-21
Kwal_26.77552.473ON5593242332e-19
ABL040W2.473ON5671572323e-19
YDR119W (VBA4)8.272ON7685082306e-19
YBR293W (VBA2)na 3ON4743012242e-18
ZYRO0G21890gsingletonON5761082243e-18
KLTH0D05434g2.473ON5763132135e-17
ZYRO0G21868gna 2ON6201081984e-15
SAKL0A08228gsingletonON5691531851e-13
KLTH0C10120gsingletonON6511431725e-12
SAKL0C05588gsingletonON6771671645e-11
YPR198W (SGE1)singletonON5431441635e-11
NCAS0C03460na 4ON6301431602e-10
Skud_16.503singletonON5431431564e-10
Smik_17.11singletonON5441441564e-10
KLTH0C10142gsingletonON5731431547e-10
KLTH0D16962gsingletonON5711401548e-10
SAKL0B12716gsingletonON6322001502e-09
KLTH0B00132gsingletonON5683431493e-09
Kpol_1053.243.84ON6201421466e-09
TPHA0A006203.84ON6341651441e-08
TBLA0B083103.84ON6381421441e-08
KLTH0B00594gsingletonON6181431432e-08
SAKL0A00726gsingletonON5981671432e-08
CAGL0I07447g3.84ON5701381412e-08
SAKL0C09350g3.84ON5781401386e-08
SAKL0F00198gsingletonON5371991369e-08
KLTH0B10142gsingletonON5683441361e-07
KNAG0K006303.84ON6181491361e-07
TDEL0G03260singletonON6121701361e-07
NCAS0C047603.84ON6071401361e-07
NCAS0I025203.84ON5871401351e-07
Skud_7.560na 4ON6421431351e-07
Kwal_14.728singletonON5681661342e-07
YKR105C (VBA5)singletonON5821781342e-07
TDEL0D054003.84ON5851431332e-07
SAKL0C11066gsingletonON5801281333e-07
Kwal_26.9616singletonON5621401323e-07
Suva_9.712.241ON5612291323e-07
KNAG0K01020singletonON5991441323e-07
NDAI0A071103.84ON6021401324e-07
Suva_15.623.84ON6091401314e-07
Smik_16.81na 4ON6251431305e-07
YGR224W (AZR1)na 4ON6131431305e-07
ZYRO0A01474g2.242ON5381371281e-06
CAGL0E04092gna 5ON6452921271e-06
YOL103W (ITR2)3.84ON6091401271e-06
YIL120W (QDR1)2.242ON5631431262e-06
Smik_15.543.84ON6111401262e-06
KLLA0D19941gsingletonON6111951262e-06
Kpol_2002.865.180ON6361301262e-06
TDEL0C045802.241ON5571431252e-06
Skud_15.513.84ON5871401252e-06
TBLA0A085304.30ON6151441252e-06
TBLA0A08510singletonON6331441253e-06
Kwal_33.150205.180ON5971301224e-06
KLLA0C12309g3.84ON5691331216e-06
KLTH0C09372g3.84ON6081281226e-06
TBLA0A08520singletonON6321381217e-06
Smik_4.7743.84ON5841331209e-06
TBLA0E038002.242ON6081431209e-06
YIL121W (QDR2)2.241ON5421331209e-06
NCAS0B064802.241ON5871431209e-06
AER339C8.723ON5731271181e-05
CAGL0G08624g2.242ON5831451182e-05
Suva_9.702.242ON5651441182e-05
KNAG0G028308.723ON6771461182e-05
Smik_9.482.241ON5911431182e-05
KAFR0C014803.84ON5771321172e-05
ZYRO0B00990g4.30ON5921811172e-05
KLTH0G09350g2.241ON5631461172e-05
Smik_9.492.242ON5421431162e-05
CAGL0E03674g4.30ON5771791172e-05
YDR497C (ITR1)3.84ON5841331162e-05
YNL065W (AQR1)2.242ON5861571162e-05
NCAS0G029902.242ON5811391163e-05
Kwal_23.48142.241ON5291351163e-05
Skud_4.7713.84ON5841331163e-05
TPHA0E032005.180ON6261501153e-05
Skud_9.482.241ON5991351144e-05
Kwal_56.227243.84ON5781241144e-05
KLLA0E09879gsingletonON6301391145e-05
TBLA0E037902.241ON5501351136e-05
Kpol_1003.112.241ON5811431127e-05
CAGL0B02079gna 4ON6241421127e-05
KLTH0B03894g5.180ON6061301127e-05
NDAI0B037702.242ON5711841128e-05
Smik_14.2622.242ON5611541128e-05
TBLA0F00470singletonON7322651128e-05
YLL028W (TPO1)4.30ON5861291111e-04
CAGL0G03927g4.30ON5671801111e-04
KNAG0E01170singletonON5731431111e-04
KNAG0J02980singletonON6362721101e-04
Skud_18.3singletonON5901431101e-04
Suva_2.6743.84ON5791331101e-04
NCAS0C057804.30ON5671541082e-04
SAKL0F00792gsingletonON6172591082e-04
KAFR0I014004.30ON5891671082e-04
TPHA0C031002.241ON6021351082e-04
TDEL0A066708.723ON6251461082e-04
ZYRO0B06688g3.84ON5931401082e-04
Skud_14.2672.242ON5621571082e-04
Kpol_513.33singletonON6262441082e-04
Smik_11.368singletonON5801661082e-04
NCAS0C036002.242ON5721791082e-04
NDAI0F020606.155ON5021111082e-04
TBLA0E01970singletonON5781281083e-04
KLLA0E09021gna 6ON566971083e-04
Skud_12.384.30ON5871291073e-04
KAFR0J009302.242ON5661391073e-04
Suva_13.278.843ON5533241073e-04
NCAS0B004908.723ON6641321064e-04
TBLA0D011608.723ON6421301064e-04
KNAG0E01160singletonON5721431064e-04
Kpol_413.28.723ON6671321055e-04
KNAG0H031808.272ON677781055e-04
YOR273C (TPO4)8.723ON6591701055e-04
Smik_12.274.30ON5871291047e-04
TBLA0A03700singletonON5721281047e-04
SAKL0E08778g2.241ON6001511047e-04
TBLA0D05810singletonON5741331047e-04
KLTH0D12320g8.723ON5881281048e-04
KAFR0F043904.30ON5671291048e-04
Suva_14.2762.242ON5621571038e-04
TDEL0H04480na 6ON570971030.001
TBLA0A03460singletonON5681331030.001
KAFR0J016202.242ON5701351030.001
CAGL0L10912g8.723ON6511481030.001
Suva_10.434.30ON5871291020.001
TBLA0E015104.30ON6711381020.001
TPHA0K021604.30ON6081481020.001
TBLA0A08515singletonON6321121020.001
Skud_15.4388.723ON6591411020.001
TBLA0A03500singletonON5731411010.002
TBLA0A03430singletonON5641331010.002
Smik_15.4558.723ON6591421010.002
TBLA0D05800singletonON5741331010.002
Kwal_33.12950na 7ON5661351000.002
TPHA0F003304.30ON5841551000.002
TBLA0B00840singletonON6371331000.002
Kpol_1039.192.242ON5731391000.002
SAKL0H25498g4.30ON6021291000.002
NDAI0J012808.272ON6942801000.002
KNAG0I019102.242ON598139990.002
Suva_4.2singletonON57097990.003
ADL258W2.242ON534154990.003
Suva_8.3228.723ON652130990.003
KAFR0B039408.843ON547243990.003
KLTH0B00484gna 7ON566135990.003
KAFR0I01560singletonON632245980.004
NDAI0D048404.30ON639140980.004
AFR343C3.84ON571142980.004
KLTH0H05698g6.155ON503128970.004
YHL040C (ARN1)na 5ON627242980.004
Kpol_478.34.30ON580155970.005
ZYRO0G07414gsingletonON707249970.005
TDEL0B005508.843ON537314970.005
TPHA0G014308.723ON637147970.006
KLLA0F18106g4.30ON589155950.007
TBLA0F01600singletonON567115950.009
KLTH0B00110gsingletonON627240950.009
ZYRO0C00374gna 6ON564112950.009
TBLA0A03470singletonON578133950.009
KLTH0E10406g8.446ON733130950.010
SAKL0H05412g8.723ON580147940.010
TBLA0A033905.394ON574141940.010
TBLA0A03400singletonON574133930.013
YKR106W (GEX2)singletonON615249930.013
AFR602W3.23ON55885930.014
Ecym_7258na 8ON638178930.014
KLLA0C19272gsingletonON623245930.014
YML116W (ATR1)8.843ON542278930.015
YCL073C (GEX1)singletonON615249930.016
TBLA0A01240singletonON569133920.020
SAKL0E08756g2.242ON565129920.020
KNAG0I030804.30ON592129920.021
TBLA0G025502.242ON613136920.021
TBLA0A03420singletonON577128910.023
TBLA0C01040singletonON669297910.025
NDAI0I027703.503ON626112910.025
SAKL0G13376g5.180ON621133910.026
TBLA0A03450singletonON573128910.026
KLLA0B00352gna 9ON498149900.027
KNAG0B007303.503ON622123910.028
TBLA0A01250singletonON503133900.032
KLLA0E20945g3.23ON52885900.032
SAKL0E06864gna 6ON573134900.033
KLTH0G11154gna 6ON572100900.033
KAFR0E02030singletonON548102900.034
TDEL0A00150singletonON566135900.034
TBLA0A03480singletonON574119900.034
ZYRO0G21648g6.155ON488112900.034
CAGL0J09944g2.242ON592139900.035
Suva_8.12na 5ON633246900.036
KAFR0F02800singletonON551102890.038
KAFR0F04080singletonON549102890.041
KLTH0D00506gsingletonON616250890.041
NDAI0D05020singletonON57388890.041
Smik_8.1na 5ON627242890.044
TDEL0B019008.446ON687140890.044
TDEL0H01600singletonON604125890.045
TBLA0B10150singletonON571133890.045
NCAS0I03160singletonON57588890.047
TBLA0H00750singletonON484102880.049
NCAS0H012306.155ON489131880.049
TDEL0E044805.180ON616130880.057
SAKL0B00264gsingletonON519139870.064
ZYRO0D17864gsingletonON578135880.065
NOTE: 2 genes in the same pillar as Ecym_4298 were not hit in these BLAST results
LIST: NCAS0B03780 KAFR0B05450

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4298
         (678 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...  1202   0.0  
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...   494   e-166
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...   443   e-147
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...   399   e-130
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...   394   e-128
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...   387   e-126
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...   384   e-125
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...   382   e-124
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...   367   e-118
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...   362   e-115
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...   350   e-108
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...   338   e-107
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...   234   4e-68
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...   221   3e-63
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...   211   1e-59
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...   137   2e-33
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...   129   6e-31
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...   129   6e-31
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...   125   2e-29
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...   119   1e-27
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...   119   2e-27
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...   118   4e-27
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...   117   5e-27
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...   116   1e-26
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...   112   3e-26
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...   114   8e-26
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...   115   8e-26
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...   114   9e-26
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...   113   1e-25
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...   113   1e-25
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...   113   2e-25
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...   110   8e-25
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...   108   4e-24
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...   107   1e-23
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...   107   2e-23
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...   106   2e-23
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}        105   4e-23
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...   103   1e-22
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...   103   3e-22
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...   103   4e-22
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...   102   5e-22
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...   102   7e-22
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    99   5e-21
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    94   2e-19
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    94   3e-19
YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...    93   6e-19
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    91   2e-18
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    91   3e-18
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    87   5e-17
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    81   4e-15
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    76   1e-13
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    71   5e-12
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    68   5e-11
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    67   5e-11
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    66   2e-10
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    65   4e-10
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    65   4e-10
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    64   7e-10
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    64   8e-10
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    62   2e-09
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    62   3e-09
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    61   6e-09
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...    60   1e-08
TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa] ...    60   1e-08
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    60   2e-08
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    60   2e-08
CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly...    59   2e-08
SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {...    58   6e-08
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    57   9e-08
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    57   1e-07
KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3....    57   1e-07
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               57   1e-07
NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84      57   1e-07
NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {O...    57   1e-07
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    57   1e-07
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    56   2e-07
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    56   2e-07
TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {O...    56   2e-07
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    56   3e-07
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    55   3e-07
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    55   3e-07
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    55   3e-07
NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa] ...    55   4e-07
Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W (...    55   4e-07
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    55   5e-07
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    55   5e-07
ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} simila...    54   1e-06
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    54   1e-06
YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}  ITR2Myo-i...    54   1e-06
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    53   2e-06
Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W (...    53   2e-06
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    53   2e-06
Kpol_2002.86 s2002 (201096..203006) [1911 bp, 636 aa] {ON} (2010...    53   2e-06
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    53   2e-06
Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {...    53   2e-06
TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4...    53   2e-06
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             53   3e-06
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    52   4e-06
KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} high...    51   6e-06
KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly...    52   6e-06
TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON}             51   7e-06
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    51   9e-06
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    51   9e-06
YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multid...    51   9e-06
NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa] ...    51   9e-06
AER339C Chr5 complement(1259842..1261563) [1722 bp, 573 aa] {ON}...    50   1e-05
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    50   2e-05
Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W (...    50   2e-05
KNAG0G02830 Chr7 complement(625263..627296) [2034 bp, 677 aa] {O...    50   2e-05
Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W (...    50   2e-05
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...    50   2e-05
ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON...    50   2e-05
KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} simila...    50   2e-05
Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W (...    49   2e-05
CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {...    50   2e-05
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...    49   2e-05
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    49   2e-05
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    49   3e-05
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    49   3e-05
Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {...    49   3e-05
TPHA0E03200 Chr5 complement(677352..679232) [1881 bp, 626 aa] {O...    49   3e-05
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    49   4e-05
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...    49   4e-05
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    49   5e-05
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    48   6e-05
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    48   7e-05
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    48   7e-05
KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {...    48   7e-05
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    48   8e-05
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    48   8e-05
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}               48   8e-05
YLL028W Chr12 (84804..86564) [1761 bp, 586 aa] {ON}  TPO1Polyami...    47   1e-04
CAGL0G03927g Chr7 complement(372896..374599) [1704 bp, 567 aa] {...    47   1e-04
KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON}               47   1e-04
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              47   1e-04
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    47   1e-04
Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {...    47   1e-04
NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa] ...    46   2e-04
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    46   2e-04
KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {O...    46   2e-04
TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.2...    46   2e-04
TDEL0A06670 Chr1 complement(1163596..1165473) [1878 bp, 625 aa] ...    46   2e-04
ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {...    46   2e-04
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    46   2e-04
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    46   2e-04
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    46   2e-04
NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {O...    46   2e-04
NDAI0F02060 Chr6 complement(505217..506725) [1509 bp, 502 aa] {O...    46   2e-04
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    46   3e-04
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    46   3e-04
Skud_12.38 Chr12 (75867..77630) [1764 bp, 587 aa] {ON} YLL028W (...    46   3e-04
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    46   3e-04
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    46   3e-04
NCAS0B00490 Chr2 complement(71160..73154) [1995 bp, 664 aa] {ON}...    45   4e-04
TBLA0D01160 Chr4 (296153..298081) [1929 bp, 642 aa] {ON} Anc_8.7...    45   4e-04
KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON}               45   4e-04
Kpol_413.2 s413 complement(4040..6043) [2004 bp, 667 aa] {ON} co...    45   5e-04
KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {O...    45   5e-04
YOR273C Chr15 complement(834452..836431) [1980 bp, 659 aa] {ON} ...    45   5e-04
Smik_12.27 Chr12 (69102..70865) [1764 bp, 587 aa] {ON} YLL028W (...    45   7e-04
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               45   7e-04
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    45   7e-04
TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa] ...    45   7e-04
KLTH0D12320g Chr4 complement(1001954..1003720) [1767 bp, 588 aa]...    45   8e-04
KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.3...    45   8e-04
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    44   8e-04
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    44   0.001
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     44   0.001
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    44   0.001
CAGL0L10912g Chr12 complement(1167086..1169041) [1956 bp, 651 aa...    44   0.001
Suva_10.43 Chr10 (89159..90922) [1764 bp, 587 aa] {ON} YLL028W (...    44   0.001
TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.3...    44   0.001
TPHA0K02160 Chr11 complement(461256..463082) [1827 bp, 608 aa] {...    44   0.001
TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possi...    44   0.001
Skud_15.438 Chr15 complement(773226..775205) [1980 bp, 659 aa] {...    44   0.001
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    44   0.002
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    44   0.002
Smik_15.455 Chr15 complement(784048..786027) [1980 bp, 659 aa] {...    44   0.002
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...    44   0.002
Kwal_33.12950 s33 complement(12899..14599) [1701 bp, 566 aa] {ON...    43   0.002
TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30 ...    43   0.002
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    43   0.002
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    43   0.002
SAKL0H25498g Chr8 complement(2229233..2231041) [1809 bp, 602 aa]...    43   0.002
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....    43   0.002
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    43   0.002
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       43   0.003
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    43   0.003
Suva_8.322 Chr8 complement(573995..575953) [1959 bp, 652 aa] {ON...    43   0.003
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    43   0.003
KLTH0B00484g Chr2 complement(51712..53412) [1701 bp, 566 aa] {ON...    43   0.003
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      42   0.004
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    42   0.004
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    42   0.004
KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} simila...    42   0.004
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    42   0.004
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    42   0.005
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    42   0.005
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...    42   0.005
TPHA0G01430 Chr7 (292540..294453) [1914 bp, 637 aa] {ON} Anc_8.7...    42   0.006
KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} simi...    41   0.007
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    41   0.009
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    41   0.009
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    41   0.009
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     41   0.009
KLTH0E10406g Chr5 (938423..940624) [2202 bp, 733 aa] {ON} weakly...    41   0.010
SAKL0H05412g Chr8 (486897..488639) [1743 bp, 580 aa] {ON} simila...    41   0.010
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    41   0.010
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...    40   0.013
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    40   0.013
AFR602W Chr6 (1523461..1525137) [1677 bp, 558 aa] {ON} Non-synte...    40   0.014
Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...    40   0.014
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...    40   0.014
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...    40   0.015
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    40   0.016
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    40   0.020
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    40   0.020
KNAG0I03080 Chr9 (617011..618789) [1779 bp, 592 aa] {ON} Anc_4.3...    40   0.021
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    40   0.021
TBLA0A03420 Chr1 (824716..826449) [1734 bp, 577 aa] {ON}               40   0.023
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               40   0.025
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     40   0.025
SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]...    40   0.026
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    40   0.026
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...    39   0.027
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    40   0.028
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}               39   0.032
KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weak...    39   0.032
SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} simila...    39   0.033
KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {...    39   0.033
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               39   0.034
TDEL0A00150 Chr1 (24714..26414) [1701 bp, 566 aa] {ON}                 39   0.034
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}               39   0.034
ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]...    39   0.034
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    39   0.035
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    39   0.036
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               39   0.038
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    39   0.041
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    39   0.041
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    39   0.041
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...    39   0.044
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    39   0.044
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    39   0.045
TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON}             39   0.045
NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON}               39   0.047
TBLA0H00750 Chr8 (171288..172742) [1455 bp, 484 aa] {ON} Anc_2.2...    39   0.049
NCAS0H01230 Chr8 (233917..235386) [1470 bp, 489 aa] {ON} Anc_6.155     39   0.049
TDEL0E04480 Chr5 complement(836068..837918) [1851 bp, 616 aa] {O...    39   0.057
SAKL0B00264g Chr2 (22039..23598) [1560 bp, 519 aa] {ON} similar ...    38   0.064
ZYRO0D17864g Chr4 (1481311..1483047) [1737 bp, 578 aa] {ON} some...    39   0.065
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       39   0.066
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    38   0.074
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    38   0.079
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    38   0.084
TBLA0B04810 Chr2 complement(1130085..1131812) [1728 bp, 575 aa] ...    38   0.094
KLTH0G18854g Chr7 complement(1628440..1629948) [1509 bp, 502 aa]...    38   0.10 
TBLA0A04910 Chr1 complement(1211111..1212838) [1728 bp, 575 aa] ...    37   0.11 
TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {O...    37   0.11 
NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa] ...    37   0.12 
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    37   0.13 
TBLA0J00100 Chr10 complement(1866..3590) [1725 bp, 574 aa] {ON}        37   0.13 
Ecym_6229 Chr6 complement(427712..429415) [1704 bp, 567 aa] {ON}...    37   0.14 
KLTH0E00132g Chr5 (3262..5010) [1749 bp, 582 aa] {ON} weakly sim...    37   0.15 
KLTH0A00440g Chr1 (37100..38848) [1749 bp, 582 aa] {ON} weakly s...    37   0.15 
Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}...    37   0.15 
TBLA0C01090 Chr3 (223890..226874) [2985 bp, 994 aa] {ON}               37   0.15 
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 37   0.15 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    37   0.16 
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...    37   0.16 
YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putativ...    37   0.16 
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...    37   0.17 
KAFR0A04120 Chr1 complement(828182..829957) [1776 bp, 591 aa] {O...    37   0.19 
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    37   0.19 
NCAS0E01350 Chr5 complement(261125..262696) [1572 bp, 523 aa] {O...    37   0.20 
Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W (...    37   0.20 
KNAG0I00110 Chr9 complement(5329..7020) [1692 bp, 563 aa] {ON}         37   0.20 
KNAG0E04270 Chr5 (849856..851529) [1674 bp, 557 aa] {ON}               37   0.22 
KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {...    37   0.22 
YOL156W Chr15 (25273..26976) [1704 bp, 567 aa] {ON}  HXT11Putati...    37   0.23 
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    37   0.25 
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    36   0.27 
TBLA0A03410 Chr1 complement(815181..816950) [1770 bp, 589 aa] {O...    36   0.27 
TDEL0E02280 Chr5 (438756..440519) [1764 bp, 587 aa] {ON} Anc_5.3...    36   0.28 
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    36   0.28 
Kwal_14.1625 s14 (395421..396941) [1521 bp, 506 aa] {ON} YBR241C...    36   0.30 
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    36   0.31 
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         36   0.32 
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...    36   0.37 
Smik_113.1 Chr113 complement(3..554) [552 bp, 184 aa] {ON} YOL15...    35   0.39 
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     36   0.39 
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    36   0.39 
Kpol_1014.21 s1014 (34471..36069) [1599 bp, 532 aa] {ON} (34471....    36   0.40 
Skud_96.1 Chr96 (1..624) [624 bp, 208 aa] {ON} YOL156W (REAL)          35   0.41 
ZYRO0A09878g Chr1 (800187..802235) [2049 bp, 682 aa] {ON} conser...    36   0.44 
KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...    36   0.44 
Skud_14.21 Chr14 complement(32206..33831) [1626 bp, 541 aa] {ON}...    35   0.46 
Ecym_1345 Chr1 (711048..712715) [1668 bp, 555 aa] {ON} similar t...    35   0.48 
TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432     35   0.51 
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    35   0.53 
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    35   0.54 
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    35   0.54 
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...    35   0.55 
TDEL0B03990 Chr2 (713794..715239) [1446 bp, 481 aa] {ON} Anc_6.1...    35   0.56 
KAFR0A08520 Chr1 (1708192..1709877) [1686 bp, 561 aa] {ON} Anc_3...    35   0.59 
SAKL0H12518g Chr8 complement(1064480..1066672) [2193 bp, 730 aa]...    35   0.59 
NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...    35   0.60 
CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly...    35   0.62 
CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {...    35   0.62 
Kwal_55.20064 s55 (235602..236315) [714 bp, 238 aa] {ON} YHR094C...    35   0.65 
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    35   0.65 
Kpol_281.2 s281 complement(3711..5390) [1680 bp, 559 aa] {ON} co...    35   0.67 
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    35   0.69 
Smik_6.68 Chr6 (125842..127482) [1641 bp, 546 aa] {ON} YFL011W (...    35   0.70 
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        35   0.71 
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    35   0.72 
KLLA0A07249g Chr1 complement(649905..651431) [1527 bp, 508 aa] {...    35   0.76 
Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094...    35   0.77 
ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly s...    35   0.85 
Smik_14.13 Chr14 complement(23204..24826) [1623 bp, 540 aa] {ON}...    35   0.85 
KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {O...    35   0.96 
KAFR0C00180 Chr3 (24352..26028) [1677 bp, 558 aa] {ON}                 35   0.96 
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               35   0.96 
Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W ...    35   0.97 
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}               35   0.98 
KAFR0D00790 Chr4 (168111..169796) [1686 bp, 561 aa] {ON}               35   1.00 
ZYRO0E03916g Chr5 complement(296502..298217) [1716 bp, 571 aa] {...    34   1.1  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...    34   1.1  
KAFR0D00800 Chr4 complement(170100..171776) [1677 bp, 558 aa] {O...    34   1.1  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    34   1.2  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...    34   1.2  
Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {...    34   1.2  
KNAG0D05370 Chr4 (984855..986225) [1371 bp, 456 aa] {ON}               34   1.2  
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    34   1.2  
YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}  HXT2High-...    34   1.2  
CAGL0M01672g Chr13 (186088..187731) [1644 bp, 547 aa] {ON} simil...    34   1.3  
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...    34   1.4  
Smik_2.384 Chr2 complement(688838..690304) [1467 bp, 488 aa] {ON...    34   1.4  
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    34   1.4  
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...    34   1.5  
TDEL0E00120 Chr5 (7519..9231) [1713 bp, 570 aa] {ON}                   34   1.5  
Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345...    34   1.5  
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     34   1.5  
KLTH0F15136g Chr6 (1240733..1242346) [1614 bp, 537 aa] {ON} simi...    34   1.5  
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...    34   1.6  
KNAG0M00610 Chr13 (97448..98857) [1410 bp, 469 aa] {ON} Anc_6.15...    34   1.6  
TDEL0E02310 Chr5 (450790..452493) [1704 bp, 567 aa] {ON} Anc_5.3...    34   1.6  
Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON...    34   1.6  
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    34   1.6  
NCAS0D03450 Chr4 complement(644151..645587) [1437 bp, 478 aa] {O...    34   1.7  
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...    34   1.7  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...    34   1.7  
Ecym_2262 Chr2 (515606..517051) [1446 bp, 481 aa] {ON} similar t...    33   1.7  
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    34   1.7  
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    33   1.8  
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...    33   1.9  
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...    33   1.9  
TDEL0A03330 Chr1 complement(590772..592421) [1650 bp, 549 aa] {O...    33   2.0  
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    33   2.1  
Suva_14.21 Chr14 complement(34919..36544) [1626 bp, 541 aa] {ON}...    33   2.1  
NCAS0A08630 Chr1 complement(1704322..1706103) [1782 bp, 593 aa] ...    33   2.1  
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    33   2.2  
Kwal_27.9678 s27 complement(14940..16481) [1542 bp, 513 aa] {ON}...    33   2.2  
Kpol_281.3 s281 complement(9070..10740) [1671 bp, 556 aa] {ON} c...    33   2.3  
KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {O...    33   2.3  
SAKL0D02508g Chr4 (197981..199720) [1740 bp, 579 aa] {ON} simila...    33   2.4  
Suva_4.501 Chr4 complement(873617..875086) [1470 bp, 489 aa] {ON...    33   2.5  
Suva_37.1 Chr37 complement(3..797) [795 bp, 265 aa] {ON} YFL011W...    33   2.6  
TBLA0E02520 Chr5 complement(632027..633718) [1692 bp, 563 aa] {O...    33   2.7  
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...    33   2.7  
KAFR0K00150 Chr11 complement(37495..39087) [1593 bp, 530 aa] {ON}      33   2.8  
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    33   2.8  
KLTH0C00462g Chr3 complement(49362..51074) [1713 bp, 570 aa] {ON...    33   2.8  
SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} simila...    33   2.8  
KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly...    33   2.8  
TBLA0E02500 Chr5 (628027..629757) [1731 bp, 576 aa] {ON}               33   2.9  
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    33   2.9  
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...    33   2.9  
KLTH0B00330g Chr2 (29891..31591) [1701 bp, 566 aa] {ON} highly s...    33   2.9  
NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {O...    33   3.0  
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    33   3.0  
KAFR0A05550 Chr1 complement(1107647..1109341) [1695 bp, 564 aa] ...    33   3.1  
TBLA0A07970 Chr1 (1971258..1972760) [1503 bp, 500 aa] {ON} Anc_5...    33   3.1  
NCAS0E00160 Chr5 complement(15851..17527) [1677 bp, 558 aa] {ON}       33   3.2  
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    33   3.3  
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       33   3.3  
KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.5...    33   3.5  
KNAG0E01630 Chr5 (327590..330055) [2466 bp, 821 aa] {ON} Anc_2.2...    33   3.6  
Suva_9.197 Chr9 (326927..327796) [870 bp, 289 aa] {ON} YFL011W (...    32   3.7  
Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON} ...    33   3.7  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    33   3.8  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    32   3.9  
TDEL0C00150 Chr3 (14725..16305) [1581 bp, 526 aa] {ON}                 32   3.9  
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    33   4.0  
KLTH0G19404g Chr7 (1672150..1673691) [1542 bp, 513 aa] {ON} weak...    32   4.0  
TDEL0E02300 Chr5 (447834..449537) [1704 bp, 567 aa] {ON}  YIL170W      32   4.1  
AEL042C Chr5 complement(557191..558834) [1644 bp, 547 aa] {ON} S...    32   4.2  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...    32   4.2  
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    32   4.3  
SAKL0F08448g Chr6 (644547..647147) [2601 bp, 866 aa] {ON} simila...    32   4.4  
Smik_7.170 Chr7 complement(303998..305392) [1395 bp, 464 aa] {ON...    32   4.5  
Smik_4.657 Chr4 complement(1168668..1170332) [1665 bp, 554 aa] {...    32   4.5  
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    32   4.6  
KNAG0B06940 Chr2 (1377486..1379168) [1683 bp, 560 aa] {ON}             32   4.6  
SAKL0G19844g Chr7 (1708176..1709894) [1719 bp, 572 aa] {ON} high...    32   4.7  
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...    32   4.8  
KLLA0A11110g Chr1 (964084..965739) [1656 bp, 551 aa] {ON} unipro...    32   4.8  
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    32   4.9  
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    32   4.9  
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    32   5.2  
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    32   5.6  
Suva_4.49 Chr4 complement(89704..91767) [2064 bp, 687 aa] {ON} Y...    32   5.7  
YDR387C Chr4 complement(1248154..1249821) [1668 bp, 555 aa] {ON}...    32   5.9  
ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} simila...    32   6.0  
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    32   6.3  
Skud_2.373 Chr2 complement(671237..672703) [1467 bp, 488 aa] {ON...    32   6.4  
Ecym_2679 Chr2 complement(1313694..1315403) [1710 bp, 569 aa] {O...    32   6.4  
Ecym_1317 Chr1 complement(643844..645484) [1641 bp, 546 aa] {ON}...    32   6.7  
KAFR0G03530 Chr7 complement(730598..732040) [1443 bp, 480 aa] {O...    32   6.7  
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...    32   7.0  
Kpol_1044.21 s1044 (47355..49118) [1764 bp, 587 aa] {ON} (47355....    32   7.1  
YFL011W Chr6 (112345..113985) [1641 bp, 546 aa] {ON}  HXT10Putat...    32   7.2  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...    32   7.4  
SAKL0A06050g Chr1 (548837..550408) [1572 bp, 523 aa] {ON} simila...    32   7.5  
TDEL0A04250 Chr1 (756579..758300) [1722 bp, 573 aa] {ON}  YBR298C      32   7.7  
TPHA0I03320 Chr9 (737136..738824) [1689 bp, 562 aa] {ON}               32   8.2  
ZYRO0D13310g Chr4 complement(1118820..1120670) [1851 bp, 616 aa]...    32   8.5  
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    32   8.5  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                32   8.6  
AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON} Syn...    32   8.6  
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...    32   8.6  
Ecym_1319 Chr1 complement(649182..650789) [1608 bp, 535 aa] {ON}...    32   8.7  
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    31   9.1  
KLLA0A03223g Chr1 (290002..292035) [2034 bp, 677 aa] {ON} simila...    32   9.2  
SAKL0C07920g Chr3 complement(735512..737317) [1806 bp, 601 aa] {...    31   9.3  
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    31   9.7  
KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {O...    31   9.9  
KLTH0D00484g Chr4 complement(44278..45819) [1542 bp, 513 aa] {ON...    31   9.9  

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 1202 bits (3109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/678 (88%), Positives = 600/678 (88%)

Query: 1   MGRKRSGIKTKERNRLKEFAKLKGRQRTLKSDEAGETYLGDKSNTISFGPYSRSSDESQG 60
           MGRKRSGIKTKERNRLKEFAKLKGRQRTLKSDEAGETYLGDKSNTISFGPYSRSSDESQG
Sbjct: 1   MGRKRSGIKTKERNRLKEFAKLKGRQRTLKSDEAGETYLGDKSNTISFGPYSRSSDESQG 60

Query: 61  ETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTVTP 120
           ETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTVTP
Sbjct: 61  ETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTVTP 120

Query: 121 DSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLLDYIA 180
           DSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAI               TILSTLLDYIA
Sbjct: 121 DSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIVSSLVVGVFLGSLDGTILSTLLDYIA 180

Query: 181 SEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTV 240
           SEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTV
Sbjct: 181 SEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTV 240

Query: 241 WWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLA 300
           WWLLAGRFVA      LTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLA
Sbjct: 241 WWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLA 300

Query: 301 EYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTFC 360
           EYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTFC
Sbjct: 301 EYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTFC 360

Query: 361 LVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPILSVHLLTDRNVL 420
           LVIFLASLTLTCSLVD            MFVSGYYFVYHELNIAADPILSVHLLTDRNVL
Sbjct: 361 LVIFLASLTLTCSLVDLNFNFLLLLILLMFVSGYYFVYHELNIAADPILSVHLLTDRNVL 420

Query: 421 ASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRR 480
           ASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRR
Sbjct: 421 ASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRR 480

Query: 481 GKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXXXXVRTSLLISLIAAVP 540
           GKYRTF                  KPSISTWRQ             VRTSLLISLIAAVP
Sbjct: 481 GKYRTFICLACIIGILGQLQIALIKPSISTWRQYLLLLIPILYTTTVRTSLLISLIAAVP 540

Query: 541 YKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMPLESEIHPKSQLLHIID 600
           YKNQTAAASISYTFR              FRSSLKSLLNTNIMPLESEIHPKSQLLHIID
Sbjct: 541 YKNQTAAASISYTFRSTGAILGASLGGGIFRSSLKSLLNTNIMPLESEIHPKSQLLHIID 600

Query: 601 KATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEYPVHASQP 660
           KATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEYPVHASQP
Sbjct: 601 KATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEYPVHASQP 660

Query: 661 QEYISQDSMDTYNDQTPK 678
           QEYISQDSMDTYNDQTPK
Sbjct: 661 QEYISQDSMDTYNDQTPK 678

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score =  494 bits (1272), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 285/670 (42%), Positives = 380/670 (56%), Gaps = 23/670 (3%)

Query: 1   MGRKRSGIKTKERNRLKEFAKLKGRQRTLKSDEAGETYLGDKSNTISFGPYSRSSDESQG 60
           MG++R G+KTK+R+RL+EFAK K RQR L    AG+   G   +     P  R      G
Sbjct: 1   MGKRRKGLKTKQRDRLREFAKRKERQRAL----AGQNQAGVGQDA---QPARRQHRPRAG 53

Query: 61  ETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTVTP 120
           E    L      ++ D SSG  G V ++LEVQ      A   + ++  S  GS+  +   
Sbjct: 54  EQSGLLEASRGTLVSDPSSGLSGLVASELEVQRQQEVCAAVTAESMATSGSGSSYGS--- 110

Query: 121 DSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLLDYIA 180
            + K   V++ +++VE     D+  +   R   +               TI++TLLD+IA
Sbjct: 111 -TQKPTEVYLTATAVEAAK-EDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIA 168

Query: 181 SEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTV 240
           SEF  LP ISWIA +YLLS+  FQPLYGKLSDIFGR+ +L+FSNL+F LG L+CG +  +
Sbjct: 169 SEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNL 228

Query: 241 WWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLA 300
           W L+ GRFVA      LTSM SI  +DIVPLRSRA YQ + N+ + LG   GG +GG  A
Sbjct: 229 WVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFGLGTACGGLVGGLFA 288

Query: 301 EYG-GWRLVFLLQVVAALISGCFIQAFLILPK---VHHGNGIALANKESLKTKLYMMDWL 356
           +   GWR+ FL+QV   L+S   IQ FL LPK    H G G          TKL M+DW 
Sbjct: 289 DRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAG---QRSIPWTTKLRMVDWT 345

Query: 357 GTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPILSVHLLTD 416
           GT  LV+FL   TL CSL              + +SG YF+YHEL +A DPIL +  L +
Sbjct: 346 GTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLEN 405

Query: 417 RNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYY 476
           R+VLA+SL+N+FCM+  + T FY+P+Y+ASVL MGP +IGKR + SF  T+ GS G GYY
Sbjct: 406 RSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFFSTAFGSLGAGYY 465

Query: 477 IKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXXXXVRTSLLISLI 536
           +KR GKY  F                   PSISTWRQ             + T  L++LI
Sbjct: 466 MKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCLYMIPGFGSAVLLTVTLLALI 525

Query: 537 AAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMPLESEIHPKSQLL 596
            AVP ++Q A  SISY FR              FR+ L + L + +MPL+S  HP S+LL
Sbjct: 526 VAVPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKLMPLQSPEHPASELL 585

Query: 597 HIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEYPVH 656
            II+KA HST+WVH+E+PE+A  ILI CYHY  +  F F + C++  +++C F+ EY +H
Sbjct: 586 RIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTFHFCLACMVLATVACCFIVEYKLH 645

Query: 657 AS----QPQE 662
           A     +PQ 
Sbjct: 646 AGNTAPRPQR 655

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score =  443 bits (1139), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/667 (38%), Positives = 364/667 (54%), Gaps = 28/667 (4%)

Query: 1   MGRKRSGIKTKERNRLKEFAKLKGRQRTLKSDEAGETYLGDKSNTISFGPYSRSSDESQG 60
           M RK++  K K+R +L+ F KLK RQR L +DE       + +++I              
Sbjct: 1   MARKKNS-KNKQRKKLQAFVKLKERQRQLLNDEPKVVIQQNPAHSIE-----------PT 48

Query: 61  ETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTVTP 120
           ET PFL  I + ++ D +S  PGFV  +LE QE       + ++   +    + +T  T 
Sbjct: 49  ETTPFLQPIRRELVLDPTSDLPGFVAGELEEQEERCAEEQTNASGYDSIKKNTVATAKTI 108

Query: 121 DSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLLDYIA 180
           D        + +SS+E  N   +  +S  R   I               TI+STLL +IA
Sbjct: 109 D--------LETSSIEAKN---NTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIA 157

Query: 181 SEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTV 240
           SEF  +P+ISWIA +YLLS+  FQPLYGK+SDIFGRK +L+FSN+MF LGCL+CG +P +
Sbjct: 158 SEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGL 217

Query: 241 WWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLA 300
           W L+AGRF+A      LTSM SI  SDIVPLR+RA YQ + N  + LG   GG +GGW +
Sbjct: 218 WCLVAGRFIAGIGGGGLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFS 277

Query: 301 EY-GGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTF 359
           E+ GGWR+ FL+Q+    IS   I A+L LPK   G+GI       +  KL  +DW G  
Sbjct: 278 EHGGGWRVAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWFGAL 337

Query: 360 CLVIFLASLTLTCSL----VDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPILSVHLLT 415
            LV+FL    L  SL    +             + V G  FVY E  ++ DPIL V  L 
Sbjct: 338 SLVVFLLLFMLASSLGGKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAFLK 397

Query: 416 DRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGY 475
           +R +L SSLAN+F M+  + T +++P+Y+A VL M P ++GKRTI SF  T++GS G GY
Sbjct: 398 NRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGY 457

Query: 476 YIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXXXXVRTSLLISL 535
           Y+K+ GKY+                    +P+I+ WRQ             + T  L+++
Sbjct: 458 YMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAM 517

Query: 536 IAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMPLESEIHPKSQL 595
           IAAVP+++Q A  SISY FR              FR SL SLL  N+M L S+ HP+ +L
Sbjct: 518 IAAVPHEHQAATTSISYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREEL 577

Query: 596 LHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEYPV 655
             IID A HS+D++H  +PE+    LI  YH+ C+  + F +  +    +SC  +KEY +
Sbjct: 578 AKIIDSAAHSSDYIHDSAPEFVRQALIESYHFACRNTYKFCLASIFCALLSCIAVKEYKL 637

Query: 656 HASQPQE 662
           H S  ++
Sbjct: 638 HTSMDRQ 644

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score =  399 bits (1025), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 250/670 (37%), Positives = 344/670 (51%), Gaps = 47/670 (7%)

Query: 7   GIKTKERNRLKEFAKLKGRQRTLKSDEAGETYLGDKSNTISFGPYSRSSDESQGETIPFL 66
           G K K+RN+L+EF + K  Q+  K+D   ET            P S    E+       L
Sbjct: 2   GKKDKQRNKLREFTRQKQLQQAKKNDMLEET-------RPLVAPSSAEPIEAS-----LL 49

Query: 67  TRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTVTPDSNKNG 126
             I   ++QD S+  PGFV  ++  QE             + + YGS +     D +   
Sbjct: 50  LPIKPEILQDPSTDLPGFVAEEIGQQEE------------VANGYGSIT-----DPHDGD 92

Query: 127 NVFIRSSSVEVGNIGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLLDYIASEFEAL 186
           N   R  S        ++ IS  R   I               TI+ST   ++ASEF  L
Sbjct: 93  NKSERPVST-------AEEISGARLRVIMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQL 145

Query: 187 PYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAG 246
             +SWIA SYLLS+  FQPLYGK+SDIFGRK +L+F+N+ F +GCL+CG + + WWL+  
Sbjct: 146 SKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIA 205

Query: 247 RFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE-YGGW 305
           RFVA      LTSM SI I+D+VPLR RA YQ + N+ Y LG   GG +GGW ++  GGW
Sbjct: 206 RFVAGVGGGGLTSMSSITITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDNKGGW 265

Query: 306 RLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKE-SLKTKLYMMDWLGTFCLVIF 364
           R+ FL+QV  + IS   I   L LP        A  N++ S+K KL  +DWLG   LVIF
Sbjct: 266 RMAFLIQVPLSAISLLVIILHLKLPSKR-----ATRNQDNSIKRKLLAIDWLGASTLVIF 320

Query: 365 LASLTLTCSLVDXXXXXXXXXXXXMFVSGYY----FVYHELNIAADPILSVHLLTDRNVL 420
           L    LT SL              M +S       F+Y EL +AADPIL +  L  R+VL
Sbjct: 321 LVLFLLTASLGGKEIAYGSRTFALMLISSLLSCLVFIYVELRVAADPILPLRFLAIRSVL 380

Query: 421 ASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRR 480
            SSL+N+FCM+  + T +Y+P+YF+ VL M P ++GKR + +F   + GS G GYY+K+ 
Sbjct: 381 GSSLSNWFCMMATMTTSYYLPIYFSGVLNMSPTDVGKRLMPNFFSVAFGSLGAGYYMKKT 440

Query: 481 GKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXXXXVRTSLLISLIAAVP 540
            KY  F                   P I TWRQ             + T  L+++IAAVP
Sbjct: 441 RKYYWFSLIFCAVAVLGQLQILLIDPKIPTWRQYILLLVPGVGTSVLITVALLAMIAAVP 500

Query: 541 YKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMPLESEIHPKSQLLHIID 600
           +++Q A  SISY FR              FR SL  L    ++   S+ HPK +LL IID
Sbjct: 501 HEHQAATTSISYAFRSAGCTLGVSIGGAIFRESLSKLTTRYVLRYISKEHPKEELLKIID 560

Query: 601 KATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEYPVHASQP 660
           KA+ S++WVH  +P++    L+ CYH  CK  F F  +C + T +S   +KE  +H+S  
Sbjct: 561 KASESSEWVHHSAPDFIRQTLLECYHKACKNTFLFCFICSILTLVSFSIIKEKKLHSSLD 620

Query: 661 QEYISQDSMD 670
           ++   +D  D
Sbjct: 621 RKEDQEDLED 630

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score =  394 bits (1012), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 238/662 (35%), Positives = 341/662 (51%), Gaps = 43/662 (6%)

Query: 7   GIKTKERNRLKEFAKLKGRQRTLKSDEAG-----ETYLGDKSNTISFGPYSRSSDESQGE 61
           G K K+R +L+ F K K +Q  ++ D+         + G +S   +    S+ + E    
Sbjct: 2   GKKDKQRKKLRNFTKAKVKQ--VQEDQEPMVPDPPEFDGTESFVQTLAETSQLTKEDDEN 59

Query: 62  TIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTVTPD 121
           ++  L  I   ++QD S+  PGF+  ++E  E       S         YG+  +     
Sbjct: 60  SV--LLPIRDELLQDPSTELPGFIAAEIEEGEQEYEETRS-------GHYGAIESR---- 106

Query: 122 SNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLLDYIAS 181
                    R SS           +S  R   I               TI+STLL +IAS
Sbjct: 107 ---------RISS-------KGTELSTARLKIIMLSMYLGIFLAALDNTIVSTLLAHIAS 150

Query: 182 EFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVW 241
           EF  LP ISW+A +YLLS+  FQP+YGK+SDIFGRK +L+F N+ F +G L+CG +P+  
Sbjct: 151 EFNELPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFE 210

Query: 242 WLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE 301
           WL+AGRF+A      +TSM SI  SDIVPLR+RA YQ + N  + LG  LGG +GGW ++
Sbjct: 211 WLVAGRFIAGIGGGGITSMSSITTSDIVPLRNRALYQGICNFYFGLGTALGGVVGGWFSD 270

Query: 302 YG-GWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANK--ESLKTKLYMMDWLGT 358
              GWR+ FL+Q+  A  S   I  FL LPK   G G+ +      ++K +L  +DW+G 
Sbjct: 271 RSVGWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGA 330

Query: 359 FCLVIFLASLTLTCSL----VDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPILSVHLL 414
             LV+FL S  +T SL    +               +    F Y EL IA DPIL +  L
Sbjct: 331 TTLVLFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFL 390

Query: 415 TDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTG 474
            DR+VL SSL+N+FCM+  +   +Y+P+YFA VL M P +IGKR I +F  T+ GS G G
Sbjct: 391 KDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAG 450

Query: 475 YYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXXXXVRTSLLIS 534
           YY+K+ GKY  F                  +P IS ++Q             + T  L++
Sbjct: 451 YYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLA 510

Query: 535 LIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMPLESEIHPKSQ 594
           +IAAVP+ +Q    SISY FR              FR SL +LL + ++  +S  H + +
Sbjct: 511 MIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDE 570

Query: 595 LLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEYP 654
           L+ IIDKA+ ST+WV   SP +    LI CYH+ CK +F F ++C +  + S   +KE+ 
Sbjct: 571 LMRIIDKASQSTEWVQNSSPSFIKQTLIDCYHFACKNVFIFCLLCTIAATFSMAIIKEHR 630

Query: 655 VH 656
           +H
Sbjct: 631 LH 632

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score =  387 bits (993), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 222/605 (36%), Positives = 318/605 (52%), Gaps = 24/605 (3%)

Query: 59  QGETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTV 118
           Q E  P LT +D++ +QD S+  PGFV N++E Q+  L     ++       YGST+ + 
Sbjct: 3   QSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRA-------YGSTTKSS 55

Query: 119 TPDSNKNGNVFIRSSSVEVGNIGDSQ-NISQIRFAAIXXXXXXXXXXXXXXXTILSTLLD 177
               N+  +    +    V   G ++  +   R   I               TI+STLL 
Sbjct: 56  ISSENERED----AGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLT 111

Query: 178 YIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTA 237
           +I SEF +L   SWIA SYLLS+   QPLYGKLSD  GRK +L+FSN +F +GCL+CG +
Sbjct: 112 HIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLS 171

Query: 238 PTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGG 297
            ++W ++AGRF++      LTS+ ++I+SD+VPLR RA YQ L N  + LG   GG +G 
Sbjct: 172 NSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGGLVGA 231

Query: 298 WLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLG 357
           +  +   WRL F+LQ   +++SG  I  +L LP     +     NK+    +L  +DW G
Sbjct: 232 YFRD---WRLAFILQCPISVLSGILIVVYLELPPRASAS-----NKDCWSARLRRLDWAG 283

Query: 358 TFCLVIFLASLTLTCSLVDXXXXXXXXXXXXM----FVSGYYFVYHELNIAADPILSVHL 413
              L+ FL    LT S+              M     V G  FVY EL +AADP+L V  
Sbjct: 284 ATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTF 343

Query: 414 LTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGT 473
           L DR+VL SSLAN+FCM++ + T FY+P+Y++SVL M   ++GKR + SF   + GS G 
Sbjct: 344 LRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGA 403

Query: 474 GYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXXXXVRTSLLI 533
           G Y+KR GKY  F                   P +  WRQ             + T  L+
Sbjct: 404 GLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITPQMPVWRQYLLQVVPGFGVSVLITVTLL 463

Query: 534 SLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMPLESEIHPKS 593
           ++IAAVP+++  A  SISY FR              FRSSL SLL+  +M   S+ H + 
Sbjct: 464 AMIAAVPHEHHAATTSISYAFRSTGATLGVSVGAAVFRSSLTSLLDAKVMRFASDGHSER 523

Query: 594 QLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKEY 653
           +L  II  A  S+DWVHR +P +    L+ CYH+  +  F F +  ++   +SC  +KE+
Sbjct: 524 ELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTTMVLAGVSCSIIKEH 583

Query: 654 PVHAS 658
            +H S
Sbjct: 584 KLHTS 588

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score =  384 bits (986), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 224/610 (36%), Positives = 319/610 (52%), Gaps = 28/610 (4%)

Query: 58  SQGETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTT 117
           S GE   FL  IDK+VIQD S+G  GFV N++E Q+ +  +         + SYG+T+  
Sbjct: 2   SPGERTSFLAPIDKDVIQDPSTGLAGFVANEVEQQDYNSRTG--------HDSYGATAVD 53

Query: 118 -VTPDSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLL 176
             T  S +    F  S + E         +S  R   I               TI+STLL
Sbjct: 54  DRTATSARCDLTFPPSETPEFA-------LSSSRIRIIMISMFLGIFLAALDGTIVSTLL 106

Query: 177 DYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGT 236
             I SEF +L  +SWIA SYLLS+   QPLYGKLSD  GRK +L+FSN++F +GCL+CG 
Sbjct: 107 TRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGM 166

Query: 237 APTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMG 296
           + ++WW++ GRFV+      LT + S++ISD+VPLR RA YQ L N  + LG   GG +G
Sbjct: 167 STSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVG 226

Query: 297 GWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWL 356
              A +  WR+ F +Q   +L S   I ++L LP  H  +           +KL  +DW 
Sbjct: 227 ---AAFQDWRMAFTIQCPISLASCALIVSYLELPPRHEDD-----KDRHWTSKLRDLDWA 278

Query: 357 GTFCLVIFLASLTLTCSL----VDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPILSVH 412
           G   LV FL    L  SL    +               V G  F Y EL +A DP+L + 
Sbjct: 279 GVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIA 338

Query: 413 LLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFG 472
            L  R+VL SSLAN+F M++ + T +Y+P+Y+ASVL M P +IGKR+I SF   + GS G
Sbjct: 339 FLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLG 398

Query: 473 TGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXXXXVRTSLL 532
            G Y+KR GKY  F                   P+   W+Q             + T  L
Sbjct: 399 AGIYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTL 458

Query: 533 ISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMPLESEIHPK 592
           +++I+AVP+++  A  SISY FR              FRS+L +LL   ++   S+ HP+
Sbjct: 459 LAMISAVPHEHHAATTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPR 518

Query: 593 SQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLKE 652
            +LL II+ A HS +WVH+E+PE+    L+ CYHY  K  F F ++ ++    SC  ++E
Sbjct: 519 EELLRIINNAAHSANWVHKEAPEFVRATLVECYHYASKSTFKFCLITMILAGASCSIIQE 578

Query: 653 YPVHASQPQE 662
           + +H +  ++
Sbjct: 579 HTLHTTLKRD 588

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score =  382 bits (982), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/611 (36%), Positives = 325/611 (53%), Gaps = 50/611 (8%)

Query: 65  FLTRIDKNVIQDTSSGRPGFV--------INKLEVQELSLGSAGSQSTTILNSSYGSTST 116
           FL  +  +++QD S+  PGFV            E Q    GS  ++     +S  G  S+
Sbjct: 16  FLNPVRDDILQDASTDIPGFVAEELEEREELYRECQGTDYGSIDNED----DSRDGVASS 71

Query: 117 TVTPDSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLL 176
            V PD      + + + S+ +G          I  AA                T++ST++
Sbjct: 72  PVPPD-----KLLVITLSMYLG----------IFLAA-------------ADGTLVSTIM 103

Query: 177 DYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGT 236
            +IASEF  LP ISWIA +YLLS+  FQPLYGKLSDIFGRK +L+ +N++F +GCL+CG 
Sbjct: 104 AHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGL 163

Query: 237 APTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMG 296
            P+ W L+  RF++      +TSM SI ISDIVPLR RA YQ + N  + LG   GG +G
Sbjct: 164 TPSFWGLVGARFISGIGGGGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTACGGVVG 223

Query: 297 GWLAEY-GGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDW 355
           GW +++ GGWR+ FL+QV  + +S   I  F+ LP         + +  S+K KL  +DW
Sbjct: 224 GWFSDHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSK----RVNSPASIKNKLLSVDW 279

Query: 356 LGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSG----YYFVYHELNIAADPILSV 411
           +G   LV+FL+   +T SL              + +       +F+  EL  A DPIL +
Sbjct: 280 IGASALVVFLSLFLVTASLGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPL 339

Query: 412 HLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSF 471
             L +R+VL SS +N+FCM+  + T +Y+P+Y++ VL M P  +GKR + +F  T++GS 
Sbjct: 340 SFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPTRVGKRLMPNFFSTALGSL 399

Query: 472 GTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXXXXVRTSL 531
           G GYY+KR GKY                     KP I+TWRQ             + T  
Sbjct: 400 GAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQFILLVIPGFGYSVLITVA 459

Query: 532 LISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMPLESEIHP 591
           L+++IAAVP+ +  A  SISY FR              FR SL  LL+  ++    + HP
Sbjct: 460 LLAMIAAVPHNHHAATTSISYAFRSTGSTLGVSIGGAIFRQSLNGLLSRKVLKFADK-HP 518

Query: 592 KSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFLK 651
           + +LL II+KA+ S++WVH  +PE+  P LI CYH+ CK  F F  +C + T  S   +K
Sbjct: 519 RKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFACKDTFLFCTLCSIGTLASISIIK 578

Query: 652 EYPVHASQPQE 662
           EY +HAS  ++
Sbjct: 579 EYKLHASLDRK 589

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score =  367 bits (942), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 210/501 (41%), Positives = 291/501 (58%), Gaps = 8/501 (1%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++TLL +IASEF  L +ISWIA +YLLS+  FQPLYGK+SDIFGR+ +++ SNL F L
Sbjct: 79  TIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFIL 138

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL+CG +  +W L+AGRF+A      +TS+ SI  SDIVPLRSRA YQ +FN  + LGI
Sbjct: 139 GCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVPLRSRALYQGIFNFFFGLGI 198

Query: 290 TLGGSMGGWLAE-YGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKE---S 345
            +GG +GGW +E   GWR+ FL+QV    IS   I  FL LP    G G+   +K+    
Sbjct: 199 AIGGLIGGWFSESKNGWRMAFLVQVPLCAISLVLIIIFLKLPPGCKGLGLVSNDKDGKVD 258

Query: 346 LKTKLYMMDWLGTFCLVIFLASLTLTCSL----VDXXXXXXXXXXXXMFVSGYYFVYHEL 401
           +K KL  +DWLG+  LV FL +  L  SL    +               +SG  F+Y EL
Sbjct: 259 IKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVEL 318

Query: 402 NIAADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTII 461
            I+ DPIL +  LT+R++L +S AN+FCM++ V   FYVP+Y++SV  + P ++GKR   
Sbjct: 319 YISDDPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAP 378

Query: 462 SFLGTSIGSFGTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXX 521
           +F  T+ GS G GYY+K+ G+Y  F                  KP ISTWRQ        
Sbjct: 379 NFFSTAFGSIGAGYYMKKTGRYYGFLLKFTGLMVLGQLQVLLMKPDISTWRQYILLPLPH 438

Query: 522 XXXXXVRTSLLISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTN 581
                + T  L+++IAAVP+++Q A  SISY FR              FR+ L   L  +
Sbjct: 439 FGSSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDS 498

Query: 582 IMPLESEIHPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVL 641
           +M  ES+ + K  LL II +A+ S+++VH  +P++    LI CY   CK  F F  +  +
Sbjct: 499 VMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISI 558

Query: 642 FTSISCYFLKEYPVHASQPQE 662
           F  ISC  +KEY +H S  ++
Sbjct: 559 FAWISCGVIKEYKLHTSMERK 579

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score =  362 bits (928), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 232/635 (36%), Positives = 321/635 (50%), Gaps = 47/635 (7%)

Query: 59  QGETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLGSAGSQSTTILNSSYGSTSTTV 118
           Q +  P L  I   ++QD+S   PGFV  ++E +E     A   S    +  YGS + ++
Sbjct: 23  QEDKSPLLHAIRGELLQDSSFSLPGFVAAEIEEREELYREASIASNQ--HHDYGSVANSI 80

Query: 119 TPDSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLLDY 178
             D++KN                   N+S  R                   TI+STLL  
Sbjct: 81  ILDNDKN-------------------NLSPTRLRLAMSSMYLGIFLSALDNTIVSTLLAR 121

Query: 179 IASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAP 238
           I SEF  LP ISWIA +YLLS+  FQPLYGK+SDIFGRK +L F N+ F +GCL+CGTA 
Sbjct: 122 IGSEFNELPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAK 181

Query: 239 TVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGW 298
           + W L+ GRF++      +TSM +I +SDI+PLR+RA YQ + N  Y LGI LGG +GGW
Sbjct: 182 SFWVLVIGRFISGVGGGGITSMSTITVSDIIPLRNRALYQGVCNFYYGLGIALGGIIGGW 241

Query: 299 LAE-YGGWRLVFLLQVVAALISGCFIQAFLILPK--VHHGNGIALANKES-------LKT 348
             E  G WR  FL QV  ++IS   +  +L LPK    +G  I ++N  S       +  
Sbjct: 242 FTEKLGSWRGAFLFQVPLSVISTVTVMVWLQLPKDSKSYGLEITMSNNSSNNGTESIIMK 301

Query: 349 KLYMMDWLGTFCLVIFLASLTLTCSL----VDXXXXXXXXXXXXMFVSGYYFVYHELNIA 404
           KL  +DW G   LVIFL S  +  S     +                S   F+Y EL  A
Sbjct: 302 KLKTIDWYGAMSLVIFLLSFMILSSAGGSDISVKSNTFLYLTLISVTSFISFIYIELKFA 361

Query: 405 ADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFL 464
            DPIL +  L DR+VL SSL+N+F M+  +   +Y+P+YF SV+ +G  ++GKRT+ +F 
Sbjct: 362 KDPILPLVFLKDRSVLGSSLSNWFTMMLLMTISYYLPIYFTSVMGIGAYDVGKRTLPNFF 421

Query: 465 GTSIGSFGTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXX 524
             + GS G GYY+K+ GKY  F                     IS WRQ           
Sbjct: 422 SVAFGSLGAGYYMKKTGKYYWFVTFFCLVVVIGCLQIYLINDGISVWRQYLLSFVPGLGA 481

Query: 525 XXVRTSLLISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMP 584
             + T  L+S+I AVP++ Q    SISY FR              FR SL   L   I+ 
Sbjct: 482 AVLITIALLSMIVAVPHEYQAVTTSISYAFRSTGCTLGVSIGAALFRDSLNKYLRAKILE 541

Query: 585 LESE--IHPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLF 642
           L S+   + + +LL IID A+ S DWVH E+P +    ++ CYHY CK++F F ++C + 
Sbjct: 542 LGSQNGNYSEKELLQIIDHASKSIDWVHNEAPRFFKRTILECYHYACKKVFLFCLICSVL 601

Query: 643 TSISCYFLKEYPVHASQPQEYISQDSMDTYNDQTP 677
             +S   +KE+ +H+          S+D   D TP
Sbjct: 602 ALLSISMIKEHKLHS----------SLDRKEDDTP 626

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score =  350 bits (898), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/476 (39%), Positives = 275/476 (57%), Gaps = 13/476 (2%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           T++STL+ +I SEF  +P + W+A SYLLS+ +FQPLYGKLSDIFGRKA+L+FSNL+F  
Sbjct: 415 TVVSTLMAHIGSEFNQIPKVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFF 474

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GC++CG + ++  L+ GRFVA      +TSM +I +SDIVPLRSRA YQ + N  + LG 
Sbjct: 475 GCIICGMSNSLNMLVWGRFVAGIGGGGITSMTTITVSDIVPLRSRAVYQGICNFFFGLGT 534

Query: 290 TLGGSMGGWLAEYG-GWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKT 348
             GG +GG   ++  GWR+VF  QV  + +S   I +FL++P++ +        + SL  
Sbjct: 535 AFGGVIGGIFVDHQYGWRMVFWSQVPVSGLSTLLICSFLVVPRIKN-------YEVSLGR 587

Query: 349 KLYMMDWLGTFCLVIFLASLTLTCSL---VDXXXXXXXXXXXXMF--VSGYYFVYHELNI 403
           KL  +DWLG+  ++++L S  L  ++   +             MF  VS   FV  EL +
Sbjct: 588 KLMRVDWLGSISMILWLTSFLLITTMMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELFV 647

Query: 404 AADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISF 463
           A+DP+L +  L++R+VL +SL NFFC++  +   FY+P+YFASVL + P  IGKR   +F
Sbjct: 648 ASDPVLPLRFLSNRSVLGASLGNFFCVMGFMTICFYLPIYFASVLDISPTGIGKRMAPNF 707

Query: 464 LGTSIGSFGTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXX 523
           L T++GS G G Y+K+ GKY  F                    ++S   Q          
Sbjct: 708 LCTALGSLGAGVYMKQTGKYYWFVVLFALVSTLGHYYLTLIPLTVSITVQYLLVVLPGVG 767

Query: 524 XXXVRTSLLISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIM 583
              +    L+++IAAVP+K+Q A  SISY FR              F  +L   L+T+++
Sbjct: 768 SSIIIVVALLAMIAAVPHKHQAATTSISYAFRSTGGTLGVALGSSVFHRTLIKRLHTDVL 827

Query: 584 PLESEIHPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVC 639
              S  HP+ +LL II KA+HST+WVHR++P +    LI+CY   C  +F F   C
Sbjct: 828 EYVSPEHPRKELLRIIKKASHSTEWVHRKAPTFIRDTLITCYDVACHDVFVFCTAC 883

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score =  338 bits (867), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 189/488 (38%), Positives = 271/488 (55%), Gaps = 10/488 (2%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI+STLL +I SE   +P +S +A SY+ S  IFQPL+GK SD+FGRK +L+ SNL+F  
Sbjct: 99  TIVSTLLPHIGSELNDMPNVSLVATSYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFA 158

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL CG + T+WWL+ GR V       LTSM +III+DIVPLR+RA YQ   N+ Y LG 
Sbjct: 159 GCLTCGLSKTIWWLILGRLVTGIGGGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGT 218

Query: 290 TLGGSMGGWLAEYG-GWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKT 348
             GG +GG  +EYG GWR+ F++Q+    +S   I  +L L       G     + SL  
Sbjct: 219 ACGGLVGGLFSEYGNGWRMAFMIQLPFCFLSTISIIVYLDLSDDKQDLG-----RSSLYC 273

Query: 349 KLYMMDWLGT----FCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIA 404
           KL ++DWLG       L++FL ++T+    V             +  SG    Y E+ +A
Sbjct: 274 KLRLIDWLGALTLVTFLLLFLVTMTIGGQHVPYGSLRFFLLCVAVCASGLALAYVEIFLA 333

Query: 405 ADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFL 464
            DPIL +  L ++NVL SSLAN+FCM+  +   +Y+P+Y++SV   GP ++GK++I SF 
Sbjct: 334 NDPILPISFLRNKNVLGSSLANWFCMMGMMTITYYLPIYWSSVSNQGPIQVGKKSIPSFF 393

Query: 465 GTSIGSFGTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXX 524
             ++GSFGT YY+++ G Y                      P +  WRQ           
Sbjct: 394 SMALGSFGTAYYVQKNGTYYRLLMTSCLIIIFGQLQIVYITPEMPQWRQYILLAVPGFGV 453

Query: 525 XXVRTSLLISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMP 584
             + T  L+++IAAVP+K+Q A  S+SY FR              F+++LK  + T +M 
Sbjct: 454 SILITVTLLAMIAAVPHKHQAATTSLSYAFRTTGCIIGASLAGAIFQNTLKKNVTTAVMK 513

Query: 585 LESEIHPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTS 644
              + H K +L  +I+KA  S+DWV+  SPE+    L+ CY   C + F F ++C L T 
Sbjct: 514 FLGDEHSKKELNLVIEKALRSSDWVNNGSPEFVHEALLKCYENACGQTFRFCLLCFLLTV 573

Query: 645 ISCYFLKE 652
           ISC F+ E
Sbjct: 574 ISCSFITE 581

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score =  234 bits (597), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 171/506 (33%), Positives = 260/506 (51%), Gaps = 27/506 (5%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++TLL  IASE +A   +SWIA SYLLS   FQPLYGKLSD+FGRK +L++SNL FG 
Sbjct: 50  TIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGF 109

Query: 230 GCLVCGTAP---TVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYV 286
           GC++CG AP   ++W L  GRF+A      L S+ +I  SDI+PLR R  YQ + NI + 
Sbjct: 110 GCILCG-APFTKSLWMLCIGRFIAGVGGGGLNSLSTITTSDIIPLRQRGVYQGMGNIVFA 168

Query: 287 LGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNG-IALANKES 345
           LG   G  +G +L +  GWR  FL QV  +L+S   I  FL LP    G G I L+NK+ 
Sbjct: 169 LGCASGSLIGAFLQQRIGWRWAFLCQVPLSLLSCSLIMKFLNLPAGSPGRGLINLSNKKI 228

Query: 346 LKTKLY-MMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFV----SGYYFVYHE 400
               +   +D+ G+F L+  +  L +  S++D              V    +GY FV  E
Sbjct: 229 TTADVREHVDFTGSFTLITTMLLLMIILSVLDNPSHLTYGTWALFIVGLALAGYTFVSTE 288

Query: 401 LNIAADPILSVHLL-TDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRT 459
           L++  +P++ + LL ++R VLASSL N+F  ++  +  +YVP+++ +V ++ P  IG RT
Sbjct: 289 LSV-HNPMVPIRLLGSNRTVLASSLTNWFFTMSTFVLAYYVPVFWQTVYHLKPWNIGVRT 347

Query: 460 IISFLGTSIGSFGTGYYIKRRGKYR----TFXXXXXXXXXXXXXXXXXXKPSISTWRQXX 515
           + +F G +IGS  TG Y+KR GKY+    T                   +P      +  
Sbjct: 348 VSNFFGIAIGSMMTGLYMKRTGKYKALSNTLNTVTVAGTLIVYLSTYNTEP--KGLLEYF 405

Query: 516 XXXXXXXXXXXVRTSLLISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLK 575
                      + T  L+SLIA+V   +Q    SI Y FR              ++S L+
Sbjct: 406 MLFLPGLGYASMLTITLLSLIASVDTSHQAQVTSIQYAFRAIGSTLGVSFAGLIYQSKLQ 465

Query: 576 SLLNTNIMPLESEIHPKSQLLHIIDKATHSTDWVHRESPEYAI-PILISC----YHYVCK 630
           + L  NI+  E++        H + K   +   +   S + +  P+L S     +    +
Sbjct: 466 TSLLRNIV--ENKTLNDKYSTHQLRKWCQTL--LENNSFDVSFDPLLESLAKISFQGGSR 521

Query: 631 RIFTFSVVCVLFTSISCYFLKEYPVH 656
            +  F+V+  +   +S  F++E+ +H
Sbjct: 522 LVLGFAVLASILGLLSSLFIREHVLH 547

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score =  221 bits (564), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 167/511 (32%), Positives = 248/511 (48%), Gaps = 30/511 (5%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++TLL  IAS+ +A   +SWIA +YLLS   FQPLYGKLSDIFGRK +L+ SNL F L
Sbjct: 59  TIVATLLPTIASDLDASSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFAL 118

Query: 230 GCLVCGTAPT--VWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVL 287
           GC +CG+  T  VW L  GRFVA        ++ +I  SDI+PLR R  YQ L NIC+ L
Sbjct: 119 GCAICGSPWTNNVWVLSTGRFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSL 178

Query: 288 GITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNG---IALANKE 344
           G   G  +G  L +  GWR  FL+QV  AL+    I   L LP    G G   + L   +
Sbjct: 179 GCASGSVLGAVLQQGIGWRWAFLVQVPMALVCALMIAVVLDLPADSPGRGLLWLELKRGK 238

Query: 345 SLK--TKLYMMDWLGTFCL----VIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVY 398
            LK  T   M+D++G+F L    ++ + +++L                  +  S   F Y
Sbjct: 239 RLKWCTVTEMVDFVGSFTLIASMILLMTAISLLSDPTQLSTSLWLLLGVLLTASSLQFAY 298

Query: 399 HELNIAADPILSVHLL-TDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGK 457
            E     +P++ + LL  +R V ASS  N+F  +     ++YVP+++ +V    P +IG 
Sbjct: 299 TECT-TRNPMVPLRLLWENRTVCASSFTNWFMTMTTFTVMYYVPVFWHTVYKFTPWDIGV 357

Query: 458 RTIISFLGTSIGSFGTGYYIKRRGKYRTFXXXXXX--XXXXXXXXXXXXKPSISTWRQXX 515
           R++ +F+G + GS   G Y+KR GKY +F                    K S     +  
Sbjct: 358 RSMSNFVGIASGSMLAGMYMKRTGKYWSFSVATNSLFAVGVLSLFAFSFKGSPQGVVEYL 417

Query: 516 XXXXXXXXXXXVRTSLLISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLK 575
                      + T  L++LIA+V  ++Q    SI Y FR              ++S L+
Sbjct: 418 LMFLPGFGYATMLTVTLLALIASVSVEHQAQVTSIQYAFRATGSTLGVALASLIYQSCLQ 477

Query: 576 SLLNTNIM---PLESEIHPKSQL---LHIIDKATHSTDWVHRESPEYAIPILISCYHYV- 628
           S L  N++   PL ++   +  +     I+   +    + HR +      ++   + +  
Sbjct: 478 SRLYNNVLTDGPLLAQYGSRRLMDWCQSILQDNSFDISFDHRLA-----ELVRQGFQFSN 532

Query: 629 -CKRIFTFSVVCVLFTSISCYFLKEYPVHAS 658
            C   F F VVCVL    SC F++E+ +H S
Sbjct: 533 QCALGFAF-VVCVLGVLSSC-FMREHVLHTS 561

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score =  211 bits (537), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 151/428 (35%), Positives = 222/428 (51%), Gaps = 15/428 (3%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI+STLL  IAS+ +A   +SWIA SYLLS   FQPLYGKLSDIFGRK +L++SNL+F +
Sbjct: 59  TIVSTLLPTIASDLDASSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAI 118

Query: 230 GCLVCGTAPT--VWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVL 287
           GC +CG+  T  +W L AGRF+A      LT++ +I  SDI+PLR R  YQ L NIC+ L
Sbjct: 119 GCALCGSPWTTNIWILSAGRFIAGIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSL 178

Query: 288 GITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGI-----ALAN 342
           G   G  +G  L +  GWR  FL+QV  ALISG  I   L LP    G G+     A  N
Sbjct: 179 GCASGSVLGAVLQQGIGWRWAFLIQVPIALISGLLIVFVLELPSDSPGRGLIWLEHARGN 238

Query: 343 KESLKTKLYMMDWLGTFCLVIFLASLTLTCSLVD--XXXXXXXXXXXXMFVSGY--YFVY 398
                    M+D++G+  LV+ +  L +T S +               + V+G+   FV+
Sbjct: 239 TFQWSKVTKMIDFVGSITLVMSMLLLMITISFLSDPSQLSENSWVVLVLLVAGFCAKFVH 298

Query: 399 HELNIAADPILSVHLL-TDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGK 457
            E  I  +P++ + LL  +R V ASS  N+F  ++    ++Y+P+++ +V    P +IG 
Sbjct: 299 TECTI-HNPMVPLRLLWENRTVFASSFTNWFMTMSTFAVMYYIPVFWQTVFKFTPYDIGF 357

Query: 458 RTIISFLGTSIGSFGTGYYIKRRGKYRTFXXXXXXX--XXXXXXXXXXXKPSISTWRQXX 515
           R+I +F+G + GS   G Y+K  GKY  F                    + +     +  
Sbjct: 358 RSISNFVGIATGSMLAGVYMKCTGKYWNFSLVTNILYFTGILSLFACTFRNTPQGVLEYL 417

Query: 516 XXXXXXXXXXXVRTSLLISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLK 575
                      + T  L++LIA+V +++Q    SI Y FR              +++SL+
Sbjct: 418 LMFLPGFGYATMLTVTLLALIASVDFEHQAQVTSIQYAFRATGSTLGVSLAGLIYQASLQ 477

Query: 576 SLLNTNIM 583
             L  +I+
Sbjct: 478 YKLYRDIL 485

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score =  137 bits (345), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 132/489 (26%), Positives = 198/489 (40%), Gaps = 24/489 (4%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI +++   I +EFE +   SWI  +YL++   FQPLYG  SD  GR+  L F+N +F L
Sbjct: 64  TITASIYQLIGNEFEDVKVSSWITTAYLVTCTSFQPLYGSFSDTLGRRRCLFFANTIFAL 123

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL CG   T++ L+  R V       L ++ +I+ SDI+P + R  YQ   NI    G 
Sbjct: 124 GCLGCGLTSTIYSLIIMRAVTGIGGGGLITLSTIVNSDIIPAKKRGMYQSFQNILVGTGA 183

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVV----AALISGCFIQAFLILPKVHHGNGIALANKES 345
            +G S GG +A   GWR  FLLQV      A+++  F+Q   ++ K      +      S
Sbjct: 184 VVGASCGGEIASSMGWRWCFLLQVPISIGGAVMAYLFVQDQDVVDKNPRSGAL-----PS 238

Query: 346 LKTKLYMMDWLGTFCLVIFLAS----LTLTCSLVDXXXXXXXXXXXXM----FVSGYYFV 397
             +K+  +D+LG F L+  L S    LT+  S  +            +     VS   F 
Sbjct: 239 NVSKIKKIDFLGAFLLISGLVSQLIFLTINSSAQEGKSTWLSGRSLALGLVTAVSLILFA 298

Query: 398 YHELNIAADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGK 457
           Y E    A+PI+   LL         +            IF +P+YF  V+     E G 
Sbjct: 299 YVEKTTTANPIIPHDLLGQWYSTTVLIVGVLVGFVSYAYIFTLPLYFQVVVGDTAAEAGL 358

Query: 458 RTIISFLGTSIGSFGTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXX 517
           R  +    T IG    G  +K   +                      KP+   W      
Sbjct: 359 RLTVPSFCTPIGGVIMGISMKDPKRLPGLLIVGISLMLFGNLCFLLIKPTTPYWLTSLLL 418

Query: 518 XXXXXXXXXVRTSLLIS-LIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKS 576
                       S L S L A  PYK  TA A++ Y FR               +S ++ 
Sbjct: 419 VPANIGQGITFPSTLFSFLFAFPPYKQATATATL-YLFRSVGCVWGVAGTSSLIQSVVRK 477

Query: 577 LLNTNIMPLESEIHPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFS 636
                +  + ++   KS L+    K +H T  + +  P+     +++ Y    K  + FS
Sbjct: 478 QATKRLQGILTDEEIKSLLV----KLSHKTSLIEKL-PDNVRAAVLTSYEISIKSTYFFS 532

Query: 637 VVCVLFTSI 645
           V+  L   I
Sbjct: 533 VILCLIAII 541

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score =  129 bits (325), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 133/513 (25%), Positives = 205/513 (39%), Gaps = 20/513 (3%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI ++    I +EF  +   SWI  +YL++   FQPLYG  SD  GR+  L F+N +F L
Sbjct: 61  TISASTYQLIGNEFGDVKLSSWITTAYLITCTSFQPLYGSFSDTLGRRHCLFFANTIFAL 120

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GC  CGT  T++ L+  R +       L ++ +II SDI+P + R  YQ   N+    G 
Sbjct: 121 GCFGCGTTTTIYSLILMRALTGIGGGGLITLSTIINSDIIPAKKRGIYQAFQNVLLGTGA 180

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
            +G S GG +A   GWR  FLLQV  + + G  +  F +  +    NG   A + +   K
Sbjct: 181 VVGASCGGLIATTMGWRWCFLLQVPIS-VGGTLVAFFFVHDQRPDINGGVSAVRTTGWEK 239

Query: 350 LYMMDW-------LGTFCLVIFLA-SLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHEL 401
           L  +D+       LG  C + FL  + T   S                 VS   F Y E 
Sbjct: 240 LEKIDFSGALLLVLGLACQLFFLTLNSTSKSSESYWYSPQSIVLTLSTGVSLILFAYVEH 299

Query: 402 NIAADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTII 461
              A+PI+   LL   +     + +          IF +P+YF  V+     + G R  +
Sbjct: 300 TTKANPIIPHDLLRQAHGATVLIISVLVGFVAYAYIFTLPLYFQVVIGDTAAKAGLRLTV 359

Query: 462 SFLGTSIGSFGTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXX 521
               T IG   TG  +K                          KP    W+         
Sbjct: 360 PSFCTPIGGLITGLSMKNPNHLPVLLISGITCMLLGNLCFLFIKPWTPYWQTSLLLVPAN 419

Query: 522 XXXXXVRTSLLISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTN 581
                   S L + + A P   Q  A S  Y FR               + ++++    +
Sbjct: 420 VGQGITFPSTLFTFLFAFPPYKQATATSTLYLFRSVGCVWGVAGTSSLIQYAVRNQAKKS 479

Query: 582 IMPLESEIHPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSV-VCV 640
           +  L +E   +  LL +    +H+T  + +  P+    + IS Y    ++ +  SV +C 
Sbjct: 480 LNGLLTEKEIRKLLLQL----SHTTSQIKKLPPDVRSAV-ISSYDNAIRQAYFLSVFLCT 534

Query: 641 LFTSISCYFLKEYPVHASQPQEYISQDSMDTYN 673
           +  +I   FLK       +  E+  QDS +T N
Sbjct: 535 I--AILLSFLKRV---FKKRDEHEGQDSNETEN 562

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score =  129 bits (325), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 94/317 (29%), Positives = 149/317 (47%), Gaps = 10/317 (3%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI ++    I +EF+     +WI  +YL++   FQPLYG  SD  GR+  L F+N +F L
Sbjct: 63  TITASTYQLIGNEFDNFEISNWITTAYLVATTSFQPLYGSFSDTLGRRHCLFFANTVFAL 122

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL CG AP +  L+  R +       L ++ +I+ SDI+P  SR  YQ   N+   +G 
Sbjct: 123 GCLGCGLAPGILSLIFMRALTGIGGGGLITLSTIVNSDIIPPESRGIYQAFQNVLLGIGA 182

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
            +G S GG +A Y GWR  FLLQV  ++  G  I A++ L         + ++ + LK +
Sbjct: 183 VIGASTGGAVASYLGWRWCFLLQVPVSV--GGTIMAYMFLENQKGFVSESESSGQLLKNR 240

Query: 350 LYMMDWLGTFCLVIFLAS----LTLTCSLVDXXXXXXXXXXXXMF----VSGYYFVYHEL 401
              +D  G+  L++ LAS    LT+  S+              +     +S   F++ E 
Sbjct: 241 FSKIDLKGSLLLIVGLASQLMYLTVNSSMASSGSQWLSKESIGLILLTVLSLVMFIHTER 300

Query: 402 NIAADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTII 461
              A+PI+   LL+  +     + +          +F +P++F  V+       G R  I
Sbjct: 301 TTQANPIIPTKLLSQSHSTMVLVISVLVGFVSYAYLFTLPLFFQIVVGDSAARAGFRLAI 360

Query: 462 SFLGTSIGSFGTGYYIK 478
               T IG   TG  ++
Sbjct: 361 PSFCTPIGGLITGLSMR 377

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 99/320 (30%), Positives = 165/320 (51%), Gaps = 23/320 (7%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI+ST ++ IAS F+    ++W+A +Y+L+ C  QPLYGK SD+ GRK  LLF+ ++F +
Sbjct: 66  TIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVFIV 125

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           G ++CG A T+  L+  R +       L +M +II+SD+ PL  R+ Y    ++ +    
Sbjct: 126 GLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSDLAPLSQRSIYWGWGSVIWGFSQ 185

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
           ++GG +GG L  + G R +F++Q     I  C     L +  +H      L+N+   +  
Sbjct: 186 SVGGPLGGLLLNWFGVRGLFVVQ-----IPFCLFSLSLTVKYIHD-----LSNQT--QGT 233

Query: 350 LYMMDWLGTFCLVIFLASLTLTCS----LVDXXXXXXXXXXXXMF----VSGYYFVYHEL 401
              +D+ G+FCL+  +++    CS    + D            +     VSG  F+Y E 
Sbjct: 234 WRDIDFAGSFCLITGISAFIFLCSSSGDVTDDSAVSLFKVGCFLITVLSVSG--FIYVEK 291

Query: 402 NIAADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTII 461
           N+AA  IL   +L     + S +     ML+ V  +F VP+Y   V  +     G   + 
Sbjct: 292 NVAAKSILPAEVLKGSLGVISFIYGLASMLSYV-GLFVVPLYLQLVWGVSVAGSGGYIMY 350

Query: 462 SFLGTSIGSFGTGYYIKRRG 481
           + + TSIGSFG+G+ +++ G
Sbjct: 351 AVISTSIGSFGSGWLLRKYG 370

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score =  119 bits (299), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 94/313 (30%), Positives = 150/313 (47%), Gaps = 15/313 (4%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A EF+      WIA SYLL+   FQPLYGKLSD+ GRK  +L ++  FGL
Sbjct: 55  TIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGL 114

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL+   A +V      R +       + +M SI +SDI   R R  YQ   NI + LG 
Sbjct: 115 GCLLTCFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRERGIYQGYANIVFGLGQ 174

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLK-T 348
            LG  +GG   +  GWR++F LQV   L+    +   + +   H      L  +E  K +
Sbjct: 175 ILGAPIGGLFIDTLGWRILFGLQVPTILLCSSLVHKNVNIKLSH-----LLPVEERFKWS 229

Query: 349 KLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPI 408
            L  +D LG+  LV  ++ +   CS  +             F++   F+  EL  + + I
Sbjct: 230 NLSRIDILGSSTLVFTISGVLFLCS-TELNKALLSIFTVISFIA---FILIELYYSKERI 285

Query: 409 LSVHLLTDRNVLASS--LANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGT 466
           +   LL     LAS+  + + F +  D   IF  P+Y   +  +   + G   +   +  
Sbjct: 286 MPFELLKGSFGLASAATVISSFIIFGD---IFRSPIYLQLIQGVSVTKTGFFMLFPSISV 342

Query: 467 SIGSFGTGYYIKR 479
           ++GS  TG+ ++ 
Sbjct: 343 AVGSLATGWILRH 355

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 97/319 (30%), Positives = 159/319 (49%), Gaps = 22/319 (6%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI+ST ++ +AS F+    ++W+A +Y+L+ C  QPLYGK SD+ GRK  LLF+ ++F +
Sbjct: 69  TIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFAEVVFII 128

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           G ++CG A TV  L   R +       L +M +II+SD+ PL  R+ Y  L ++ +    
Sbjct: 129 GLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAPLSQRSIYWGLGSLIWGFSQ 188

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
           ++GG +GG L  + G   +F++QV       C    FL +  +H      L ++   +  
Sbjct: 189 SIGGPLGGLLLNWFGVSGLFVIQV-----PFCLFSLFLTVRYIHD-----LTDQR--QGT 236

Query: 350 LYMMDWLGTFCLVIFLASLTLTCSLVDXXXX-------XXXXXXXXMFVSGYYFVYHELN 402
              +D+ G+FCL+I +++   +CS  D                     V+G  FV  E  
Sbjct: 237 WRDIDFAGSFCLIIGISAFIFSCSAGDGVDSNDEGPFKVVCLIVTIAAVAG--FVVVEKR 294

Query: 403 IAADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIIS 462
           +A   IL  H+L     +   +     ML+ V  +F VP+Y   V        G   I +
Sbjct: 295 MATKSILPAHVLKGSLGVVGLIYGLSSMLSYV-GLFIVPLYLQVVWGTSVAGSGGYIIYA 353

Query: 463 FLGTSIGSFGTGYYIKRRG 481
            + TS+GSF +G+ ++R G
Sbjct: 354 VVSTSVGSFSSGWLLRRYG 372

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score =  118 bits (295), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 97/316 (30%), Positives = 150/316 (47%), Gaps = 23/316 (7%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A EF+      WIA S+LL+   FQPLYGKLSDI GRK  LL ++  F L
Sbjct: 69  TIVANIMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTFFCL 128

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL+   A  V      R +       +++M SI +SDI   R R +YQ   N+ +  G 
Sbjct: 129 GCLLTCFARNVTEFSIARAICGIGGGGISAMSSITVSDICTARERGAYQGYANVVFSTGQ 188

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
            LG  +GG+  +  GWR +F LQV   LI  C +         +    I LA+   L+ +
Sbjct: 189 LLGAPLGGFALDRIGWRAIFGLQVPMLLI--CMVLG-------YRNVNIKLAHVPPLEER 239

Query: 350 -----LYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIA 404
                L  +D  G+  LV  ++ +   CS                 +S   F+Y+EL +A
Sbjct: 240 FTWKNLSRIDIGGSITLVCTISGVLFLCS----TSLNKAILSVFTGLSFMLFMYNELYLA 295

Query: 405 ADPILSVHLLTDRNVLAS--SLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIIS 462
            + IL   LL     LAS  ++ + F +  DV   F  P++   V  +   + G   + S
Sbjct: 296 RERILPFELLGGSFGLASILTVGSSFVIFGDV---FRSPIFLQLVQNISVTKTGGFLLFS 352

Query: 463 FLGTSIGSFGTGYYIK 478
            + T+  S  TG+ ++
Sbjct: 353 SIATAAASLITGWILR 368

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score =  117 bits (294), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 139/291 (47%), Gaps = 17/291 (5%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A EFE      WIA S+LL+   FQPLYGKLSDI GR+  LL ++  FGL
Sbjct: 51  TIVANIMNRVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGL 110

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL+   A +V      R +       + +  SI +SDI   + R SYQ   NI +  G 
Sbjct: 111 GCLLTCFAQSVEQFALARAICGIGGGGINACSSIAVSDICTAKERGSYQGYANIVFGTGQ 170

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGC-FIQAFLILPKVHHGNGIALANKESLKT 348
            LGG +GG L +  GWR +F +QV   +I  C F+    I  K+ H   I   ++     
Sbjct: 171 MLGGPIGGLLIDTIGWRAIFAVQV--PIIMFCSFLTYKNITIKLSH---IPPVSERFTWM 225

Query: 349 KLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPI 408
            L  +D +G+  LV+ +  +   CS                 V   +F+  E   A + I
Sbjct: 226 NLSRIDIMGSSSLVVVICGILFICS----TNWNKVILSTFTIVGFLFFIVTETYFAKECI 281

Query: 409 LSVHLLTDRNVLASSLANFFCMLNDVLT---IFYVPMYFASVLYMGPKEIG 456
           L + LL      AS L +   +L+  +T   IF  P+Y+  V  M   + G
Sbjct: 282 LPLKLLKG----ASGLCSLVTVLSSFITFGEIFRAPIYYQVVQDMSVTKTG 328

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score =  116 bits (291), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 98/316 (31%), Positives = 143/316 (45%), Gaps = 15/316 (4%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A EFE      WIA S+LL+   FQPLYGKLSDI GRK  +L S+  FGL
Sbjct: 58  TIVANIMNKVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGL 117

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GC +   A  +      R +       + +M SI +SDI   R R  YQ   NI + LG 
Sbjct: 118 GCFLTCFAQNITQFSIARAICGIGAGGVNAMSSITVSDICSTRERGIYQGYANIVFGLGQ 177

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
            LG  +GG   +  GWR++F +QV   L+        + +   H         KE    K
Sbjct: 178 LLGAPLGGLFIDSVGWRVIFGVQVPMLLLCSTLATRNINVKLAHIP-----PRKERFTWK 232

Query: 350 -LYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPI 408
            L  +D  G+  LV  ++SL    S               M  S   F++ EL  A + I
Sbjct: 233 NLSRIDIFGSLALVGTISSLLFLTS----TTLNKIVLTLSMIASFILFIWIELYYAKERI 288

Query: 409 LSVHLLTDRNVLAS--SLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGT 466
           L   LL     L S  ++A+ F +  D   IF  P+Y   V  +   + G   +   +  
Sbjct: 289 LPFDLLKGSFGLCSLVTVASSFVVFGD---IFRSPIYLQLVQDISVTKTGLFLVFPSIAV 345

Query: 467 SIGSFGTGYYIKRRGK 482
           + GS  TG+ ++   K
Sbjct: 346 AGGSLVTGWILRHTKK 361

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score =  112 bits (280), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 94/315 (29%), Positives = 148/315 (46%), Gaps = 19/315 (6%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A EF+      WIA S+LL+   FQPLYGKLSDI GRK  LL +   FGL
Sbjct: 52  TIVANIMNKVAEEFQESQEKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLTALSFFGL 111

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GC +   +  +      R +       + ++ SI + DI   + R  YQ   NI + +G 
Sbjct: 112 GCFLTSLSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKDRGIYQGYANIVFGMGQ 171

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
            LG  +GG      GWR +F +QV   +I+    + ++ +  VH          E  K K
Sbjct: 172 LLGAPVGGLFIATIGWRALFWIQVPLVIIAIILGEMYVNIKLVH-----VPPPSERFKWK 226

Query: 350 -LYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYY-FVYHELNIAADP 407
            +  +D+LG+F LV      ++TC ++             + V  +  F+Y EL ++ D 
Sbjct: 227 NISRIDFLGSFTLV-----SSITCFIILISTKSNVILLSLLSVLSFIAFIYVELYVSKDR 281

Query: 408 ILSVHLLTDR---NVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFL 464
           IL   LL      N +A+ ++++         IF  P+Y   V      + G   I   +
Sbjct: 282 ILPFELLKGSFGCNSIATVISSYVIFGE----IFRSPIYLQLVQDFSVIKTGIFLIFPAI 337

Query: 465 GTSIGSFGTGYYIKR 479
            T+IGS  TG  +KR
Sbjct: 338 TTAIGSLVTGAILKR 352

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  114 bits (284), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 151/315 (47%), Gaps = 19/315 (6%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A EF       WIA S+LL+   FQPLYGKLSDI GRK+ LL ++  FG+
Sbjct: 54  TIVANIMNRVAEEFSESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGI 113

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL+   A  V      R +       L ++ SI +SDI   R R  YQ   NI + LG 
Sbjct: 114 GCLLTCFARNVTEFSIARAICGIGAGGLNAIGSIAVSDICTARERGVYQGYANIVFGLGQ 173

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQV-VAALISGCFIQAFLILPKVHHGNGIALANKESLKT 348
            LG  +GG   E  GWR +F +QV V  L S   I+   I  K+ H     +  + +LK 
Sbjct: 174 LLGAPLGGVFIETIGWRALFGVQVPVIMLCSVLAIKNINI--KLFHVP--PMKERYTLK- 228

Query: 349 KLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYY--FVYHELNIAAD 406
            L  +D  G+  LV  ++ +   CS               +F  G +  F+  E   A +
Sbjct: 229 NLSRIDIFGSLSLVATISGVLFLCS------SHLNKLYLTLFTIGSFIVFILVERYYATE 282

Query: 407 PILSVHLLTDRNVLASSLA--NFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFL 464
            IL + LLT    L+S++   + F +  +   IF  P+Y   +  +   + G   I   +
Sbjct: 283 KILPLELLTRSFCLSSAVTVISSFVVFGE---IFRSPIYLQLLQNISVTKTGLFLIFPSV 339

Query: 465 GTSIGSFGTGYYIKR 479
             ++GS  TG+ ++ 
Sbjct: 340 SVAVGSLVTGWLLRN 354

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score =  115 bits (287), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 108/500 (21%), Positives = 205/500 (41%), Gaps = 30/500 (6%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           +I+  +   IASEF  L  +S + + YLL   I Q ++ KLS + G K +L  +   F L
Sbjct: 273 SIILVIASKIASEFHELWRLSLVISVYLLGNAIGQLMFLKLSLVSGVKLLLCVAQFSFIL 332

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           G  +  ++   W  +  R V       L ++ S I++     R     ++ + +   + +
Sbjct: 333 GSYLSWSSIHFWTFILARSVTGFGSGSLIALKSTIMN-----RFSQKNENQYPLSTSMTV 387

Query: 290 -TLGGSMGGWLAEY------GGWRLVFLLQVVAALISGCFIQA--FLILPKVHHGNGIAL 340
            +LG ++G +L  +       GW+  FL+ V   L++   + A  + +   +HH  G   
Sbjct: 388 FSLGVAVGPFLVSFFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKNTIHH-EGPTT 446

Query: 341 ANKESLKTKLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMF----VSG-YY 395
             ++  K  L+  D      L +FL       SL              +F    + G  +
Sbjct: 447 TLQKRFKKVLWSPDLYEILTLALFLLCFVQATSLDSTRLEHSTMIQEIIFSVIIICGVLF 506

Query: 396 FVYHELNIAADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEI 455
           FV  + ++  + + S+ L  D++++ + +  FFC    +  I +   YF  VL +   EI
Sbjct: 507 FVIEKSDVRMNSVFSLSLQGDKHLIWTMMGIFFCFAALMCIIPFGTTYFMIVLNLDTLEI 566

Query: 456 GKRTIISFLGTSIGSFGTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXX 515
            +R +  F    +G F   Y+     +   F                    S+S W+Q  
Sbjct: 567 AERLLPFFFSIVVGYFSVCYFWNSERQNYLFKFVLSGVTLLLYVALMGMNLSLSVWKQYT 626

Query: 516 XXXXXXXXXXXVRTSLLISLIAAVPY-----KNQTAAASISYTFRXXXXXXXXXXXXXXF 570
                      + +S++++L++ + +     +    + SI+Y F               F
Sbjct: 627 CLSLPL-----LGSSMILTLLSTLYHEYHVQRKSPISGSIAYCFAAMGGTIGVSSAGYVF 681

Query: 571 RSSLKSLLNTNIMPLESEIHPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCK 630
             +L   +N  +M    + + K  L  II  AT S++WVH+ +P++    LI CY   C+
Sbjct: 682 HKTLVRTMNEEVMKFSKQGYLKKDLFKIIKHATQSSNWVHKSAPKFIFRTLIECYLQACR 741

Query: 631 RIFTFSVVCVLFTSISCYFL 650
            +F  S +    T ++ +F 
Sbjct: 742 NVFKLSALFFTITVVTLFFF 761

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 7  GIKTKERNRLKEFAKLKGRQRTLK 30
          G K ++R +L+EFAKLK RQR LK
Sbjct: 2  GKKDRQRKKLREFAKLKNRQRNLK 25

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score =  114 bits (284), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 100/314 (31%), Positives = 147/314 (46%), Gaps = 19/314 (6%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A EF       WIA S+LL+   FQPLYGKLSDI GR+  LL +   FGL
Sbjct: 54  TIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGL 113

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL+   A  V      R V       L ++ SI +SDI   R R  YQ   NI +  G 
Sbjct: 114 GCLMTCFARNVTEFSIARAVCGIGAGGLNAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFL-ILPKVHHGNGIALANKESLKT 348
            LG  +GG   E  GWR +F +QV   +I  C I A   I  K+ H     +  + +LK 
Sbjct: 174 LLGAPLGGIFIETIGWRALFGVQV--PMIIVCSILAIKNINIKLFHVP--PMKERYTLK- 228

Query: 349 KLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYY--FVYHELNIAAD 406
            L  +D  G+  LV  ++ +   CS               +F  G +  FV  E   A +
Sbjct: 229 NLSRIDIFGSLSLVATISGVLFLCS------SHMNKIYLALFTIGSFIVFVLVERYYATE 282

Query: 407 PILSVHLLTDRNVLASSLA--NFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFL 464
            IL   LLT    L+S++   + F +  +   IF  P+Y   +  +   + G   I   +
Sbjct: 283 RILPFELLTGSFCLSSAVTVISSFVVFGE---IFRSPIYLQLLQNISVTKTGLFLIFPSI 339

Query: 465 GTSIGSFGTGYYIK 478
             ++GS  TG+ ++
Sbjct: 340 SVAVGSLVTGWVLR 353

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 148/315 (46%), Gaps = 19/315 (6%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A EF       WIA S+LL+   FQPLYGKLSDI GRK+ LL +   FGL
Sbjct: 54  TIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQFFFGL 113

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL+   A  V      R +       L ++ SI +SDI   R R  YQ   NI +  G 
Sbjct: 114 GCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQV-VAALISGCFIQAFLILPKVHHGNGIALANKESLKT 348
            LG  +GG   E  GWR +F +QV V  L S   I+   I  K+ H     +  + +LK 
Sbjct: 174 LLGAPLGGVFIETIGWRALFGIQVPVIMLCSVLAIKNINI--KLFHVP--PMKERYTLK- 228

Query: 349 KLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYY--FVYHELNIAAD 406
            L  +D  G+  LV  ++ +   CS               +F  G +  F+  E   A +
Sbjct: 229 NLSRIDIFGSLSLVATISGVLFLCS------SQLNKLYLALFTIGSFIVFILVERYYATE 282

Query: 407 PILSVHLLTDRNVLASSLA--NFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFL 464
            IL   LLT    L+S++   + F +  +   IF  P+Y   +  +   + G   I   +
Sbjct: 283 KILPFELLTRSFCLSSAVTVISSFVVFGE---IFRSPIYLQLLQNISVTKTGLFLIFPSI 339

Query: 465 GTSIGSFGTGYYIKR 479
             ++GS  TG+ ++ 
Sbjct: 340 SVAVGSLVTGWVLRN 354

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 148/315 (46%), Gaps = 19/315 (6%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A +F       WIA S+LL+   FQPLYGKLSDI GRK+ LL +   FGL
Sbjct: 54  TIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLIAQFFFGL 113

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL+   A  V      R +       L ++ SI +SDI   R R  YQ   NI +  G 
Sbjct: 114 GCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARERGVYQGYANIVFGFGQ 173

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFL-ILPKVHHGNGIALANKESLKT 348
            LG  +GG   E  GWR +F +QV   +I  C I A   I  K+ H     +  + +LK 
Sbjct: 174 LLGAPLGGVFIETIGWRALFGVQV--PMIMLCTILAIKNINIKLFHVP--PMKERYTLK- 228

Query: 349 KLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYY--FVYHELNIAAD 406
            L  +D  G+  LV  ++ +   CS               +F  G +  FV  E   A +
Sbjct: 229 NLSRIDLFGSLSLVATISGVLFLCS------SHLNKLYLSLFTIGSFIVFVLVERYYATE 282

Query: 407 PILSVHLLTDRNVLASSLA--NFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFL 464
            IL   LLT    L+S++   + F +  +   IF  P+Y   +  +   + G   I   +
Sbjct: 283 RILPFELLTPSFCLSSAVTVISSFVVFGE---IFRSPIYLQLLQNISVTKTGLFLIFPSI 339

Query: 465 GTSIGSFGTGYYIKR 479
             ++GS  TG+ ++ 
Sbjct: 340 SVAVGSLVTGWVLRN 354

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 93/315 (29%), Positives = 146/315 (46%), Gaps = 13/315 (4%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A EF       WIA S+LL+   FQPLYGKLSD+ GRK  LL +     +
Sbjct: 53  TIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVI 112

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL+   A  V      R +       + +  SI +SDI   + R  YQ   NI + +G 
Sbjct: 113 GCLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDICTAKERGIYQGYANIVFGMGQ 172

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
            LG  +GG   +  GWR +F +QV   ++S  F+    +  K+ H   I+   +   +  
Sbjct: 173 MLGAPLGGLFIDTIGWRAIFGIQVPVVMVSA-FLAYRNVNIKLSHVPPIS---ERFTRKN 228

Query: 350 LYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPIL 409
           L  +D+LG+  L   +  + + CS  D             FV    F++ EL  AA+ IL
Sbjct: 229 LSRIDFLGSVTLASTICGVLVLCS-TDLNKLVVSLATAASFV---LFLWVELFYAAERIL 284

Query: 410 SVHLLTDRNVLAS--SLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTS 467
              LL     L+S  ++ + F +  D   IF  P+Y   +  +     G   I   +  +
Sbjct: 285 PFELLKGPFGLSSVVTVCSSFVIFGD---IFRSPIYLQLIHDLSVTNTGLFMIFPSVSVA 341

Query: 468 IGSFGTGYYIKRRGK 482
           +GS  TG  ++R  K
Sbjct: 342 VGSLVTGAVLRRTSK 356

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score =  110 bits (276), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 98/317 (30%), Positives = 150/317 (47%), Gaps = 17/317 (5%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A EF       WIA S+LL+   FQPLYGKLSDI GRK  +L ++  FGL
Sbjct: 61  TIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGL 120

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL+   A  V      R +       + +M SI  SDI   R R  +Q   NI + +G 
Sbjct: 121 GCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRERGIFQGYANIVFGMGQ 180

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
            LG  +GG   ++ GWR +F +QV   +I  C   ++L +  V+         KE    K
Sbjct: 181 VLGAPLGGLFLDHIGWRTLFGIQV--PMIMFC---SYLTITNVNIKLLHVPPRKERFTWK 235

Query: 350 -LYMMDWLGTFCLVIFLAS-LTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIAADP 407
            L  +D  G+  LV  ++  L LT + +D             F+S   F++ EL  A + 
Sbjct: 236 NLSRIDIFGSLSLVATISGILFLTSTQLDKLLLSLFT-----FISFGLFMWIELYYAKER 290

Query: 408 ILSVHLLTDRNVLAS--SLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLG 465
           IL   LL     L S  ++ + + +  D   IF  P+Y   +  +   + G   II  + 
Sbjct: 291 ILPFDLLNGSFGLCSVVTVISSYVVFGD---IFRSPIYLQLIQDISVTKTGLFLIIPSIA 347

Query: 466 TSIGSFGTGYYIKRRGK 482
            + GS  TG+ ++   K
Sbjct: 348 MAGGSLVTGWILRNTTK 364

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score =  108 bits (271), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 105/198 (53%), Gaps = 6/198 (3%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           T+ ++    I +EF  +   SWI ASYL+++  FQPLYG  SD+ GR+  L F++++F +
Sbjct: 85  TVTASTYQTIGNEFNHMDLSSWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSI 144

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL CG +  + WL   R         L ++ +I+ SD++P   R  +Q   N+   LG 
Sbjct: 145 GCLGCGISINILWLSFMRAFTGIGGGGLITLSTIVNSDMIPTSKRGIFQAFQNLLLGLGA 204

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
             G S GG +    GWR  FLLQV  +L +G  I    +  +  +       +KES +TK
Sbjct: 205 ICGASFGGVITSSIGWRWCFLLQVPISL-AGALIGHLYVRNQDEYERR---KSKESSQTK 260

Query: 350 --LYMMDWLGTFCLVIFL 365
             L  +D+ G F ++I L
Sbjct: 261 EMLKHIDFSGAFLIIIGL 278

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 85/144 (59%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +  EF+    I W+A S+LL++ +FQP+YGKLSD+ GR+ +L+ +  +F L
Sbjct: 65  TIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLAYSLFLL 124

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCLV   A  +W    GR +       + +M  I + D+  ++ ++ YQ   +I Y +G 
Sbjct: 125 GCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSVKEQSIYQSYAHIIYTIGE 184

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQV 313
            LG  +GG   E  GWR +FL QV
Sbjct: 185 VLGAPIGGIALETVGWRAIFLAQV 208

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 93/316 (29%), Positives = 141/316 (44%), Gaps = 21/316 (6%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           T+++ +++ IA+EF       WIA SYLL+   FQPLYGKLSDI GRK  ++ ++  F L
Sbjct: 60  TVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFAL 119

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL+   A  V      R +       + +M SI ++DI   R R  YQ   N+ +  G 
Sbjct: 120 GCLLTCFAQNVTQFSIARAICGIGGGGINAMSSITVTDICSARERGVYQGYANVVFGTGQ 179

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
            LG  +GG+L +  GWR +F +QV   ++        + +  VH    I   N+      
Sbjct: 180 LLGAPIGGFLLDSIGWRSIFGIQVPMLMLCSVLALKNVNIKLVH----IPPRNERFTWKN 235

Query: 350 LYMMDWLGTFCLV------IFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNI 403
           L  +D  G+  LV      +FL S     SL+               +S   F+Y EL +
Sbjct: 236 LSRIDIFGSISLVATISGILFLTSSNWNKSLLGIFTV----------LSFSLFIYIELYV 285

Query: 404 AADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISF 463
           A + I+   LL     L SS+A           IF  P+Y   +  +     G   I   
Sbjct: 286 AKERIMPFELLKGSFGL-SSIATVITSFIIYGEIFRSPIYLQLIQNVSVTVTGLYLIFPS 344

Query: 464 LGTSIGSFGTGYYIKR 479
           +  ++GS  TG  ++ 
Sbjct: 345 VAIALGSIVTGSILRN 360

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 97/396 (24%), Positives = 161/396 (40%), Gaps = 16/396 (4%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           T+ ++    I +EF  +   +WI  +YL+++  FQPLYG  SD  GR+  L F+N  F +
Sbjct: 71  TVTASTYQTIGNEFNQMSISNWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAAFTI 130

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL C  +  ++ L   R +A      L ++ +I+ SD++P   R  +Q   N+    G 
Sbjct: 131 GCLACSLSTNIYTLSLMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGA 190

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPK-VHHGNGIALANKESLKT 348
             G S GG +A   GWR  FL+QV  ++IS   +  ++   K  +H N     N + + T
Sbjct: 191 ICGASFGGTIASTIGWRWCFLIQVPISIISSVLMNYYVPNQKEYNHENSNIFRNSKRILT 250

Query: 349 KLYMMDWLGTFCLV----IFLASLTLTCSLVDXXXXXXXXXXXXMFVSG-----YYFVYH 399
            +   D  G+  ++    + L  L+L CS               + + G       F+ H
Sbjct: 251 DI---DITGSILIITGLTLQLLYLSLGCS---GSKLSWTSPSVLLLLVGSIAILLLFISH 304

Query: 400 ELNIAADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRT 459
           E    A  I+ + L++        L +          +F +P++F  VL     + G R 
Sbjct: 305 EKKTTARAIIPMELVSSSYSFVVLLISILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRL 364

Query: 460 IISFLGTSIGSFGTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXX 519
            I  L T +GS  TG+ + +    R+                   + +   W        
Sbjct: 365 AIPSLFTPVGSLITGFSMSKYNCLRSLLYVGVSLMFLGNFLFLFIEKTSPNWLISLFLIP 424

Query: 520 XXXXXXXVRTSLLISLIAAVPYKNQTAAASISYTFR 555
                     + L + I   P  +Q  A S  Y FR
Sbjct: 425 ANLGQGITFPTTLFTFIFLFPKSDQATATSTLYLFR 460

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  105 bits (263), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 110/490 (22%), Positives = 183/490 (37%), Gaps = 14/490 (2%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           T+ ++    I +EF  +   SWI  +YL+++  FQPLYG  SD  GR+  L F+N  F +
Sbjct: 73  TVTASTYQTIGNEFNHMNISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTI 132

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL CG +P +  L   R +       L ++ +I+ SD++P   R  +Q   N+   LG 
Sbjct: 133 GCLACGLSPNIVVLSFMRALTGIGGGGLITLSTIVNSDMIPSSKRGIFQAFQNLLLGLGA 192

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
             G S GG +A   GWR  F +QV   + +   + +++   K +    I        K  
Sbjct: 193 ICGASFGGSIASSIGWRWCFFVQVPICITNSLIMSSYVPNQKEYEDREIGFLFHP--KKI 250

Query: 350 LYMMDWLGTFCLVI---FLASLTLTCSLVDXXXXXXXXXXXXMFVSG---YYFVYHELNI 403
           L  +D  G+  ++I            S               +F SG     FVY+E   
Sbjct: 251 LKDIDVTGSVFIIIGLTLQLLYLSLGSSKVGVSWTSPSVLPLLFASGIILVLFVYNEAKT 310

Query: 404 AADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISF 463
           +A  I+ + L+           +          +F +P++F  VL     + G R  I  
Sbjct: 311 SARAIIPLELMRSSFSFVVLTISILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPS 370

Query: 464 LGTSIGSFGTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXX 523
           L T +G   TG  + R    +                    +     W            
Sbjct: 371 LFTPVGGLITGICMSRYNCLQILLYAGVFLMALGNFLFLFIEKGSPNWLVGLFLIPANLG 430

Query: 524 XXXVRTSLLISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIM 583
                 + L + I A P   Q  A S  Y FR               +      L +N+ 
Sbjct: 431 QGITFPATLFTFIFAFPKSRQATATSTLYLFRSIGSVWGVAMSTGVIQLYFGKSLRSNLK 490

Query: 584 PLESEIHPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFT 643
            L  E     ++  ++ K T ++ ++ +   E    ++I C+    K+    S +  L  
Sbjct: 491 DLLDE----DKINELVTKITSNSSYIEKLHGELK-DVVIDCFDSSTKKAHLLSTILSLLA 545

Query: 644 SISCYFLKEY 653
              C  +KE+
Sbjct: 546 LAFCV-IKEF 554

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 98/421 (23%), Positives = 167/421 (39%), Gaps = 8/421 (1%)

Query: 190 SWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFV 249
           +WI  +YL+++  FQPLYG  SD  GR+  L F+N  F +GCL CG +  ++ L   R +
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFMRAL 64

Query: 250 AXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVF 309
                  L ++ +I+ SD++P   R  +Q   N+    G   G S GG +A   GWR  F
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIASTIGWRWCF 124

Query: 310 LLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTFCLV----IFL 365
           L+QV  ++IS   +  ++   K ++     + N    K  L  +D +G+  ++    + L
Sbjct: 125 LIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDP--KKILTGIDVMGSILIITGLTLQL 182

Query: 366 ASLTLTCSLVDXXXXXXXXXXXXM--FVSGYYFVYHELNIAADPILSVHLLTDRNVLASS 423
             L+L CS  +                +    F+ HE    A  I+ + L++        
Sbjct: 183 LYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSSYSFVVL 242

Query: 424 LANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGKY 483
             +          +F +P++F  VL     + G R  I  L T +GS  TG+ + +    
Sbjct: 243 SISILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLITGFSMSKYNCL 302

Query: 484 RTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXXXXVRTSLLISLIAAVPYKN 543
           R+                   + +   W                  + L + I   P  +
Sbjct: 303 RSLLYLGISLMFLGNFLFLFIEETSPNWLISLFLIPANLGQGITFPTTLFTFIFMFPKSD 362

Query: 544 QTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMPLESEIHPKSQLLHIIDKAT 603
           Q  A S  Y FR               + S  + L TN+  L  E   K  ++ + D ++
Sbjct: 363 QATATSTLYLFRSIGSVWGVAISAGVIQLSFANFLCTNLKGLLDENTIKKLVIKLSDNSS 422

Query: 604 H 604
           +
Sbjct: 423 Y 423

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 119/492 (24%), Positives = 192/492 (39%), Gaps = 10/492 (2%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           +IL  ++  IASEF  L  +S I + YLLS  I Q L+ KLS I   K +L  +   F L
Sbjct: 267 SILLVIVSKIASEFHELWRLSLIVSVYLLSNAIGQLLFLKLSIISSVKLLLCMAQFSFIL 326

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           G  +  ++   W  +  RFVA      L ++ S I++                I + LG+
Sbjct: 327 GSYLSWSSSHFWTFIFARFVAGFGSGSLIALKSTIMNRFSQKNESRYSLSASVIIFSLGV 386

Query: 290 TLGGSMGGWL-AEYG-GWRLVFLLQVVAALISGCFIQA--FLILPKVHH-GNGIAL---A 341
            +G  + G   + +G GW+  FL+ V   L++   + A  + +   +HH G+   L    
Sbjct: 387 AIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNASIMLADIYSVKDNLHHEGSTFTLWKRV 446

Query: 342 NKESLKTKLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHEL 401
            K  L   LY +  L  F L     + TL  + ++            + + G  F   E 
Sbjct: 447 KKILLSPDLYEILTLTLFLLCFVQVT-TLDLTELEHRTMIQWVLFSVILICGVLFWLIEA 505

Query: 402 NIA-ADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTI 460
           N    + ++S+ L  D+ ++ +     FC    +  I +   YF  VL +   +I +R +
Sbjct: 506 NDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMCIIPFGTTYFTIVLNLNTLQIAERLL 565

Query: 461 ISFLGTSIGSFGTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXKPSISTWRQXXXXXXX 520
             F    IG F   Y+ K + +                        S+  W+Q       
Sbjct: 566 PFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTLILYITLMGVGLSLPVWKQYVCLSLP 625

Query: 521 XXXXXXVRTSLLISLIAAVPYKNQTAAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNT 580
                 + T L          +    + SI Y F               F  +L   L+ 
Sbjct: 626 FLGSSMLLTLLSSLYHEYHEQRKSLNSGSIVYCFGAIGGTIGISLGGYVFHKTLTKSLHE 685

Query: 581 NIMPLESEIHPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCV 640
            +M    + + K  LL II  AT S+DWVH  +P++    LI CY   C+ +F  S V  
Sbjct: 686 EVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPKFIFKTLIECYLQACRNVFKLSAVFF 745

Query: 641 LFTSISCYFLKE 652
               IS +F  +
Sbjct: 746 TIMVISMFFFNK 757

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 7  GIKTKERNRLKEFAKLKGRQRTLKSDEAG-----ETYLGDKSNTISFGPYSRSSDESQGE 61
          G K ++R +L+EFAKLK RQ+ L++         +  +G+  N       +  S+E++  
Sbjct: 2  GKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENKEN 61

Query: 62 TIPFLTRIDK 71
          T   LT  ++
Sbjct: 62 TPLLLTSSER 71

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score =  103 bits (256), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 128/585 (21%), Positives = 228/585 (38%), Gaps = 32/585 (5%)

Query: 86  INKLEVQELSLGSAGSQSTTILNS------SYGSTSTTVTPDSNKNGNVFIRSSSVEVGN 139
           IN L   +LS  SA S    +++        YGS S TV    N   + + R +S     
Sbjct: 199 INALPTSDLSPTSATSAPEVLVDRPQMRAYEYGSISRTVKDVENGTTSSYARVAS----- 253

Query: 140 IGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLLDYIASEFEALPYISWIAASYLLS 199
             D       R                   TIL +++  IASEF  L  +S I + YLLS
Sbjct: 254 -SDKFVHDLTRRRIFSSCMCTYLFFIAMDSTILMSIVSKIASEFHELWRLSLIISIYLLS 312

Query: 200 ACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTS 259
             I Q ++ KLS +   K +L  +   F LG  +  +A   W  +  R +       L +
Sbjct: 313 NAIGQLVFLKLSIVTSVKLLLCVAQFSFILGSYLSWSAFHFWTFVFARSITGFGSGALMA 372

Query: 260 MPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWL--AEYGGWRLVFLLQVVAAL 317
           + S I++     +          I + LG+ +G  +      +   GW+  FL+ V   L
Sbjct: 373 LKSTIMNRFSDKKKNGYSLSASVIVFSLGVAIGPFLVYLFDNSRGSGWKNAFLIPVPFCL 432

Query: 318 ISGCFIQA--FLILPKVHHGNGIALANKESLKT----KLYMMDWLGTFCLVIFLASLTLT 371
           ++   + A  + I   +HHG    ++ K   K      LY +       L+ F+   +L 
Sbjct: 433 VNASIMLADIYSIKDNLHHGGSAPISWKRIKKILMSPDLYEIL-TLALLLLCFVQVTSLD 491

Query: 372 CSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIA-ADPILSVHLLTDRNVLASSLANFFCM 430
            + ++            +   G  F + E N   A+ I+S+ L  D++++ + +   FC 
Sbjct: 492 ITRLEHSAVIQGVLFFVIITCGILFWWIETNETYANSIISMSLRGDKHLMWTIMGISFCF 551

Query: 431 LNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGKYRTFXXXX 490
              +  I +   YF  VL +   +I +R +   +   +G F   Y+ K + K        
Sbjct: 552 AALMCIIPFGTTYFTIVLNISTLQIAERLLPLSVAIVVGYFSVCYFWKPQMKNYLLEVVL 611

Query: 491 XXXXXXXXXXXXXXKPSISTWRQXXXXXXXXXXXXXVRTSLLISLIAAVPY-----KNQT 545
                           S+  W+Q             + ++++++L++++ +     K   
Sbjct: 612 GGVTLILYIALMGASLSLPVWKQYVCLSLPL-----LGSAMILTLLSSLYHEYHQPKKSP 666

Query: 546 AAASISYTFRXXXXXXXXXXXXXXFRSSLKSLLNTNIMPLESEIHPKSQLLHIIDKATHS 605
            + SI Y F               F  +L   ++  +M      + +  LL II+ AT S
Sbjct: 667 ISGSIVYCFSAMGGTIGISLGGYVFHKTLLKAVHDGVMKFSKHGYHEKDLLKIIEHATQS 726

Query: 606 TDWVHRESPEYAIPILISCYHYVCKRIFTFSVVCVLFTSISCYFL 650
           +DWVH  +P++    LI CY   C+ +F  S +    T ++ +F 
Sbjct: 727 SDWVHESAPKFIFQTLIECYLQACRNVFKLSAILFTITVMTMFFF 771

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 10/67 (14%)

Query: 7  GIKTKERNRLKEFAKLKGRQ-------RTLKSDEAGETYLGDKSNTISFGPYSRSSDESQ 59
          G K ++R +L+EFAKLK RQ       ++LK +   ++   +  N I FG   R   E  
Sbjct: 2  GKKDRQRKKLREFAKLKNRQQNLRKSVQSLKKEVQRKSVAPENLNRIVFGNLKR---EEA 58

Query: 60 GETIPFL 66
           E  P L
Sbjct: 59 SENSPLL 65

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score =  102 bits (254), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 85/157 (54%), Gaps = 2/157 (1%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A EFE      WI  S+LL+   FQPLYGKLSD+ GRK  L+ ++  F +
Sbjct: 58  TIVANIMNKVAEEFEESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLV 117

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL    +  +      R V       ++++ SI +SDI   + R  YQ   N+ +  G 
Sbjct: 118 GCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPKERGVYQGYANVVFGTGS 177

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAF 326
            LGG +GGWL +  GW+++F  QV   LI  C    +
Sbjct: 178 MLGGPIGGWLMDSFGWKVIFAGQV--PLIMTCMFLGY 212

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score =  102 bits (253), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 79/144 (54%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI++ +++ +A +F A     WIA SYLL+   FQPLYG+LSDI GRK   L     FG+
Sbjct: 84  TIVAVIMNRVAEDFNASNQKQWIATSYLLTNTAFQPLYGRLSDIIGRKYTQLIVPFFFGM 143

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           G  +   + T+      R VA      +++M SI +SDI  ++ R  YQ   NI Y  G 
Sbjct: 144 GSFLTTFSKTLPQFALARAVAGIGGGGISAMSSIAVSDICTVKERGMYQGYANIFYGAGQ 203

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQV 313
            +G  +GG L +  GWR +F  QV
Sbjct: 204 LIGAPIGGLLIDRIGWRALFAFQV 227

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 99.0 bits (245), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 94/180 (52%), Gaps = 2/180 (1%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI ++    I +EF  +   SWI  +YL+++  FQPLYG  SD  GR+  L F+N +F +
Sbjct: 76  TITASTYQTIGNEFNQMSISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAVFTI 135

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           GCL C  +  ++ L   R +A      L ++ +I+ SD++P   R  +Q   N+    G 
Sbjct: 136 GCLACSFSTNIYMLSFMRALAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGA 195

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGN--GIALANKESLK 347
             G S GG +    GWR  FL+QV  ++I+   +  ++   K +      I L++K+ LK
Sbjct: 196 ICGASFGGTITSTIGWRWCFLIQVPISMIASLLMNYYVPNQKEYDDQKINILLSSKKILK 255

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 36/324 (11%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIF-GRKAILLFSNLMFG 228
           TI++ +++ IA EF+      WIA S+LL+   FQPLYGKLSD+  GRK   L +   F 
Sbjct: 58  TIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKGAALVAQFFFC 117

Query: 229 LGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLG 288
           LG ++   A  V     GR V       + +M SI++SDI   + R  YQ   NI +  G
Sbjct: 118 LGLVISCFAQNVTQFAVGRAVCGIGGGGIAAMSSIVVSDICTAKERGMYQGYANIVFGSG 177

Query: 289 ITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALAN----KE 344
             LG  +GG L    GWR +F +QV   L+  C + AF           I LA+    KE
Sbjct: 178 QLLGAPLGGLLITTLGWRAIFAIQVPVTLL--CMVLAF-------RNVNIKLAHLPPPKE 228

Query: 345 SLKTK-LYMMDWLGTFCLV------IFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFV 397
               K L  +D LG+  LV      +FL S TL    +               VS   FV
Sbjct: 229 CFTLKNLSRLDLLGSCTLVMSISGLLFLFSTTLNKLWISIFTA----------VSFGLFV 278

Query: 398 YHELNIAADPILSVHLLTDRNVLASSLANF--FCMLNDVLTIFYVPMYFASVLYMGPKEI 455
           Y+E   A + I+   LL   + + S+L     F M  DV   F  P+Y   V  +     
Sbjct: 279 YNEYYWATERIIPFELLRGESGVTSALTVLSSFVMFGDV---FRSPIYLQVVQNVSLARS 335

Query: 456 GKRTIISFLGTSIGSFGTGYYIKR 479
           G   +   +  +  S  TG+ I+R
Sbjct: 336 GLFILFGSIACAGSSMLTGWLIRR 359

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/157 (36%), Positives = 83/157 (52%), Gaps = 2/157 (1%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           +I++ +++ IA EF       W+A S+LL+   FQPLYG+ SDI GRK  LL +   F L
Sbjct: 62  SIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLL 121

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           G L+   A  V      R +       + +M SI +SDI   + R  YQ   N+ +  G 
Sbjct: 122 GTLLTCFARNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKERGMYQGYANVIFGAGQ 181

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAF 326
            LG  +GG + E   WR++F  QVVA +I  C I A+
Sbjct: 182 VLGAPVGGLIMETFNWRIIFAAQVVAIMI--CMILAY 216

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score = 93.2 bits (230), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 107/508 (21%), Positives = 195/508 (38%), Gaps = 51/508 (10%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           +I+  +   IASEF  L  +S + ++YLLS  I Q ++ KLS I   K +L  +   F L
Sbjct: 267 SIILVIASKIASEFHELWRLSLVISAYLLSNAIGQLVFLKLSLISSVKLLLCIAQFSFIL 326

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           G  +  ++   W  +  R V       L ++ S I++                I + +G+
Sbjct: 327 GGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGV 386

Query: 290 TLGGSMGGWL-AEYG-GWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLK 347
            +G  M     + +G GWR  FL+ V   L++                  I LA+  S+K
Sbjct: 387 VIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNA----------------SIMLADMYSVK 430

Query: 348 TKLY----------------------MMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXX 385
           + LY                      ++         + + SL LT  L +         
Sbjct: 431 STLYGRPTPTLWKRFKNTLLSPDLYEILTLTLFLLCFVQVTSLDLT-GLKNNTMIQALLF 489

Query: 386 XXXMFVSGYYFVYHELNIAADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFA 445
              +     +F+    +   + ++S+ L  D+ ++ + +   FC    +  I +   YF 
Sbjct: 490 SVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFI 549

Query: 446 SVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGKYRTFXXXXXXXXXXXXXXXXXXK 505
            VL +   ++ +R    F    +G F   Y+ K +G+                       
Sbjct: 550 IVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLLLYVALMGVS 609

Query: 506 PSISTWRQXXXXXXXXXXXXXVRTSLLISLIAAV--PYKNQTAA---ASISYTFRXXXXX 560
            ++  W+Q             + +S++++L++ +   Y  Q  +    SI Y F      
Sbjct: 610 LNLPVWKQYICLSLPF-----LGSSMILTLLSNLYHEYHEQRKSPISGSIVYCFGAVGGT 664

Query: 561 XXXXXXXXXFRSSLKSLLNTNIMPLESEIHPKSQLLHIIDKATHSTDWVHRESPEYAIPI 620
                    F  +L  L++  +MP   + + K  LL II  AT S+DWVH  +P++    
Sbjct: 665 VGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQT 724

Query: 621 LISCYHYVCKRIFTFSVVCVLFTSISCY 648
           LI CY   C+ +F  S +    T ++ +
Sbjct: 725 LIECYLQACRNVFKLSTLFFTITVVAIF 752

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 45/98 (45%), Gaps = 13/98 (13%)

Query: 7  GIKTKERNRLKEFAKLKGRQR-------TLKSDEAGETYLGDKSNTISFGPYSRSSDESQ 59
          G K ++R +L+EFAKLK RQR       TLK++   E  +   SN I+ G       E  
Sbjct: 2  GKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALG---NDKIEEI 58

Query: 60 GETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLG 97
           E  P L+   K   Q+  S      I+ ++ Q L  G
Sbjct: 59 NENSPLLSAPSK---QEEVSIPKAVDIDTIDAQPLHEG 93

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 134/301 (44%), Gaps = 8/301 (2%)

Query: 190 SWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFV 249
           +WI  +YL+++  FQPLYG  SD  GR+  L F+N  F +GCL CG +  ++ L   R +
Sbjct: 5   NWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANGAFTIGCLACGFSKNIYMLSFMRAL 64

Query: 250 AXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVF 309
                  L ++ +I+ SD++P   R  +Q   N+    G   G S GG +A   GWR  F
Sbjct: 65  TGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAICGASFGGTIASSIGWRWCF 124

Query: 310 LLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTFCLV----IFL 365
           L+QV  ++IS   +  +  +P     N    +  ++    L  +D +G+  ++    + L
Sbjct: 125 LIQVPISVISSILMNYY--VPNQKEYNRQNSSIFQNPGKILRDIDVMGSILIITGLTLQL 182

Query: 366 ASLTLTCSLVDXXXXXXXXXXXXM--FVSGYYFVYHELNIAADPILSVHLLTDRNVLASS 423
             L+L CS               +   +    F+ HE   +A  I+ + L+     +   
Sbjct: 183 LYLSLGCSTSKLSWTSPSVLLLLVGSVIILLLFILHERKTSARAIIPMELVNSSYSVVVL 242

Query: 424 LANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGKY 483
             +          +F +P++F  VL     + G R  I  L T +GS  TG+ + +    
Sbjct: 243 SISILVGFASYAYLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLITGFSMSKYNCL 302

Query: 484 R 484
           R
Sbjct: 303 R 303

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 70/108 (64%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI+ST ++ IAS+F+    ++W+A +YLL+    QPLYGK+SDI GR+  LLF  ++F L
Sbjct: 78  TIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFAL 137

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASY 277
           G L+C  A T+  L   R +        ++M +I+++DI+PL  RA+Y
Sbjct: 138 GVLLCNFANTIPQLAIARAICGIGGSGNSAMGNIMLNDILPLSVRATY 185

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 95/313 (30%), Positives = 141/313 (45%), Gaps = 14/313 (4%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIF-GRKAILLFSNLMFG 228
           TI++ +++ IA EF+      WIA S+LL+   FQPLYGKLSD+  GRK   L +   F 
Sbjct: 58  TIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFF 117

Query: 229 LGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLG 288
           LG ++   A  V     GR V       +++M SI +SDI   + R  YQ   NI +  G
Sbjct: 118 LGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSIAVSDICTAKERGMYQGYANIVFGSG 177

Query: 289 ITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKT 348
             LG  +GG L    GWR +F +QV  AL    F+    +  K+ H   +   N+     
Sbjct: 178 QLLGAPLGGLLITTIGWRAIFAIQVPMALFC-MFLTGRNVNIKLAH---LPSRNERFTLK 233

Query: 349 KLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPI 408
            L  +D LG+  LV+ ++ L    S                 V+   F+Y+E   A + I
Sbjct: 234 NLSRLDLLGSCTLVLSISGLLFLFS----TSMNRTWISAFTIVTFAIFIYNERFWAKERI 289

Query: 409 LSVHLLTDRNVLASSLANF--FCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGT 466
           +   LL   + + S L     F M  DV   F  P+Y   V  +   + G   +   +  
Sbjct: 290 IPFDLLCGTSGITSLLTVLSSFIMFGDV---FRSPIYLQIVQNVSLAKSGIFILFGSVAC 346

Query: 467 SIGSFGTGYYIKR 479
           +  S  TG+ I+R
Sbjct: 347 AATSVLTGWIIRR 359

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 64/108 (59%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           TI+ST ++ +AS F+    ++W+A +YLL+    QPLYGK+SDI GR+  LLF  ++F +
Sbjct: 120 TIVSTTVNDVASRFQQASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIVFAV 179

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASY 277
           G  +C  + ++  L   R +         +M +II+SD+ PL  R  Y
Sbjct: 180 GVGLCIFSKSIPQLAIARGICGIGGSGTGAMTNIILSDMAPLSERGKY 227

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 79/153 (51%), Gaps = 1/153 (0%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ T+L+ IA +F A   I W+   Y LS  +F  L+G+ + IFG K  L+ S ++F +G
Sbjct: 39  IVVTILNTIADKFNAYSKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIG 98

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            LV   + ++  ++ GR +A      + ++   I + +V   +R +   L ++ Y +   
Sbjct: 99  SLVIAVSNSMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAVASA 158

Query: 291 LGGSMGGWLAEYGGWRLVFLLQV-VAALISGCF 322
           LG  +GG L EY  WR  F + + +  L  G F
Sbjct: 159 LGPYIGGALTEYVTWRWCFYINLPIGGLALGVF 191

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 72/143 (50%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ TL + I  +F     + W+   Y LS+ +F  L+G+++ + G K  L+ S L+F +G
Sbjct: 62  IVVTLYETIGEKFNDYNDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIG 121

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   + ++  L+AGR VA      + S+  I+ + +V  RSR     +    +V    
Sbjct: 122 SLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNA 181

Query: 291 LGGSMGGWLAEYGGWRLVFLLQV 313
            G  +GG L E+  WR  F + +
Sbjct: 182 GGPILGGALNEHASWRWCFFINL 204

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/167 (28%), Positives = 83/167 (49%), Gaps = 6/167 (3%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+S  ++ IA +F+      WI + Y L+  +   L+G+ + I G K+ LL S L+F  G
Sbjct: 137 IISASIEVIAEQFKDYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAG 196

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   + ++  L+ GR VA      + S+  +I S + P RSR     + +  Y +   
Sbjct: 197 SLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIASTLTPDRSRVIIISVLSCSYAVAAV 256

Query: 291 LGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNG 337
           +G  +GG L  +  WR  F + +    I G    AF++L  V++ +G
Sbjct: 257 VGPFLGGALTTHVTWRWCFYINLP---IGGL---AFVVLAMVYNPSG 297

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 71/144 (49%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
            I+ TL D I  +F     I W+   Y LS  +F  L+G+L++I G K  L+ S ++F +
Sbjct: 26  VIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEI 85

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           G L+   + ++  L++GR VA      + S+  ++ + IV    R        I YV+  
Sbjct: 86  GSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVIAE 145

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQV 313
            +G  +GG   E+  WR  F + +
Sbjct: 146 GVGPFIGGAFNEHLSWRWCFYINL 169

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 73/143 (51%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ST+++ +A +F A     WI A Y L   +   L+G+++ I G K+ +L + ++F +G
Sbjct: 97  IVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIG 156

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+ G A ++  L+ GR +A      + S+  +I S++V  R R       +  + +   
Sbjct: 157 SLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLVDERRRGLIIACMSSAFAVASV 216

Query: 291 LGGSMGGWLAEYGGWRLVFLLQV 313
           +G  +GG    +  WR  F + +
Sbjct: 217 IGPFLGGAFTTHATWRWCFYINL 239

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 70/143 (48%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ TL D I  +F     I W+   Y L+  +F  L+G+L++I G    L+ S ++F +G
Sbjct: 27  IVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVG 86

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   + ++  L++GR +A      + S+  ++ + IV    R +        YV+   
Sbjct: 87  SLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVIAEG 146

Query: 291 LGGSMGGWLAEYGGWRLVFLLQV 313
           +G  +GG   E+  WR  F + +
Sbjct: 147 VGPFIGGAFNEHLSWRWCFYINL 169

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 69/144 (47%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
            I+ TL D I  +F     I W+   Y LS  +F  L+G+L++I G    L+ S ++F +
Sbjct: 26  VIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEI 85

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           G L+   + T+  L+ GR +A      + S+  ++ + IV    R        + YV+  
Sbjct: 86  GSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTSIVQENYRGIMITALAVSYVIAE 145

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQV 313
            +G  +GG   E+  WR  F + +
Sbjct: 146 GVGPFIGGAFNEHLSWRWCFYINL 169

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 70/143 (48%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ TL + I  +F+    I W+   Y L   +F  L+G+L+ I G K  L FS ++F +G
Sbjct: 26  IVITLYETIGEKFKDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIG 85

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   + ++  ++ GR VA      + S+  ++ + +V  R+R     +  + + +   
Sbjct: 86  SLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFA 145

Query: 291 LGGSMGGWLAEYGGWRLVFLLQV 313
           +G  +GG   E   WR  F + +
Sbjct: 146 VGPVIGGAFTENVSWRWCFYINL 168

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 68/140 (48%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
            I  TL D I  EF     + W+ A Y L   +F  L+G+++ + G K  L+ S ++F  
Sbjct: 25  VICITLYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEA 84

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           G L+ G A ++  L+  R ++      + S+   + + IV  + RA    +  I Y+L  
Sbjct: 85  GSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGTSIVEEKHRARVITVLGIAYMLAE 144

Query: 290 TLGGSMGGWLAEYGGWRLVF 309
             G  +GG LAE+  WR  F
Sbjct: 145 GAGPFVGGGLAEHVSWRWCF 164

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 85/200 (42%), Gaps = 5/200 (2%)

Query: 138 GNIGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLLDYIASEFEALPYISWIAASYL 197
           G++GD Q +S  +  A                 I+S  ++ I+ +F       WI + Y 
Sbjct: 27  GHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYS 86

Query: 198 LSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           L   +   L+G+ + IFG K  LL S L+F  G L+   + ++  L+ GR VA      +
Sbjct: 87  LPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGI 146

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            S+  +I S +   RSR     + +  Y +    G  MGG    +  WR  F +     L
Sbjct: 147 QSLCFVIASTLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTHVTWRWCFYIN----L 202

Query: 318 ISGCFIQAFLILP-KVHHGN 336
             G    A L+L  K H GN
Sbjct: 203 PIGSLAFAVLVLTYKPHEGN 222

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 75/343 (21%), Positives = 136/343 (39%), Gaps = 33/343 (9%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ T++D + + F       WI   Y L   +F  L+G+LS + G +  ++   ++F  G
Sbjct: 63  IVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVISCIILFETG 122

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   A ++  L++GR +A      L ++  +I   +V  +SR     L N  + +   
Sbjct: 123 SLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNEKSRPLVLSLLNCTFAVASI 182

Query: 291 LGGSMGGWLAEYGGWRLVFLLQV-VAALISGCFI---------------QAFLILPKVHH 334
           +G  +GG    +  WR  F + + +  L    FI               Q F  L     
Sbjct: 183 VGPFLGGAFTTHVTWRWCFYINLPIGGLAIAIFIFFYNPEGADLLEKGSQTFKKLLSYRR 242

Query: 335 GNGIALANKESLKTKLYMMDWLGTFCL-----VIFLASLTL-------TCSLVDXXXXXX 382
            N   L+ K+ L   L+  D + +F L     ++FL +LT           +V       
Sbjct: 243 AN---LSLKQLLDQLLFGFD-IVSFVLFTAGWLLFLLALTFGGQTHPWKSGIVISFIIVG 298

Query: 383 XXXXXXMFVSGYYFVYHELNIAA-DPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVP 441
                   +  +    H   +    P+LS HL++ R +L ++   FF  +   + + Y  
Sbjct: 299 VLLIALSLIYDFRLFDHIKTMDTFRPLLSWHLMSQRAILNANFTGFFSTIAYNVQMIYSV 358

Query: 442 MYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGKYR 484
            +F  V      + G   I   + T + S  +G  IK+ G  +
Sbjct: 359 QFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGVIIKKTGHIK 401

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 67/142 (47%), Gaps = 4/142 (2%)

Query: 191 WIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVA 250
           +I A+  L A I     G  +DIFGRK  +L SNLMF +G ++  TA T W ++ GRF+ 
Sbjct: 163 FITAATSLGALISSIFAGISADIFGRKPCILLSNLMFLIGAIIQVTAHTFWQMVVGRFIM 222

Query: 251 XXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEY-GGWRLVF 309
                  + +  + IS+I P   R     + ++    G  +    G  L+    GWR++ 
Sbjct: 223 GFGVGIGSLIAPLYISEIAPKNIRGRLTVINSLWLTGGQLIAYGCGAGLSHVNNGWRILV 282

Query: 310 LLQVVAALISGCFIQAFLILPK 331
            L ++  +I       FL LP 
Sbjct: 283 GLSLIPTVIQ---FSCFLFLPD 301

>TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.84
           YDR497C
          Length = 634

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 75/165 (45%), Gaps = 8/165 (4%)

Query: 172 LSTLLDYIASEFEALPYI----SWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMF 227
           +S+ L  I ++ +  P       +I A+  L A I     G  +D+FGRK  L+FSNLMF
Sbjct: 154 ISSALISIGNDLDNRPLTYGDKEFITAATSLGALISSIFAGTAADVFGRKPCLMFSNLMF 213

Query: 228 GLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVL 287
            +G +V  TA   W + AGR V        + +  + I +I P + R     + ++    
Sbjct: 214 VVGAIVQITAHKFWQMTAGRLVMGFGVGIGSLIAPLYIGEIAPRKIRGRLTVINSLWLTG 273

Query: 288 GITLGGSMGGWLAEY-GGWRLVFLLQVVAALISGCFIQAFLILPK 331
           G  +    G  L +   GWR++  L ++  ++       FL LP 
Sbjct: 274 GQLIAYGCGAGLTKVNNGWRILVGLSLIPTVVQ---FTCFLFLPD 315

>TBLA0B08310 Chr2 complement(1985796..1987712) [1917 bp, 638 aa]
           {ON} Anc_3.84 YDR497C
          Length = 638

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 68/142 (47%), Gaps = 4/142 (2%)

Query: 190 SWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFV 249
            +I A+  L A I     G  +D+FGRK  L+FSN+MF +G ++  ++ T W + AGR +
Sbjct: 180 EYITAATSLGALITSIGAGTAADVFGRKPCLMFSNVMFVVGAILQISSHTFWQMCAGRLI 239

Query: 250 AXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLG-GSMGGWLAEYGGWRLV 308
                   + +  + IS+I P   R     + ++C   G  +  G   G+     GWR++
Sbjct: 240 MGFGVGIGSLISPLFISEIAPKMIRGRLTVINSLCLTGGQLIAYGCGAGFNYVNNGWRIL 299

Query: 309 FLLQVVAALISGCFIQAFLILP 330
             L ++  +I       FL LP
Sbjct: 300 VGLSLIPTVIQ---FTCFLFLP 318

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 69/143 (48%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ T+++ +A++F       W+   Y L   +   L+G+   + G K  +L S ++F +G
Sbjct: 94  IVGTIMETVAAKFNGYSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVG 153

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   A ++  L+ GR ++      + ++  +I S +V  R+R +   + +  + +   
Sbjct: 154 SLIAAAATSMTMLIGGRVISGIGGSGIQTLCFVITSTLVTDRTRGTAISILSCAFAVASV 213

Query: 291 LGGSMGGWLAEYGGWRLVFLLQV 313
            G  +GG  A +  WR  F + +
Sbjct: 214 AGPFLGGAFATHVTWRWCFYINL 236

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 81/167 (48%), Gaps = 6/167 (3%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ST+++ ++ +F       W+   Y L   +   ++G+ + I G K+ +L S ++F +G
Sbjct: 62  IVSTIIETVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVG 121

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            LV   A ++  L+ GR ++      L ++  +IIS +V  RSR     + +  + +   
Sbjct: 122 SLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIISTLVNERSRGMAISVLSCSFAVASI 181

Query: 291 LGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNG 337
           +G  +GG    +  WR  F + +    I G    AFL+    ++ NG
Sbjct: 182 VGPFLGGAFTTHVTWRWCFYINLP---IGGL---AFLVFVLSYNPNG 222

>CAGL0I07447g Chr9 (716374..718086) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103w ITR2 myo-inositol permease minor
          Length = 570

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 194 ASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXX 253
           A+  L A IF  + G   DIFGRK  L+FSN+MF +G ++  TA   W + AGRF+    
Sbjct: 120 AATSLGALIFALVAGFSVDIFGRKPCLMFSNIMFLIGAILQVTAHKFWQMTAGRFIMGFG 179

Query: 254 XXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE-YGGWRLVFLLQ 312
               + +  + IS+I P   R     + ++    G  +    G  L   + GWR++  L 
Sbjct: 180 VGIGSLIAPLYISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVHNGWRILVGLS 239

Query: 313 VVAALISGCFIQAFLILP 330
           ++  ++   F   F+ LP
Sbjct: 240 LIPTVLQFVF---FIFLP 254

>SAKL0C09350g Chr3 complement(849691..851427) [1737 bp, 578 aa] {ON}
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1
          Length = 578

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 68/140 (48%), Gaps = 4/140 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I     G  +D+FGRK  ++FSNL+F +G ++  +A T W +  GR V  
Sbjct: 113 ITAATSLGALITAVFAGVSADLFGRKPCIMFSNLLFVIGAILQVSAHTFWQMAIGRLVMG 172

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE-YGGWRLVFL 310
                 + +  + IS+I P   R     + ++C   G  +  + G  L + + GWR++  
Sbjct: 173 FGVGIGSLISPLFISEIAPKMIRGRLTVVNSLCLTGGQLIAYACGAGLDKVHNGWRILVG 232

Query: 311 LQVVAALISGCFIQAFLILP 330
           L ++  +I       F+ LP
Sbjct: 233 LSLIPTVIQ---FTMFMFLP 249

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 82/199 (41%), Gaps = 3/199 (1%)

Query: 138 GNIGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLLDYIASEFEALPYISWIAASYL 197
           G++GD Q +S  +  A                 I+S  ++ I+ +F       WI + Y 
Sbjct: 27  GHVGDPQPLSGFKLYANMGSLTLVLFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYS 86

Query: 198 LSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           L   +   L+G+ + IFG K  LL S L+F  G L+   + ++  L+ GR VA      +
Sbjct: 87  LPEALLTLLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGI 146

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            S+  +I S +   RSR     + +  Y +       MG     +  WR  F + +    
Sbjct: 147 QSLCFVIASTLTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTHVTWRWCFYINLP--- 203

Query: 318 ISGCFIQAFLILPKVHHGN 336
           I G      ++  K H GN
Sbjct: 204 IGGLAFAVLVLTYKPHEGN 222

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/344 (22%), Positives = 134/344 (38%), Gaps = 35/344 (10%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ T++D +   F       WI   Y L   +F  L+ +LS + G +  ++   ++F  G
Sbjct: 63  IVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARLSAVLGPRISVVSCIILFEAG 122

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   A ++  L+AGR VA      L ++  +I   +V  +SR     L N  + +   
Sbjct: 123 SLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQLVDEKSRPLVLSLLNCTFAVASI 182

Query: 291 LGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLI----------------LPKVHH 334
           +G  +GG    +  WR  F + +    I G  I  F+                   KV  
Sbjct: 183 VGPFLGGAFTTHVTWRWCFYINLP---IGGLAIAIFVFFYNPEGVNLLEKFGNTFKKVSS 239

Query: 335 GNGIALANKESLKTKLYMMDWLG----TFCLVIFLASLTL-------TCSLVDXXXXXXX 383
            + +  + K+ L+  L+  D L     T   ++FL +LT           +V        
Sbjct: 240 FHPVKKSPKKVLQQLLFGFDILSFISFTAGWLLFLLALTFGGQTHAWNSGIVISFIIIGV 299

Query: 384 XXXXXMFVSGYYFVYHELNIAAD---PILSVHLLTDRNVLASSLANFFCMLNDVLTIFYV 440
                  V  Y F   E     D   P+LS  ++++R++L S+   FF  +   + + Y 
Sbjct: 300 LLIAISLV--YDFKVFEQIKTQDSFRPLLSWEIMSNRSILLSNFTGFFSTVAYNVQMIYS 357

Query: 441 PMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGKYR 484
             +F  V      + G   I   + T + S  +G   K+ G  +
Sbjct: 358 VQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGILTKKTGHIK 401

>KNAG0K00630 Chr11 (113522..115378) [1857 bp, 618 aa] {ON} Anc_3.84
           YDR497C
          Length = 618

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 69/149 (46%), Gaps = 22/149 (14%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           + A+  L A I   + G  +D++GRK  ++FSN+MF +G ++  +A   W + AGR +  
Sbjct: 165 VTAATSLGALISSTMAGTAADMYGRKPCIMFSNIMFLVGAILQVSAHKFWQMAAGRLIMG 224

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG-------- 303
                 + +  + IS+I P   R        +   L +T     GG L  YG        
Sbjct: 225 FGVGIGSLISPLFISEIAPKMIRGR----LTVINSLWLT-----GGQLIAYGLGAAFNHV 275

Query: 304 --GWRLVFLLQVVAALISGCFIQAFLILP 330
             GWR++  L +V  ++  CF   FL LP
Sbjct: 276 NNGWRILVGLSLVPTVLQFCF---FLFLP 301

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 81/170 (47%), Gaps = 12/170 (7%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ST+++ +A EF       WI A Y L + +   ++G+++ + G K+ +L + ++F +G
Sbjct: 74  IVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVG 133

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSR----ASYQDLFNICYV 286
            LV   A ++  L+ GR +A      + ++  +IIS +V    R    A     F I  V
Sbjct: 134 SLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEESKRGLLIACMGSAFGIASV 193

Query: 287 LGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGN 336
           +G  LGG+       +  WR  F +     L  G    AF IL    HG+
Sbjct: 194 VGPFLGGA----FTTHVTWRWCFWIN----LPIGGLAFAFFILFYNPHGS 235

>NCAS0C04760 Chr3 (969811..971634) [1824 bp, 607 aa] {ON} Anc_3.84
          Length = 607

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 65/140 (46%), Gaps = 4/140 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I   + G  +DIFGR+  L+FSN+MF +G ++  TA   W +  GR +  
Sbjct: 155 ITAATSLGALITSTMAGTAADIFGRRPCLMFSNVMFVIGAILQITAHKFWQMAVGRLIMG 214

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEY-GGWRLVFL 310
                 + +  + IS+I P   R     + ++    G  +    G  L     GWR++  
Sbjct: 215 FGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNGWRILVG 274

Query: 311 LQVVAALISGCFIQAFLILP 330
           L ++  ++   F   FL LP
Sbjct: 275 LSLIPTVLQFSF---FLFLP 291

>NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {ON}
           Anc_3.84
          Length = 587

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 66/140 (47%), Gaps = 4/140 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I     G  +DIFGRK  L+FSN++F +G ++  TA   W + AGR +  
Sbjct: 132 ITAATSLGALISSIFAGTAADIFGRKPCLMFSNVLFVIGAILQITAHRFWQMNAGRLIMG 191

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE-YGGWRLVFL 310
                 + +  + IS+I P   R     + ++    G  +    G  L   + GWR++  
Sbjct: 192 FGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVHNGWRILVG 251

Query: 311 LQVVAALISGCFIQAFLILP 330
           L ++  ++   F   FL LP
Sbjct: 252 LSLIPTVLQFSF---FLFLP 268

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 71/143 (49%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ST+++ +A +F +   I W+   Y L   +   ++G+++   G K  +LF+ ++F +G
Sbjct: 95  IVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVG 154

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   A ++  L+ GR +A      + S+  +I S++V   +R     + +  + +   
Sbjct: 155 SLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAIASV 214

Query: 291 LGGSMGGWLAEYGGWRLVFLLQV 313
           +G  +GG       WR  F + +
Sbjct: 215 VGPFLGGVFTSRVTWRWCFYINL 237

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 73/166 (43%), Gaps = 3/166 (1%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ T++D +   F       WI   Y L   +F  L+G++S   G +  ++   ++F  G
Sbjct: 62  IVGTIIDTVCKSFGDYTKSGWIVTGYSLPNALFSLLWGRISANLGPRISIVACIVLFEAG 121

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   A ++  L+AGR V+      L ++  +I   +V  +SR     L N  + +   
Sbjct: 122 SLISALARSMNMLIAGRVVSGVGGSGLQTLSLVIGCQLVDEKSRPLVLSLLNCTFAIASI 181

Query: 291 LGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGN 336
           +G  +GG    +  WR  F + +    I G  I  FL     H+ N
Sbjct: 182 IGPFIGGAFTTHVTWRWCFYINLP---IGGVAILTFLCFYNPHNEN 224

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 81/178 (45%), Gaps = 4/178 (2%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ T++D +A +F       W+   Y L   I   ++G+ + I G +  L+ + L+F  G
Sbjct: 56  IVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAG 115

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   A ++  L+ GR VA      L ++  +I   +V  RSR     + +  + +   
Sbjct: 116 SLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAI 175

Query: 291 LGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKT 348
           +G  +GG    +  WR  F + +    I G  I  FL+  K  +  GI    K+++ T
Sbjct: 176 VGPIIGGAFTTHVTWRWCFYINLP---IGGLAIIMFLLTYKAEN-KGILQQIKDAIGT 229

>TDEL0D05400 Chr4 complement(978323..980080) [1758 bp, 585 aa] {ON}
           Anc_3.84 YDR497C
          Length = 585

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 71/143 (49%), Gaps = 10/143 (6%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I   + G  +D++GRKA ++FSN+MF +G ++  TA + W +  GR +  
Sbjct: 133 ITAATSLGALITSLMAGTAADLYGRKACIMFSNVMFLVGAILQATAFSFWQMAVGRLIMG 192

Query: 252 XXXXXLTSMPSIIISDIVP--LRSRASYQDLFNICYVLGITL--GGSMGGWLAEYGGWRL 307
                 + +  + IS+I P  +R R +   + N  ++ G  L   G   G +  + GWR+
Sbjct: 193 FGVGIGSLISPLFISEIAPKMIRGRLT---VINSLWLTGGQLIAYGCGAGLVHVHNGWRI 249

Query: 308 VFLLQVVAALISGCFIQAFLILP 330
           +  L +V  ++       F  LP
Sbjct: 250 LVGLSLVPTVVQ---FTCFFFLP 269

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 1/128 (0%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I     G L+DIFGRK + + SN+MF +G ++     + W + AGR +  
Sbjct: 123 ITAATSLGALITSLFAGTLADIFGRKPVTMSSNVMFLIGAILQACTRSFWQMAAGRLLMG 182

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEY-GGWRLVFL 310
                 + +  + IS+I P   R     + + C   G  +   +G   ++   GWR++  
Sbjct: 183 FGIGIGSLLSPLFISEIAPSEYRGRLTVVNSACITGGQLIAYGIGAGTSKIDNGWRILVA 242

Query: 311 LQVVAALI 318
           + VV ++I
Sbjct: 243 ISVVPSMI 250

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 65/140 (46%)

Query: 174 TLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLV 233
           TL D I   F     + W+   Y L   +   L+G+++ + G K  L+ S ++F  G L+
Sbjct: 29  TLYDTIGKVFNDYANVGWLMTGYNLPNALCMLLWGRIASLVGLKNSLVASIVIFEAGSLL 88

Query: 234 CGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGG 293
              A ++  L+ GR +A      + ++   + + +V  + RA    +  I Y+L    G 
Sbjct: 89  AALATSMGMLIGGRVIAGFGGSGIETLVFAVGTRMVDEKHRARVVTILGIAYMLAEGAGP 148

Query: 294 SMGGWLAEYGGWRLVFLLQV 313
            +GG  AE+  WR  F + +
Sbjct: 149 FIGGAFAEHVSWRWCFFINI 168

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 96/229 (41%), Gaps = 15/229 (6%)

Query: 120 PDSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAA-----IXXXXXXXXXXXXXXXTILST 174
           PD  +   + + +S  EVGN  D +     RF+      +               +I   
Sbjct: 28  PDHGETSGLAVSNSQSEVGNESDFELEPYSRFSHTQKMLLVVQCAFTGFFSTVAGSIYYP 87

Query: 175 LLDYIASEF---EALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGC 231
           +L  I  +F   E L  ++ +   Y +   +   + G L+D FGR+ ++L++ L +   C
Sbjct: 88  VLTVIEKKFNITEELANVTIVV--YFVFQGLAPSIMGGLADTFGRRPVVLWAVLTYCCAC 145

Query: 232 LVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITL 291
           +   ++     +LA R +       + ++ S I+ D+     R  Y  L +   V+G   
Sbjct: 146 IGLASSHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVERGGYVGLVSGFQVVGTAF 205

Query: 292 GGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHH---GNG 337
           G  +G  L+   GWR +F    + + I  C + + L+LP+      GNG
Sbjct: 206 GALIGAGLSSRWGWRAIFWFLAIGSGI--CLVVSALLLPETKRTLVGNG 252

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 71/144 (49%), Gaps = 1/144 (0%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIF-GRKAILLFSNLMFGL 229
           I++T+++ + + F+A     WI A Y L   +   L+G+++  F G K  +L + ++F +
Sbjct: 77  IVTTIINDVGAHFDAYAKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEI 136

Query: 230 GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGI 289
           G L+C  A ++  L+ GR +A      + S+  +I S +V  R R       +  + +  
Sbjct: 137 GSLICALANSMDMLIGGRVIAGIGGSGIQSLSFVIGSTLVSPRGRGFIIAFMSASFGIAS 196

Query: 290 TLGGSMGGWLAEYGGWRLVFLLQV 313
            +G  +GG    +  WR  F + +
Sbjct: 197 VIGPFIGGAFTSHVTWRWCFWINL 220

>NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa]
           {ON} Anc_3.84
          Length = 602

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 4/140 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           + A+  L A I     G  +D+FGRK  L+FSN+MF +G ++  +A   W + AGR +  
Sbjct: 143 VTAATSLGALISSIFAGTAADVFGRKPCLMFSNVMFIIGAILQISAHKFWQMAAGRLIMG 202

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE-YGGWRLVFL 310
                 + +  + IS+I P   R     + ++    G  +    G  L + + GWR++  
Sbjct: 203 FGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNKVHNGWRILVG 262

Query: 311 LQVVAALISGCFIQAFLILP 330
           L ++  +I   F   F  LP
Sbjct: 263 LSLIPTVIQFTF---FCFLP 279

>Suva_15.62 Chr15 (97049..98878) [1830 bp, 609 aa] {ON} YOL103W
           (REAL)
          Length = 609

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 64/140 (45%), Gaps = 4/140 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I     G  +D+FGR+  L+FSNLMF +G ++  TA   W + AGR V  
Sbjct: 154 ITAATSLGALITSIGAGTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLVMG 213

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEY-GGWRLVFL 310
                 + +  + IS+I P   R     + ++    G  +    G  L     GWR++  
Sbjct: 214 FGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNGWRILVG 273

Query: 311 LQVVAALISGCFIQAFLILP 330
           L +V  +I   F   F  LP
Sbjct: 274 LSLVPTVIQFTF---FCFLP 290

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 69/143 (48%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ST+++ +A +  +   I W+   Y L   +   ++G+++   G KA +LF+ ++F +G
Sbjct: 80  IVSTIIEEVAKQLGSYSEIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIG 139

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   A ++  L+ GR +A      + S+  +I S +V    R     + +  + +   
Sbjct: 140 SLISALASSMNMLIGGRVIAGIGGCGIQSLSFVIGSTLVEESKRGMLIAILSSSFAIASV 199

Query: 291 LGGSMGGWLAEYGGWRLVFLLQV 313
           +G  +GG       WR  F + +
Sbjct: 200 VGPFLGGVFTSSVTWRWCFYINL 222

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 69/143 (48%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ST+++ +A +F +   I W+   Y L   +   ++G+++   G K  +LF+ ++F +G
Sbjct: 86  IVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIG 145

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            L+   A ++  L+ GR +A      + S+  +I S +V    R     + +  + +   
Sbjct: 146 SLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAIASV 205

Query: 291 LGGSMGGWLAEYGGWRLVFLLQV 313
           +G  +GG       WR  F + +
Sbjct: 206 VGPFLGGVFTSSVTWRWCFYVNL 228

>ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 538

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 64/137 (46%), Gaps = 6/137 (4%)

Query: 202 IFQPL----YGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           +FQ L     G ++D  GR+ ++L S L++ + CL   +  T   L+  R +       +
Sbjct: 99  VFQGLSPSFMGNMADTLGRRPVILVSVLIYFVACLGIASCNTYSQLIGLRCLQAAGISPV 158

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            ++ S +++DI     R  Y    + C VLG   G  +G  L+   GWR VF    + + 
Sbjct: 159 IAINSGMMTDITTRAERGGYVGYTSGCQVLGSAFGALIGAGLSSRWGWRSVFWFLSIGSG 218

Query: 318 ISGCFIQAFLILPKVHH 334
           I  C + + L+LP+   
Sbjct: 219 I--CLVISTLLLPETKR 233

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 117/292 (40%), Gaps = 29/292 (9%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q +Y +LSD++GR A+   S +++ +G ++   A  V    AG          +  +  +
Sbjct: 144 QIVYARLSDVYGRFALFCVSIVLYSVGTIIQSQAYDVQRYAAGSIFYNTGYVGVILVLLL 203

Query: 264 IISDIVPLRSRASYQDLFNICYVLGITLGGS-------MGGWLAEYGGWRLVFLLQVVAA 316
           I+SD   LR R  YQ +    +++   + G+       +  W  + G W  +F L  V  
Sbjct: 204 ILSDFSSLRWRLVYQFVPTWPFIINTWISGNVTSRANPLKNWSWDIGMWAFIFPLSCVPL 263

Query: 317 LISGCFIQAFLILPKVHHGNGIA----LANKESLKTKLYMMDW----LGTFCLVIFLASL 368
           L     I  + +  K      ++       K  LK  +  + W    +G F + I L  +
Sbjct: 264 LC--VMIHMWWLARKTEEWQELSKEKTFYQKHGLKDTIVELFWKIDAMGVFIMTISLGCI 321

Query: 369 TLTCSLV-DXXXXXXXXXXXXMFVSGYY----FVYHELNIAADPILSVHLLTDRNVLASS 423
            +  +L                FV G+      V  E   A DPI+   L+ DR V AS 
Sbjct: 322 LVPLTLAGGTKSKWNNSHVIGPFVLGFVLIPILVLWEYKFARDPIIPYKLVKDRGVWASF 381

Query: 424 LANFFCMLNDVLTIFYVPM-YFASVLYMGPKE-IGKRTIISFLGTSIGSFGT 473
             +F         I+Y+   Y  +VL +G  E +   T IS L T + + G+
Sbjct: 382 AISFLIDF-----IYYMAADYLYTVLIVGVNESVKSATRISSLSTFVSTVGS 428

>YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}
           ITR2Myo-inositol transporter with strong similarity to
           the major myo-inositol transporter Itr1p, member of the
           sugar transporter superfamily; expressed constitutively
          Length = 609

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 4/140 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I     G  +D+FGR+  L+FSNLMF +G ++  TA   W + AGR +  
Sbjct: 154 ITAATSLGALITSVGAGTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAGRLIMG 213

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEY-GGWRLVFL 310
                 + +  + IS+I P   R     + ++    G  +    G  L     GWR++  
Sbjct: 214 FGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNGWRILVG 273

Query: 311 LQVVAALISGCFIQAFLILP 330
           L ++  ++   F   F  LP
Sbjct: 274 LSLIPTVLQFSF---FCFLP 290

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 65/143 (45%), Gaps = 9/143 (6%)

Query: 202 IFQ----PLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           IFQ     + G L+D FGR+ I+L++ L +   C+    A     +LA R +       +
Sbjct: 116 IFQGVAPSIMGGLADTFGRRPIVLWAILAYFCACIGLACAHNYAQILALRCLQAAGISPV 175

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            ++ S I+ D+     R  Y  L     V+G   G  +G  L+   GWR +F    + + 
Sbjct: 176 IAINSGIMGDVTTKVERGGYVGLVAGFQVVGTAFGALIGAGLSSKWGWRAIFWFLAIGSG 235

Query: 318 ISGCFIQAFLILPKVHH---GNG 337
           I  C + + L++P+      GNG
Sbjct: 236 I--CLVFSTLLMPETKRTLVGNG 256

>Smik_15.54 Chr15 (87058..88893) [1836 bp, 611 aa] {ON} YOL103W
           (REAL)
          Length = 611

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 4/140 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I     G  +D+FGR+  L+FSNLMF +G ++  TA   W + AGR +  
Sbjct: 156 ITAATSLGALITSVGAGTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLIMG 215

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEY-GGWRLVFL 310
                 + +  + IS+I P   R     + ++    G  +    G  L     GWR++  
Sbjct: 216 FGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVNNGWRILVG 275

Query: 311 LQVVAALISGCFIQAFLILP 330
           L ++  ++   F   F  LP
Sbjct: 276 LSLIPTVLQFSF---FCFLP 292

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 81/195 (41%), Gaps = 15/195 (7%)

Query: 119 TPDSNKNGNVFIRSSSVEVGNIGDSQNISQIRFAAIXXXXXXXXXXXXXXXTILSTLLDY 178
           TPD N N NV +               +S +R                    I++T++D 
Sbjct: 40  TPDHNDNSNVRL---------------MSGLRLYVCVAALVLATFIFALDVFIVNTIIDS 84

Query: 179 IASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAP 238
           +++         W+ A Y L   +F  ++G+ + + G +A +  S  +F +G +V  +A 
Sbjct: 85  VSASLGGYSKSGWLIAGYSLPNSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSASAT 144

Query: 239 TVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGW 298
           ++  L+ GR +A      L ++  +I S IV  ++RA    +    +     +G  +GG 
Sbjct: 145 SMDNLIVGRVIAGVGGSGLQTLSLVIGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGA 204

Query: 299 LAEYGGWRLVFLLQV 313
              +  WR  F + +
Sbjct: 205 FTTHVIWRWCFWINL 219

>Kpol_2002.86 s2002 (201096..203006) [1911 bp, 636 aa] {ON}
           (201096..203006) [1911 nt, 637 aa]
          Length = 636

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 62/130 (47%), Gaps = 4/130 (3%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           ++  LS+ FGR AI   + L+  +  + C     +  LLA RF+          +    +
Sbjct: 209 IFAPLSEEFGRNAIYHTTLLVAVIFIIPCAVPRNIGTLLAFRFLDGLAFSAPMCLIGGSL 268

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGC-FIQ 324
           SDI  ++ R     +F+    LG  +G  +G  L+   GWR V++  ++    SGC +  
Sbjct: 269 SDIWRVKERGVAMAIFSAAPFLGPVMGPIVGSLLSVKCGWRWVYIFMII---FSGCLYAV 325

Query: 325 AFLILPKVHH 334
           AF+ LP+ HH
Sbjct: 326 AFVFLPETHH 335

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 63/143 (44%), Gaps = 9/143 (6%)

Query: 202 IFQ----PLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           IFQ     L G L+D  GR+ I++ S L++   C+    + +   ++A R +       +
Sbjct: 117 IFQGISPTLMGGLADYLGRRPIVILSVLVYFSACVGLACSQSYAQIIALRCLQAAGISPV 176

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            ++ S I+ D+     R  Y    + C V+G   G  +G  L+   GWR +F    + + 
Sbjct: 177 IAINSGIMGDVTTRAERGGYVGYVSGCQVVGSAFGALIGAGLSSRWGWRSIFWFLAIGS- 235

Query: 318 ISGCFIQAFLILPKVHH---GNG 337
              C +   L LP+      GNG
Sbjct: 236 -GACLVATVLFLPETKRTVVGNG 257

>Skud_15.51 Chr15 (83321..84391,84482..85174) [1764 bp, 587 aa] {ON}
           YOL103W (REAL)
          Length = 587

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 4/140 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I     G  +D+FGR+  L+FSNLMF +G ++  TA   W + AGR +  
Sbjct: 162 ITAATSLGALITSIGAGTAADVFGRRPCLMFSNLMFLIGAILQITAHRFWQMAAGRLIMG 221

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEY-GGWRLVFL 310
                 + +  + IS+I P   R     + ++    G  +    G  L     GWR++  
Sbjct: 222 FGVGIGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNGWRILVG 281

Query: 311 LQVVAALISGCFIQAFLILP 330
           L ++  ++   F   F  LP
Sbjct: 282 LSLIPTVLQFSF---FCFLP 298

>TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4.30
           YLL028W
          Length = 615

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 65/144 (45%), Gaps = 4/144 (2%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           LY  LS+++GR+ +L+ S L F +      TA  +  ++  RF          ++   + 
Sbjct: 230 LYAPLSELYGRRGVLVLSGLGFAIFQFAVATAENLQTIMICRFFGGLIGAAPMAVVPAVF 289

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           +D+     R     LF+    +G  LG  +G ++ ++  WR  +L  V+  L +  F+  
Sbjct: 290 ADMFDTNFRGKAICLFSAFVFIGPILGPIIGSYIVQHTTWR--WLNYVIGCLAAAVFVAI 347

Query: 326 FLILPKVHHGNGIALANKESLKTK 349
             ++ + HH +   L NK  +  K
Sbjct: 348 LFLVEETHHAS--ILVNKAKMMRK 369

>TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 62/144 (43%), Gaps = 4/144 (2%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           +Y  LS+++GRK +L+ S L F L      TA     ++  RF A        ++   + 
Sbjct: 248 IYAPLSELYGRKGVLVVSGLGFALFQFAVATAENFQTIMICRFFAGFIGAAPMAIVPAVF 307

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           +D+     R     LF +   +G  LG  MG ++ ++  WR  +L  VV       F+  
Sbjct: 308 ADMFDTDFRGKAICLFTLGVFVGPILGPVMGSYIVQHTTWR--WLNYVVGFQACAVFVAI 365

Query: 326 FLILPKVHHGNGIALANKESLKTK 349
            L + + HH     L NK  L  K
Sbjct: 366 VLFVEETHHPT--ILVNKAKLLRK 387

>Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138C
           (TPO2) -  [contig 96] FULL
          Length = 597

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 59/130 (45%), Gaps = 4/130 (3%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
            +  LS+ FGR  + L + L+  +  + CG A  +  LLA RF+          +    +
Sbjct: 176 FFAPLSEEFGRNPVYLITLLIAVVFIVPCGAAKNIGTLLAFRFLDGLAFSAPMCLIGGSL 235

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           SD+   + R     LF+    LG  +G  +G  L+ Y  WR V+   V+   +SGC    
Sbjct: 236 SDMWRNKERGVAMSLFSAAPFLGPVMGPIVGSLLSVYCSWRWVYWFMVI---LSGCLYAV 292

Query: 326 FLI-LPKVHH 334
             + +P+ HH
Sbjct: 293 MAVFMPETHH 302

>KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively
          Length = 569

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 2/133 (1%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I     G  +DIFGRK  L+FSN++F +G  +  +A + W +  GR +  
Sbjct: 106 ITAATSLGALISAVFAGISADIFGRKPCLMFSNILFVIGAALQVSAHSFWQMAVGRLIMG 165

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE-YGGWRLVFL 310
                 + +  + IS+I P   R     + ++    G  +  + G  L + + GWR++  
Sbjct: 166 FGVGIGSLLAPLFISEIAPKHIRGRLTVINSLWLTGGQLIAYACGAGLNKVHNGWRILVG 225

Query: 311 LQVVAALIS-GCF 322
           L ++  ++   CF
Sbjct: 226 LSLIPTVVQFTCF 238

>KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1 Myo-inositol transporter with strong
           similarity to the minor myo-inositol transporter Itr2p,
           member of the sugar transporter superfamily; expression
           is repressed by inositol and choline via Opi1p and
           derepressed via Ino2p and Ino4p
          Length = 608

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 61/128 (47%), Gaps = 1/128 (0%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I     G  +DI+GRK  L+FSNL+F +G ++  +A + W +  GR +  
Sbjct: 145 ITAATSLGALISSIFAGTSADIWGRKPCLMFSNLLFTVGAVLQISARSFWQMAVGRLIMG 204

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE-YGGWRLVFL 310
                 + +  + I +I P   R     + ++C   G  +    G  L + + GWR++  
Sbjct: 205 FGVGIGSLISPLFIGEIAPKNIRGRLVVINSLCLTGGQLVAYGCGAGLDKVHNGWRILVG 264

Query: 311 LQVVAALI 318
           L ++   I
Sbjct: 265 LSLIPTCI 272

>TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 62/138 (44%), Gaps = 4/138 (2%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           LY  LS+I+GRK IL+ S   F L      TA  +  ++  RF +        ++   + 
Sbjct: 247 LYAPLSEIYGRKLILVISGFGFALFQFAVATAENLQTIMICRFFSGLIGGAPMAVVPAVF 306

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           +D+     R     LF+    +G  LG  MG ++ ++  WR  +L  VV  L S  F+  
Sbjct: 307 ADMFDTNFRGKAICLFSAFVFIGPILGPIMGSYIVQHTSWR--WLNYVVGCLASLVFVLL 364

Query: 326 FLILPKVHHGNGIALANK 343
            + + + HH     L NK
Sbjct: 365 CVFVKESHHAT--ILVNK 380

>Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 60/133 (45%), Gaps = 19/133 (14%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           + A+  L A I     G  +D+FGRK  L+ SNLMF +G ++  +A T W + AGR +  
Sbjct: 131 VTAATSLGALITSIFAGTAADVFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAAGRLIMG 190

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG-------- 303
                 + +  + IS+I P   R        +   L +T     GG L  YG        
Sbjct: 191 FGVGIGSLIAPLFISEIAPKMIRGR----LTVINSLWLT-----GGQLVAYGCGAGLNYV 241

Query: 304 --GWRLVFLLQVV 314
             GWR++  L ++
Sbjct: 242 NNGWRILVGLSLI 254

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 63/143 (44%), Gaps = 9/143 (6%)

Query: 202 IFQPL----YGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           IFQ L     G L+D  GR+ ++L S +++   C+          L+  R +       +
Sbjct: 146 IFQALSPTLMGGLADSLGRRPVVLSSIVLYFCACIGLARCTNYSQLIGLRCLQAAGISPV 205

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            ++ S I+ D+     R  Y  L +   VLG   G  +G  L+    WR +F   V+ + 
Sbjct: 206 IAVNSGIMGDVTTKAERGGYMGLVSGTQVLGTAFGALIGAGLSSRWSWRSIFWFLVIGSG 265

Query: 318 ISGCFIQAFLILPKVHH---GNG 337
           I  C I + ++LP+      GNG
Sbjct: 266 I--CLIVSIIVLPETKRTVAGNG 286

>YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin; may have a role in potassium uptake
          Length = 542

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 5/133 (3%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISD 267
           G  +D  GR+ ++L + +++   C+    A T   ++  R +       + ++ S I+ D
Sbjct: 118 GGFADSLGRRPVVLVAIVIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGD 177

Query: 268 IVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFL 327
           +     R  Y        VLG   G  +G  L+   GWR +F    + + I  CF+ +FL
Sbjct: 178 VTTRAERGGYVGYVAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLAIGSGI--CFLASFL 235

Query: 328 ILPKVHH---GNG 337
           ILP+      GNG
Sbjct: 236 ILPETKRNISGNG 248

>NCAS0B06480 Chr2 complement(1225523..1227286) [1764 bp, 587 aa]
           {ON} 
          Length = 587

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 65/143 (45%), Gaps = 9/143 (6%)

Query: 202 IFQPL----YGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           IFQ L     G L+D  GR+ ++LFS  ++   C+    A T   ++  R +       +
Sbjct: 141 IFQGLSPSIMGGLADSLGRRPVVLFSVAVYFCACVGLACAQTYPQIIVLRCLQAAGISPV 200

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            ++ S I+ D+     R  Y    +   VLG + G  +G  ++    WR +F    + + 
Sbjct: 201 IAINSGIMGDVTTRAERGGYVGYVSGFQVLGNSFGALIGAGISSTWSWRAIFWFLAIGSG 260

Query: 318 ISGCFIQAFLILPKVHH---GNG 337
           I  C + +F++LP+      GNG
Sbjct: 261 I--CLLASFIVLPETKRTIAGNG 281

>AER339C Chr5 complement(1259842..1261563) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR273C
           (TPO4)
          Length = 573

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 8/127 (6%)

Query: 210 LSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIIS 266
           LS++FGRK + L S   +L+F LG  +      V  +L  R  +        S+ S  I 
Sbjct: 131 LSEVFGRKPVYLISLPISLLFSLGVGLSNGRMAV--ILPMRLFSGIFASPALSVASGTIV 188

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAF 326
           DI  +   +    LF +   LG  +   MGG+ AE GGWR V  +++++    G  +   
Sbjct: 189 DIFDVDEVSVAMSLFCMAPFLGPVISPIMGGYAAENGGWRWVVWIRLISG---GVLMPML 245

Query: 327 LILPKVH 333
           +++P+ H
Sbjct: 246 IVMPETH 252

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 64/145 (44%), Gaps = 5/145 (3%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           Y +   I   L G L+D  GR+ ++LF+  ++   C+    A T   ++  R +      
Sbjct: 126 YFIFQGIAPTLMGGLADSLGRRPVVLFAVTVYFGACIGLACAQTYAQIVVLRCLQAAGIS 185

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
            + ++ S II D+     R  Y    +   VLG   G  +G  L+   GWR +F    + 
Sbjct: 186 PVIAINSGIIGDVTTRAERGGYVGYISGFQVLGSAFGALIGAGLSSRWGWRSIFWFLAIG 245

Query: 316 ALISGCFIQAFLILPKVHH---GNG 337
           + +  C + + ++LP+      GNG
Sbjct: 246 SGV--CLVFSIIMLPETKRTIVGNG 268

>Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W
           (REAL)
          Length = 565

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 63/144 (43%), Gaps = 6/144 (4%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISD 267
           G  +D  GR+ ++L + L++   C+    A T   ++  R +       + ++ S I+ D
Sbjct: 118 GGFADSLGRRPVVLVAILIYLGACVGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGD 177

Query: 268 IVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFL 327
           I     R  Y        VLG   G  +G  L+   GWR +F    + + +  CF+ + L
Sbjct: 178 ITTRAERGGYVGYVAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLAIGSGV--CFLGSLL 235

Query: 328 ILPKVHHGNGIALANKESLKTKLY 351
           +LP+        +A   S+  KLY
Sbjct: 236 VLPETKRN----IAGNGSITPKLY 255

>KNAG0G02830 Chr7 complement(625263..627296) [2034 bp, 677 aa] {ON}
           Anc_8.723 YOR273C
          Length = 677

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 65/146 (44%), Gaps = 11/146 (7%)

Query: 208 GKLSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSII 264
             LS++FGRK I + S   + +F +G  + G    V  +L  RF A        S+ S  
Sbjct: 147 APLSEVFGRKPIYVVSLPVSCLFIMGVGLSGGHMRV--ILPLRFFAGAFASPALSIASGT 204

Query: 265 ISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQ 324
           I DI  L   +     F +   +G  L   M G+ AEY  WR    +Q+ A   SG    
Sbjct: 205 IMDIFDLDEVSVAMTFFCLAPFMGPVLSPIMAGFAAEYRSWRYTQWIQLFA---SGMVFP 261

Query: 325 AFLILPKVHHGNGIALANKESLKTKL 350
             L++P+ H G    +  K ++K K+
Sbjct: 262 FILLMPETHKG---VILRKRAVKRKM 284

>Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W
           (REAL)
          Length = 591

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 64/143 (44%), Gaps = 9/143 (6%)

Query: 202 IFQPL----YGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           +FQ L     G  +D  GR+ ++L + +++   C+    A T   ++  R +       +
Sbjct: 132 VFQGLAPTFMGGFADSLGRRPVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISPV 191

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            ++ S I+ DI     R  Y        VLG   G  +G  L+   GWR +F    + + 
Sbjct: 192 IAINSGIMGDITTRAERGGYVGYAAGFQVLGSAFGALIGAGLSFRWGWRAIFWFLAIGSG 251

Query: 318 ISGCFIQAFLILPKVHH---GNG 337
           I  CF+ +FLILP+      GNG
Sbjct: 252 I--CFLASFLILPETKRNISGNG 272

>KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {ON}
           Anc_3.84 YDR497C
          Length = 577

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 65/132 (49%), Gaps = 7/132 (5%)

Query: 191 WIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVA 250
           +I A+  L A I     G  +D++GRK  L+FSN+MF +G ++  +A   W +  GR + 
Sbjct: 124 FITAATSLGALISSIFAGVAADMYGRKPCLMFSNVMFLIGAILQISASNFWQMTVGRLIM 183

Query: 251 XXXXXXLTSMPSIIISDIVP--LRSRASYQDLFNICYVLGITL--GGSMGGWLAEYGGWR 306
                  + +  + IS+I P  LR R +   + N  ++ G  L   G   G    + GWR
Sbjct: 184 GFGVGIGSLISPLFISEIAPKMLRGRLT---VINSLWLTGGQLIAYGCGAGLNHVHNGWR 240

Query: 307 LVFLLQVVAALI 318
           ++  L ++  ++
Sbjct: 241 VLVGLSLIPTVV 252

>ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON}
           similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force-dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 592

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 80/181 (44%), Gaps = 4/181 (2%)

Query: 170 TILSTLLDYIASEFEALPYISWIA-ASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFG 228
           +I ++ ++ I   +  +P ++ +  A Y+L       +Y  LS+++GR+ +L+ S+  F 
Sbjct: 170 SIFASGVEQICEIYHVIPVVAILGIALYVLGFAASPIIYAPLSELYGRRGVLVISSFGFA 229

Query: 229 LGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLG 288
           +      TA  +  ++  RF A        ++     +D+     R     LF +   +G
Sbjct: 230 IFHFAVATAKDLQTIMICRFFAGFIGAAPMAVVPAAFTDMFDTNFRGKVMALFALGVFVG 289

Query: 289 ITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKT 348
             +G  MG ++ ++  WR  +L  V A   S  F+   L   + HH   I ++    L+ 
Sbjct: 290 PIIGPVMGSYIVQHTTWR--WLEYVTACFSSLVFVGIILFYDETHHAT-ILVSKASELRK 346

Query: 349 K 349
           K
Sbjct: 347 K 347

>KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 563

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 65/146 (44%), Gaps = 7/146 (4%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           Y L   +   L G L+D FGR+ I+++S  ++   C+    + T   +L  R +      
Sbjct: 89  YFLFQGLAPTLMGGLADSFGRRPIVMWSIALYLAACIGIACSRTYAQILVLRCLQSAGIS 148

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
            + ++ S I+ D+     R  Y  L     VLG   G  +GG +    GWR +F    + 
Sbjct: 149 PVIAVNSGIMGDVTTRAQRGGYVGLTAGFQVLGSAFGALIGGGIVSTWGWRAIFWFLAIG 208

Query: 316 ALISGC-FIQAFLILPKVHH---GNG 337
              SGC  + + L+LP+      GNG
Sbjct: 209 ---SGCSLVCSSLLLPETKRSVVGNG 231

>Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W
           (REAL)
          Length = 542

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 64/143 (44%), Gaps = 9/143 (6%)

Query: 202 IFQPL----YGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           +FQ L     G  +D  GR+ ++L + +++   C+    A T   ++  R +       +
Sbjct: 108 VFQGLAPTFMGGFADSLGRRPVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISPV 167

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            ++ S I+ DI     R  Y        VLG   G  +G  L+   GWR +F    + + 
Sbjct: 168 IAINSGIMGDITTRAERGGYVGYAAGFQVLGSAFGALIGAGLSFRWGWRAIFWFLAIGSG 227

Query: 318 ISGCFIQAFLILPKVHH---GNG 337
           I  CF+ +FLILP+      GNG
Sbjct: 228 I--CFLASFLILPETKRNISGNG 248

>CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {ON}
           highly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028w TPO1
          Length = 577

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 78/179 (43%), Gaps = 3/179 (1%)

Query: 170 TILSTLLDYIASEFEALPYISWIAAS-YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFG 228
           +I +T +  I   +  +P ++ +  + Y+L       +Y  LS+I+GR+ +L+ S+  F 
Sbjct: 155 SIFATGIRQICEIYHVIPVVAILGITLYVLGFAASPVIYAPLSEIYGRRGVLVISSFGFA 214

Query: 229 LGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLG 288
           L      TA  +  ++  RF A        ++     +D+     R     LF++   +G
Sbjct: 215 LFNFAVATAKDLQTIMICRFFAGFIGAAPLAVVPAAFADMFDTNIRGKAICLFSLGVFVG 274

Query: 289 ITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLK 347
             L   +G ++ ++  WR  +L  V+A   S  F+       + HH + +    KE  K
Sbjct: 275 PILAPVIGSYITQHTTWR--WLEYVIACFASAIFVAILFFFEESHHPSILVGKAKELRK 331

>YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}
           ITR1Myo-inositol transporter with strong similarity to
           the minor myo-inositol transporter Itr2p, member of the
           sugar transporter superfamily; expression is repressed
           by inositol and choline via Opi1p and derepressed via
           Ino2p and Ino4p
          Length = 584

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 59/133 (44%), Gaps = 19/133 (14%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           + A+  L A I     G  +DIFGRK  L+ SNLMF +G ++  +A T W +  GR +  
Sbjct: 131 VTAATSLGALITSIFAGTAADIFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVGRLIMG 190

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG-------- 303
                 + +  + IS+I P   R        +   L +T     GG L  YG        
Sbjct: 191 FGVGIGSLIAPLFISEIAPKMIRGR----LTVINSLWLT-----GGQLVAYGCGAGLNYV 241

Query: 304 --GWRLVFLLQVV 314
             GWR++  L ++
Sbjct: 242 NNGWRILVGLSLI 254

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 68/157 (43%), Gaps = 6/157 (3%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           YLL   I   + G L+D FGR+ I+L   L++ +  +    AP+   ++  R +      
Sbjct: 145 YLLFQGISPTVSGGLADCFGRRPIILAGMLIYVIASIGLACAPSYGVIIFLRCIQSIGIS 204

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
              ++ S ++ D      R ++    +   +LG   G  +G  L     WR +F    + 
Sbjct: 205 PTIAISSGVVGDFTLKHERGTFVGATSGFVLLGQCFGSLIGAVLTARWDWRAIFWFLTIG 264

Query: 316 ALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYM 352
                CF+ AFLILP+        +A   S+K K ++
Sbjct: 265 C--GSCFLIAFLILPETKR----TIAGNLSIKPKRFI 295

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 2/139 (1%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           YLL   I   + G L+D+FGR+ ++L   L++ +  +    AP+   ++  R +      
Sbjct: 135 YLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASIGLACAPSYGVIVFLRIIQSIGIS 194

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
              ++ S ++ D      R ++    +   +LG   G  +G  LA    WR +F    + 
Sbjct: 195 PTIAISSGVVGDFTLKHERGTFVGATSGLVLLGQCFGSLIGAVLAAAWNWRAIFWFLTIG 254

Query: 316 ALISGCFIQAFLILPKVHH 334
              S  FI AFL+LP+   
Sbjct: 255 CGTS--FIIAFLLLPETKR 271

>Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W -
           Hypothetical ORF [contig 5] FULL
          Length = 529

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 61/135 (45%), Gaps = 5/135 (3%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           L G L+D FGR+ ++L+S  ++   C+    + T   +L  R +       + ++ S I+
Sbjct: 75  LMGGLADSFGRRPVVLWSVALYMAACIGIACSKTYAQILVLRCLQSAGISPVIAVNSGIM 134

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
            D+     R  Y  L     V+G   G  +GG +     WR VF    +A+  S   +  
Sbjct: 135 GDVTTREQRGGYVGLTAGFQVIGSAFGALIGGGIVSTWSWRAVFWFLAIASGFS--LVVT 192

Query: 326 FLILPKVHH---GNG 337
           F++LP+      GNG
Sbjct: 193 FIMLPETKRSIVGNG 207

>Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 59/133 (44%), Gaps = 19/133 (14%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           + A+  L A I     G  +D+FGRK  L+ SNLMF +G ++  +A T W +  GR +  
Sbjct: 131 VTAATSLGALITSIFAGTAADLFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVGRLIMG 190

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG-------- 303
                 + +  + IS+I P   R        +   L +T     GG L  YG        
Sbjct: 191 FGVGIGSLIAPLFISEIAPKMIRGR----LTVINSLWLT-----GGQLVAYGCGAGLNHV 241

Query: 304 --GWRLVFLLQVV 314
             GWR++  L +V
Sbjct: 242 NNGWRILVGLSLV 254

>TPHA0E03200 Chr5 complement(677352..679232) [1881 bp, 626 aa] {ON}
           Anc_5.180
          Length = 626

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 65/150 (43%), Gaps = 14/150 (9%)

Query: 189 ISWIAASYLLSACIFQPLYGKLSDIFGRKAIL---LFSNLMFGLGCLVCGTAPTVWWLLA 245
           +S +   + L   +F PL    S+  GR  I    LF  ++F + C V     T   LLA
Sbjct: 195 VSLMVWGFGLGPLVFAPL----SEELGRNWIYCTTLFVAVIFIIPCAVAQNIGT---LLA 247

Query: 246 GRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGW 305
            RF+          +    +SDI     R     +F+    LG  +G  +G  L  Y GW
Sbjct: 248 FRFLDGLAFSAPMCIIGGSLSDIWRTEERGIAMSIFSAAPFLGPVMGPIVGSLLTVYCGW 307

Query: 306 RLVFLLQVVAALISGCFIQA-FLILPKVHH 334
           R V++  ++   +SGC     F+ LP+ HH
Sbjct: 308 RWVYIFMII---LSGCLYAVLFVFLPETHH 334

>Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W
           (REAL)
          Length = 599

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 59/135 (43%), Gaps = 5/135 (3%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           L G  +D  GR+ ++L + +++   C+      T   ++  R +       + ++ S I+
Sbjct: 138 LMGGFADSLGRRPVVLIAIIIYFGACVGLACTQTYAQIIVLRCLQAAGISPVIAINSGIM 197

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
            DI     R  Y        VLG   G  +G  L+   GWR +F    + + I  CF+ +
Sbjct: 198 GDITTRAERGGYVGYAAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLTIGSGI--CFLAS 255

Query: 326 FLILPKVHH---GNG 337
            LILP+      GNG
Sbjct: 256 LLILPETKRNISGNG 270

>Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {ON}
           YDR497C (ITR1) - myo-inositol transporter [contig 184]
           FULL
          Length = 578

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 57/124 (45%), Gaps = 1/124 (0%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I     G  +DI+GRK  L+ SNL F +G ++  +A T W +  GR +  
Sbjct: 115 ITAATSLGALISAVAAGTCADIWGRKPCLMISNLFFVIGAVLQVSASTFWQMAVGRLIMG 174

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE-YGGWRLVFL 310
                 + +  + I +I P   R     + ++C   G  +    G  L   + GWR++  
Sbjct: 175 FGVGIGSLISPLFIGEIAPKMIRGRLVVINSLCLTGGQLIAYGCGAGLDHVHNGWRILVG 234

Query: 311 LQVV 314
           L ++
Sbjct: 235 LSLI 238

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 64/139 (46%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I++T++D ++          W+   Y L   +   ++G+ + + G ++ +L S  +F +G
Sbjct: 94  IVNTVIDVVSKNLGGYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQSSMLISIFIFEVG 153

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            +V  TA ++  L+ GR VA      L ++  II   +V  R+R     +    + +   
Sbjct: 154 SIVSATATSMNNLVVGRVVAGIGGSGLQTVSMIIGCSLVEERNRTIVIAVIMSAFAVSSL 213

Query: 291 LGGSMGGWLAEYGGWRLVF 309
           +G  +GG    +  WR  F
Sbjct: 214 IGPFIGGAFTTHATWRWCF 232

>TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.242
           YNL065W
          Length = 550

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 58/135 (42%), Gaps = 5/135 (3%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           L G L+D  GR+ +++ S  ++   C+          L+  R +       + ++ S ++
Sbjct: 155 LMGGLADSLGRRPVIITSVFLYFCACIGLACCNNYSQLIGLRCLQATGISPVIAVNSGLM 214

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
            D+     R  Y  L +   VLG   G  +G  L    GWR +F   V+ + +  C + +
Sbjct: 215 GDVTTKAERGGYMGLVSGTQVLGTAFGALIGAALFSRWGWRSIFWFLVIGSGV--CLVLS 272

Query: 326 FLILPKVHH---GNG 337
             ILP+      GNG
Sbjct: 273 LFILPETKRTVVGNG 287

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 64/143 (44%), Gaps = 9/143 (6%)

Query: 202 IFQPL----YGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           IFQ L     G L+D  GR+ ++LFS L++   C+    +     ++  R +       +
Sbjct: 147 IFQGLAPSFMGGLADSLGRRPVVLFSILVYCCACIGLALSQNYTQIVVLRCLQAAGISPV 206

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            ++ S I  DI     R +Y    +   V+G   G  +G  L+   GWR +F    + + 
Sbjct: 207 IAINSGICGDITTRAERGAYVGYVSGFIVIGSAFGALIGAGLSSTWGWRSIFWFLTIGSG 266

Query: 318 ISGCFIQAFLILPKVHH---GNG 337
           I  C + + ++LP+      GNG
Sbjct: 267 I--CLMISIIVLPETKRTLVGNG 287

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 69/142 (48%)

Query: 172 LSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGC 231
           +ST+++ ++ +F     + W+   Y L   +   ++G+++ + G K   L + ++F +G 
Sbjct: 63  VSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGS 122

Query: 232 LVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITL 291
           LV   A ++  L+ GR +A      + S+  +I S +V  R+R     + +  + +   +
Sbjct: 123 LVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEERNRGLIIAVMSSSFGIASVV 182

Query: 292 GGSMGGWLAEYGGWRLVFLLQV 313
           G  +GG    +  WR  F + +
Sbjct: 183 GPFLGGAFTTHVTWRWCFYINL 204

>KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {ON}
           weakly similar to uniprot|P53283 Saccharomyces
           cerevisiae YGR138C TPO2 Polyamine transport protein
          Length = 606

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 57/130 (43%), Gaps = 4/130 (3%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           L+  LS+ FGR  + L +  +  +  + CG A  +  LLA RF+          +    +
Sbjct: 189 LFAPLSEEFGRNPVYLVTLFIAVVFIVPCGAAKNIGTLLAFRFLDGLAFSAPMCLIGGSL 248

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           SD+   + R     LF+    LG  +G  +G  L+    WR V+   V+    SGC    
Sbjct: 249 SDMWRNKERGVAMSLFSAAPFLGPVMGPIVGSLLSVKCSWRWVYWFMVI---FSGCLYAV 305

Query: 326 FLI-LPKVHH 334
             + LP+ HH
Sbjct: 306 MAVFLPETHH 315

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 80/184 (43%), Gaps = 11/184 (5%)

Query: 175 LLDYIASEF---EALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGC 231
           +L  I +EF   E +  I+ +   Y +   I   + G L+D  GR+ ++L S L++   C
Sbjct: 101 VLSVIENEFNITEEMVNITVVV--YFIFQGIAPSIMGGLADSMGRRPVVLSSVLVYCCAC 158

Query: 232 LVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITL 291
           +    + T   ++  R +       + ++ S I+ DI     R  Y    +   V+G   
Sbjct: 159 IGLACSHTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAERGGYVGYVSGFQVIGSAF 218

Query: 292 GGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHH---GNG-IALANKESLK 347
           G  +G  L+    WR +F    + + +  C + + +ILP+      GNG I   N+ S  
Sbjct: 219 GALIGAGLSATWSWRSIFWFLAIGSGV--CLVASIIILPETKRTVVGNGSIMPPNRISRA 276

Query: 348 TKLY 351
             LY
Sbjct: 277 PSLY 280

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 66/154 (42%), Gaps = 6/154 (3%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           YLL   I   + G L+D FGR+ I+L   L++ +  +    AP+   ++  R +      
Sbjct: 144 YLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRCIQSIGIS 203

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
              ++ S ++ D      R ++    +   +LG   G  +G  L     WR +F    + 
Sbjct: 204 PTIAISSGVVGDFTLKHERGTFVGATSGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIG 263

Query: 316 ALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
                CF+ AFLILP+        +A   S+K K
Sbjct: 264 C--GSCFLIAFLILPETKR----TIAGNLSIKPK 291

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 106/265 (40%), Gaps = 22/265 (8%)

Query: 178 YIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTA 237
           Y AS ++    +S I     +++   Q +Y + SDIFGR ++LL + + + +G ++   A
Sbjct: 140 YAASSYKKHSLVSTINVIDSVASATSQVVYSRASDIFGRLSLLLVAIICYVVGTIIQSQA 199

Query: 238 PTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLF---NIC--YVLGITL- 291
             +    AG F        ++ + ++I+SD   L+ R  YQ +    NI   ++ GI + 
Sbjct: 200 YDIQRYCAGSFFYNLGYVGVSLLMTLILSDYSSLKWRFFYQAILAWPNIINDWISGIIVD 259

Query: 292 -GGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALAN-------- 342
               +  W  + G W  +F L  +  L   C I    +  +      +            
Sbjct: 260 RANPIKHWSWDIGMWAFIFPLSCIPILC--CLIHMQWLASQTDEWKQLKKGKSYFKYYGY 317

Query: 343 KESLKTKLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXM-FVSGYY----FV 397
           K+SL    +  D +G   L  F+  + +  +L                FV G      F 
Sbjct: 318 KDSLIDMFWRFDVVGVILLAAFIGLILIPLTLAGGTKSRWSEGKLIAPFVIGCVMVPCFA 377

Query: 398 YHELNIAADPILSVHLLTDRNVLAS 422
             E   A  PI+   L+ DR++ A+
Sbjct: 378 IWEKWFAKHPIMPWRLIKDRSIWAA 402

>YLL028W Chr12 (84804..86564) [1761 bp, 586 aa] {ON}  TPO1Polyamine
           transporter that recognizes spermine, putrescine, and
           spermidine; catalyzes uptake of polyamines at alkaline
           pH and excretion at acidic pH; phosphorylation enhances
           activity and sorting to the plasma membrane
          Length = 586

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 54/129 (41%), Gaps = 2/129 (1%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           +Y  LS+++GRK +L+ S   F L      TA  +  +   RF          ++     
Sbjct: 201 IYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFICRFFGGFIGAAPMAVVPAAF 260

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           +D+     R     LF++   +G  L   MG ++A+   WR  +L  VV    S  F+  
Sbjct: 261 ADMFDTNVRGKAIALFSLGVFVGPILSPVMGSYIAQRTTWR--WLEYVVGCFASAVFVAI 318

Query: 326 FLILPKVHH 334
            L   + HH
Sbjct: 319 VLFFEETHH 327

>CAGL0G03927g Chr7 complement(372896..374599) [1704 bp, 567 aa] {ON}
           highly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028w TPO1 polyamine transport protein
          Length = 567

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 76/180 (42%), Gaps = 3/180 (1%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQP-LYGKLSDIFGRKAILLFSNLMFG 228
           +I ++ +  I   +  +P ++ +  +  +      P +Y  LS+++GR+ +L+ S   F 
Sbjct: 145 SIFASGVPQICKIYHVIPVVAILGVTLYVFGFAASPVIYAPLSEVYGRRGVLVISAFGFA 204

Query: 229 LGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLG 288
           +      T+  +  ++  RF          ++     +D+  +R R     LF++   +G
Sbjct: 205 VFQFAVATSKDLQSIMICRFFGGLIGAAPMAVVPAAFADMFDVRVRGKAICLFSLGVFVG 264

Query: 289 ITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKT 348
             L   MG ++A+   WR  +L  V     S  F+   L   + HH   +    KE  K+
Sbjct: 265 PILSPVMGSYIAQRTTWR--WLEYVTGCFASALFVAVALTFKETHHPTILVQKAKEMRKS 322

>KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 202 IFQPL----YGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           IFQ L     G L+D  GR+ ++L S +++   C+      T   ++A R V       +
Sbjct: 128 IFQALSPTLMGGLADSLGRRPVVLSSVIIYFCACVGLARCNTYAQIIALRCVQAAGISPV 187

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            ++ S ++ D+     R  Y    +   V+G   G   G  L+   GWR +F    + + 
Sbjct: 188 IAINSGMMGDVTTKAERGGYVGYVSGFQVVGTATGAVFGALLSSRWGWRSIFWFLAIGS- 246

Query: 318 ISGCFIQAFLILPKVHH---GNG 337
              C I + L+LP+      GNG
Sbjct: 247 -GACSIVSLLLLPETKRTIVGNG 268

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/272 (23%), Positives = 111/272 (40%), Gaps = 28/272 (10%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q +Y +LSDI+GR ++L+ + +++ +G ++   A  V    AG          +  +  +
Sbjct: 132 QIVYARLSDIYGRMSLLVVAIVLYAVGTIIQCQAYDVQRYAAGSIFYNAGYVGVILILLL 191

Query: 264 IISDIVPLRSRASYQDLFNICYVLGITLGGS-------MGGWLAEYGGWRLVFLLQVVAA 316
           I+SD   LR R  YQ +    +++   + G+       +  W  + G W  +F L  V  
Sbjct: 192 ILSDFSSLRWRLFYQFVPTWPFIINTWISGNITQKANPLKHWSWDIGMWAFIFPLSCVPI 251

Query: 317 LISGCFIQAFLIL---PKVHHGNGIAL-----ANKESLKTKLYMMDWLGTFCLVIFLASL 368
           L   C I     +   P+     G          K +LKT  + +D +G   +V  L  +
Sbjct: 252 LC--CMIHMHWRVRNDPEWKELQGEKTYFQIHGWKVTLKTLFWKLDVVGVLLMVACLGCI 309

Query: 369 TLTCSLV-DXXXXXXXXXXXXMFVSGYY----FVYHELNIAADPILSVHLLTDRNVLASS 423
            +  +L                FV G+     F Y E   A +P++   L+ DR V A+ 
Sbjct: 310 LVPLTLAGGVSSKWNHSNIIGPFVLGFVLIPIFSYWEARWATNPLVPYKLVKDRGVWAAL 369

Query: 424 LANFFCMLNDVLTIFYVPM-YFASVLYMGPKE 454
             +F         IFY+ + Y  +VL +   E
Sbjct: 370 GISFLIDF-----IFYMAVDYLYTVLIVAVHE 396

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 66/143 (46%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ T++D +A +F       W+   Y L   +   L+G+ + I G +  L+ + L+F  G
Sbjct: 64  IVGTIIDVVAKQFGNYSKTGWLVTGYSLPNAVLSLLWGRFASIIGFQHSLILAVLIFEAG 123

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            LV   A ++  L+ GR VA      L ++  +I   +V  RSR     + +  + +   
Sbjct: 124 SLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVDERSRPLVISILSCAFAVAAI 183

Query: 291 LGGSMGGWLAEYGGWRLVFLLQV 313
           +G  +GG    +  WR  F + +
Sbjct: 184 VGPIIGGAFTTHVTWRWCFYINL 206

>Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {ON}
           YDR497C (REAL)
          Length = 579

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 58/133 (43%), Gaps = 19/133 (14%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I A+  L A I     G  +DI+GRK  L+ SN MF +G ++  +A T W +  GR +  
Sbjct: 127 ITAATSLGALITSIFAGTAADIYGRKRCLMGSNFMFVIGAILQVSAHTFWQMAVGRLIMG 186

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG-------- 303
                 + +  + IS+I P   R        +   L +T     GG L  YG        
Sbjct: 187 FGVGIGSLISPLFISEIAPKMIRGR----LTVINSLWLT-----GGQLVAYGCGAGLNYV 237

Query: 304 --GWRLVFLLQVV 314
             GWR++  L ++
Sbjct: 238 NNGWRILVGLSLI 250

>NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa]
           {ON} Anc_4.30
          Length = 567

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 67/154 (43%), Gaps = 3/154 (1%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           Y+L   I   +Y  LS+I+GR+ +L+ S+  F L      TA  +  ++  RF       
Sbjct: 172 YVLGFAISPIVYAPLSEIYGRRGVLVISSFGFCLFQFAVATAENLQTIMICRFFGGLMGA 231

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
              ++    ++D+    +R     LF I   +   +   MG ++A+   WR    L+ V 
Sbjct: 232 APFAVVPAAMADMFDTNTRGKAICLFTIGVFVAPVVSPVMGSYMAQRTTWR---WLEYVI 288

Query: 316 ALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
            + +G    A ++  +  H   I +A  + ++ +
Sbjct: 289 GIFAGVLTAAVVVFFQETHHPSILVAKAKQMRKE 322

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 98/259 (37%), Gaps = 28/259 (10%)

Query: 197 LLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXX 256
           LLSA   Q  Y +LSD+FGR ++ + S + + +G ++   A  V    AG          
Sbjct: 110 LLSAAS-QIFYARLSDVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFYNIGYVG 168

Query: 257 LTSMPSIIISDIVPLRSRASYQ-----DLFNICYVLG--ITLGGSMGGWLAEYGGWRLVF 309
           L  +  +I+SD   L+ R  YQ         I ++ G  I+    +  W    G W  +F
Sbjct: 169 LFLILVLILSDCSSLKWRLFYQYAPTWPFIIITWISGNIISRANPIENWSWGIGMWAFIF 228

Query: 310 LLQVVAALISGCFIQAFLILPKVHHGNGIALANK--------ESLKTKLYMMDWLGTFCL 361
            L  +  L   C +       K      ++            ++L    + +D +G F +
Sbjct: 229 PLTCLPILF--CMLHMRFKARKTPEWQDLSSQKSFFQTHGIVQALVQLFWKLDVVGIFIM 286

Query: 362 VIFLASLTLTCSLVDXXXXXXXXX-----XXXMFVSGYYFVYHELNIAADPILSVHLLTD 416
            I L  + +  +L                    FV    F+Y E   A DP+    LL D
Sbjct: 287 TISLGCILVPLTLAGGSSSKWQNSEIIGPLVLGFVLVPVFIYWESKWAKDPLAPFELLKD 346

Query: 417 RNVLASSLANF-----FCM 430
           R + AS   NF     +CM
Sbjct: 347 RGIWASMCFNFLMDFVYCM 365

>KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {ON}
           Anc_4.30 YLL028W
          Length = 589

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 73/167 (43%), Gaps = 3/167 (1%)

Query: 179 IASEFEALPYISWIAAS-YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTA 237
           I +EF  +  ++ +  + Y+L       ++  LS+++GRK +L+ S   F +      TA
Sbjct: 176 ICAEFHIIQVVAILGITLYVLGFAASPVIFAPLSEVYGRKGVLVVSAFGFTIFNFAVATA 235

Query: 238 PTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGG 297
             +  LL  RF A        ++     +DI     R     LF++   +G  LG  +G 
Sbjct: 236 KDLQTLLICRFFAGFIGAAPLAVVPAAFADIFDTNVRGKAICLFSLGVFVGPILGPVIGS 295

Query: 298 WLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKE 344
           ++ ++  WR  +L  VV  L +  F+       + HH   +A   K+
Sbjct: 296 YIVQHTTWR--WLEYVVGCLSAVVFVLVTFFYQESHHPTILAYKAKQ 340

>TPHA0C03100 Chr3 (684842..686650) [1809 bp, 602 aa] {ON} Anc_2.242
           YNL065W
          Length = 602

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 59/135 (43%), Gaps = 5/135 (3%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           + G L+D  GR+ ++L   L++   C+   +  T   L+  R +       + ++ S I 
Sbjct: 178 IVGNLADTNGRRPLILSCLLIYFCACVGLASCNTYAQLIGLRCLQAAGIAPVIAINSGIA 237

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
            DI   R R SY    +   V+G   G  +G  L+    WR +F    + + +  C I +
Sbjct: 238 GDITTRRERGSYIGYVSGFVVIGSAFGALIGAGLSSTWDWRAIFWFLAIGSGV--CVIYS 295

Query: 326 FLILPKVHH---GNG 337
            ++ P+      GNG
Sbjct: 296 IILFPETKRSIVGNG 310

>TDEL0A06670 Chr1 complement(1163596..1165473) [1878 bp, 625 aa]
           {ON} Anc_8.723 YOR273C
          Length = 625

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 68/146 (46%), Gaps = 13/146 (8%)

Query: 210 LSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIIS 266
           LS++FGRK + LFS   +++F +G  +      +  +L  RF++        S+ S  I 
Sbjct: 130 LSEVFGRKPVYLFSLPISMLFTMGVGLSNGHMRI--VLPLRFLSGAFASPALSVGSGTIM 187

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAF 326
           DI  +   +     F +   LG  +   MG +  E  GWR    +Q    LI+G  I  F
Sbjct: 188 DIFDMDQVSVAMTFFCVAPFLGPVISPIMGSFATEKQGWRWSQWIQ----LIAGGLILPF 243

Query: 327 L-ILPKVHHG---NGIALANKESLKT 348
           + I+P+ H G      A  NK +LK+
Sbjct: 244 IAIMPETHKGVILRKRAKKNKVNLKS 269

>ZYRO0B06688g Chr2 complement(535548..537329) [1782 bp, 593 aa] {ON}
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively and similar to YDR497C uniprot|P30605
           Saccharomyces cerevisiae YDR497C ITR1 Myo-inositol
           transporter with strong similarity to the minor myo-
           inositol transporter Itr2p, member of the sugar
           transporter superfamily; expression is repressed by
           inositol and choline via Opi1p and derepressed via Ino2p
           and Ino4p
          Length = 593

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 4/140 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           + A+  L A I     G ++DI GRK  ++ SN+MF +G ++   A   W + AGR +  
Sbjct: 139 LTAATSLGAFISSLFAGIVADIIGRKPSIMASNVMFLVGIVLQVCAHKYWQMAAGRLIMG 198

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEY-GGWRLVFL 310
                 + +  + I +I P   R     + ++C   G  +  + G  L     GWR++  
Sbjct: 199 FGVGVGSLVAPLFIGEIAPSMIRGRLTVINSLCVTGGQLVAYACGAGLTHVNNGWRVLVG 258

Query: 311 LQVVAALISGCFIQAFLILP 330
           L ++   +   F   F+ LP
Sbjct: 259 LALIPVALQFAF---FMFLP 275

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 68/157 (43%), Gaps = 6/157 (3%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           YLL   +   + G L+D FGR+ I+L   L++ +  +    AP+   ++  R +      
Sbjct: 145 YLLFQGVSPTISGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRCIQSIGIS 204

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
              ++ S ++ D      R ++    +   +LG   G  +G  L     WR +F    + 
Sbjct: 205 PTIAISSGVVGDFTLKHERGTFVGATSGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIG 264

Query: 316 ALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYM 352
                CF+ AFL+LP+        +A   S++ K ++
Sbjct: 265 C--GSCFLIAFLVLPETKR----TIAGNLSIRPKKFI 295

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 95/244 (38%), Gaps = 40/244 (16%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q  Y + SDIFGR  IL+ S L + +G L+   A  +    AG  +          +  +
Sbjct: 108 QIWYARASDIFGRTPILILSILFYFIGTLIESQATDISKYAAGSCIYALGYAGSVLVTQV 167

Query: 264 IISDIVPLRSRASYQDLFNICYVLGITLGGSM-----GGWLAEYGGWRLVFLLQVVAALI 318
           ++SD   L+ R     +  +  ++   +GG++       W   +G W  +F L  +  L 
Sbjct: 168 LVSDYSTLKWRLVSSTVLFLPNIINTWVGGNITEDVGNRWQWGFGMWAFIFPLASIPLL- 226

Query: 319 SGCFIQAFLILPKVHHGNGIALANKESLKTKL-----------------YMMDWLGTFCL 361
             C +          H   +A+ NKE +K  +                 + +D LG   L
Sbjct: 227 --CCLA---------HMKYLAIKNKEDVKLTISKPRSISWARHLYDIFFWKLDMLGLILL 275

Query: 362 VIFLASLTLTCSLVDXXXXXXXXXXXXM-FVSGY-----YFVYHELNIAADPILSVHLLT 415
           V F A + +  +L              +  V G+      F+  EL  A++PI  + L+ 
Sbjct: 276 VAFFALILVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIK 335

Query: 416 DRNV 419
           DR +
Sbjct: 336 DRGI 339

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 74/166 (44%), Gaps = 3/166 (1%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I+ T++D +A +F       W+   Y L   I   ++G+ + I G +  L+ + L+F  G
Sbjct: 54  IVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAG 113

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            LV   A ++  L+ GR VA      L ++  +I   +V  RSR     + +  + +   
Sbjct: 114 SLVAALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRPLVISILSCAFAVAAI 173

Query: 291 LGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGN 336
           +G  +GG    +  WR  F + +    I G  +  FL+  K    N
Sbjct: 174 VGPIIGGAFTTHVTWRWCFYINLP---IGGFAVIMFLLTYKTKSEN 216

>NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 77/179 (43%), Gaps = 16/179 (8%)

Query: 170 TILSTLLDYIASEFEALPYISWIAAS-----YLLSACIFQPLYGKLSDIFGRKAILLFSN 224
           TI   +   + SE E + +IS  + +     Y +   I   + G L+D  GR+ I+L S 
Sbjct: 95  TIAGAIYYPVLSEIEEIFHISEESVNITVVVYFIFQGISPSIMGGLADTMGRRPIVLCSI 154

Query: 225 LMFGLGCL---VCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLF 281
            ++   C+    C T P +  L   R +       + ++ S I+ DI     R  +    
Sbjct: 155 AVYFCACIGLACCQTYPQIVVL---RCLQAAGISPVIAINSGIMGDITTRAERGGFVGYV 211

Query: 282 NICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHH---GNG 337
           +   V+G   G  +G  ++    WR +F    + + I  C I +F+ILP+      GNG
Sbjct: 212 SGFQVMGSAFGALIGAGISSTWSWRAIFWFLAIGSGI--CLIISFIILPETKRTIVGNG 268

>NDAI0F02060 Chr6 complement(505217..506725) [1509 bp, 502 aa] {ON}
           Anc_6.155
          Length = 502

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 52/111 (46%), Gaps = 1/111 (0%)

Query: 208 GKLSDIFGRKAILLFSNLMFGL-GCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIIS 266
           G L++ +GRK + L +N  F L G L   TA  V  L+ GR +          + S+ I+
Sbjct: 111 GSLAERYGRKRVNLINNFCFALFGSLCMFTANNVIMLILGRVLVGIAAGVSIVVTSLYIN 170

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
           DI P+  R +   +  +   LGI L  ++    A+   WR +F +    AL
Sbjct: 171 DIAPVEWRGALGTMNQLSINLGILLTQTVALKYADVHSWRWIFFVGAFVAL 221

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 7/128 (5%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           GKL DI+GR+  L+ + ++F +G L+  T+   W+    GR +A      +  +  ++IS
Sbjct: 134 GKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQYFIGRIIAGIGMGLIAVLSPMLIS 193

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG---WRLVFLLQVVAALISGCFI 323
           ++ P   R +    + +    GI LG         Y     WR+   LQ + ++I  C  
Sbjct: 194 EVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYSNSAQWRIGVGLQFLWSIIMVC-- 251

Query: 324 QAFLILPK 331
            A + +P+
Sbjct: 252 -AMMFVPE 258

>KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON}
           uniprot|Q8NJ22 Kluyveromyces lactis KLLA0E08987g frt1
           Hexose transporter
          Length = 566

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 45/97 (46%), Gaps = 8/97 (8%)

Query: 210 LSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIV 269
           LS+ FGRK  L+ S + + +G ++C  A  V  + AGRF+             + I++ V
Sbjct: 152 LSEYFGRKVALVISCIFYTIGGILCAAAQDVHTMYAGRFLIGVGVGIEGGGVGVYIAESV 211

Query: 270 PLRSRASYQDL--FNIC------YVLGITLGGSMGGW 298
           P   R S   L  FNI       YV+G+      GGW
Sbjct: 212 PSTVRGSLVSLYQFNIALGELVGYVIGVIFFDVKGGW 248

>Skud_12.38 Chr12 (75867..77630) [1764 bp, 587 aa] {ON} YLL028W
           (REAL)
          Length = 587

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 53/129 (41%), Gaps = 2/129 (1%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           +Y  LS+++GRK +L+ S   F L      TA  +  +   RF          ++     
Sbjct: 202 IYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFICRFFGGFIGAAPMAVVPAAF 261

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           +D+     R     LF +   +G  L   MG ++A+   WR  +L  VV    S  F+  
Sbjct: 262 ADMFDTDVRGKAIALFALGVFVGPILSPVMGSYIAQRTTWR--WLEYVVGCFASAVFVAI 319

Query: 326 FLILPKVHH 334
            L   + HH
Sbjct: 320 VLFFEETHH 328

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 61/139 (43%), Gaps = 2/139 (1%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           YLL   +   + G L+D++GR+ ++L   L+F +  +    AP+   ++  R +      
Sbjct: 135 YLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASIGIAKAPSYGVIVFLRCIQSIGIS 194

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
              ++ S ++SD    R R ++    +   ++G  +G  +G  +     WR VF    + 
Sbjct: 195 PTIAISSGVVSDFTVKRERGTFVGATSGLVLIGQGIGPLLGAVITAALHWRAVFWFLTIG 254

Query: 316 ALISGCFIQAFLILPKVHH 334
                C I  F +LP+   
Sbjct: 255 C--GSCMIIGFFLLPETKR 271

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 71/324 (21%), Positives = 133/324 (41%), Gaps = 34/324 (10%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           +I++ L D   S+  +    SW+ AS+ L +  F  + G++ DIFG K +LL   +M  +
Sbjct: 102 SIMNILADSFGSDANSR---SWLMASFPLVSGSFILISGRMGDIFGLKNMLLIGYVMIII 158

Query: 230 GCLVCG----TAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICY 285
             L+CG    +    +++++  F        L ++  II +  V      +++    I +
Sbjct: 159 WSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYV----GGTFRKNIVISF 214

Query: 286 V-----LGITLGGSMGGWLAEY--GGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGI 338
           +     +G TLG    G +       W   F    + A+I+       LIL         
Sbjct: 215 IGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVIN-------LILSIY------ 261

Query: 339 ALANKESLKTKLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVY 398
           A+ N        + MDW+G+   VI L  L L  +               + +S  + V 
Sbjct: 262 AIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVL 321

Query: 399 ---HELNIAADPILSVHLLTDRNVLASSLANFFCMLNDVLTIFYVPMYFASVLYMGPKEI 455
              +E++ A  P+L   ++ DR+++   L+ FF   +  +  FY   +  ++ +  P   
Sbjct: 322 FGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWA 381

Query: 456 GKRTIISFLGTSIGSFGTGYYIKR 479
           G    +  +   I +   G+ IKR
Sbjct: 382 GGSYFMFLIWGIIAALLVGFSIKR 405

>NCAS0B00490 Chr2 complement(71160..73154) [1995 bp, 664 aa] {ON}
           Anc_8.723
          Length = 664

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 60/132 (45%), Gaps = 10/132 (7%)

Query: 208 GKLSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSII 264
             LS++FGRK I LFS   +++F +G  +      +  +L  RF +        S+ S  
Sbjct: 137 APLSEVFGRKPIYLFSLPISMLFTMGVGLSNGHMRI--ILPLRFFSGVFGSPCLSIGSGT 194

Query: 265 ISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQ 324
           I DI  +   +     F +   LG  +   + G+  EY GWR    +Q    L +G  I 
Sbjct: 195 IMDIFDVDQVSVAMTFFCLSPFLGPVISPFIAGFATEYQGWRWAEWIQ----LFAGGLIL 250

Query: 325 AFLIL-PKVHHG 335
            F++L P+ H G
Sbjct: 251 PFIVLMPETHKG 262

>TBLA0D01160 Chr4 (296153..298081) [1929 bp, 642 aa] {ON} Anc_8.723
           YOR273C
          Length = 642

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 58/130 (44%), Gaps = 10/130 (7%)

Query: 210 LSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIIS 266
           LS++FGRK + + S   +++F +G  + G    +  +L  RF +        S+    I 
Sbjct: 130 LSEVFGRKPVYVISLPLSMLFAMGVALSGGKQRI--ILPLRFFSGVFASPALSVAGGTIM 187

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAF 326
           D+  +   +     F +   LG  +   M  +  E  GWR    +Q    LI+G  I  F
Sbjct: 188 DVFDIDEVSVSMTFFCLAPFLGPVISPVMASFATEKKGWRWATYIQ----LIAGGVIMPF 243

Query: 327 LIL-PKVHHG 335
           LIL P+ H G
Sbjct: 244 LILMPETHKG 253

>KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 62/143 (43%), Gaps = 9/143 (6%)

Query: 202 IFQ----PLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           IFQ     L G L+D  GR+ ++L S +++   C+    +     ++A R +       +
Sbjct: 127 IFQGLSPTLMGGLADSLGRRPVILCSVIIYFCACIGLACSNNYAQVIALRCLQAAGISPV 186

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAAL 317
            ++ S ++ D+     R  Y    +   V+G   G   G  L+   GWR +F    + + 
Sbjct: 187 IAINSGMMGDVTTKAERGGYVGYVSGFQVVGTATGAVFGALLSSRWGWRSIFWFLAIGS- 245

Query: 318 ISGCFIQAFLILPKVHH---GNG 337
              C I + L+LP+      GNG
Sbjct: 246 -GACSIVSLLLLPETKRTIVGNG 267

>Kpol_413.2 s413 complement(4040..6043) [2004 bp, 667 aa] {ON}
           complement(4040..6043) [2004 nt, 668 aa]
          Length = 667

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 60/132 (45%), Gaps = 10/132 (7%)

Query: 208 GKLSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSII 264
             LS++FGRK +  FS   +++F +G  +      +  +L  RF++        S+ S  
Sbjct: 157 APLSEVFGRKPVYFFSLPISMLFTMGVGLANGHMRI--ILPLRFLSGVFASPALSVGSGT 214

Query: 265 ISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQ 324
           I D+  L         F +   LG  +   MGG+  E  GWR    +Q    LI+G  I 
Sbjct: 215 ILDVFDLDEVPVALTFFCLAPFLGPVISPVMGGFACESQGWRWAEWIQ----LIAGGLIL 270

Query: 325 AFL-ILPKVHHG 335
            F+ ++P+ H G
Sbjct: 271 PFIALMPETHKG 282

>KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 570 FRSSLKSLLNTNIMPLESEIHPKSQLLHIIDKATHSTDWVHRESPEYAIPILISCYHYVC 629
           F  +L+  L T +  L SE HP+ QL  I+ +A  S+ W+   +PE+A   + + + +  
Sbjct: 592 FNVALRKSLWTALEQLVSEEHPQEQLQQILHRALESSHWIQHSAPEFAQETIYASFRHNF 651

Query: 630 KRIFTFSVVCVLFTSISC 647
             +F  + + +L TS+ C
Sbjct: 652 TTLF-LAAITLLTTSLFC 668

>YOR273C Chr15 complement(834452..836431) [1980 bp, 659 aa] {ON}
           TPO4Polyamine transport protein, recognizes spermine,
           putrescine, and spermidine; localizes to the plasma
           membrane; member of the major facilitator superfamily
          Length = 659

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (43%), Gaps = 29/170 (17%)

Query: 198 LSACIFQPLYGKLSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXX 254
           LS  I  PL    S++FGRK + LFS   +++F +G  +      +  +L  RF++    
Sbjct: 141 LSTVIGAPL----SEVFGRKPVYLFSLPVSMLFTMGVGLSNGHMRI--ILPLRFLSGVFA 194

Query: 255 XXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVV 314
               S+ S  I DI  +   +     F +   LG  L   M G+  E  GWR    +Q  
Sbjct: 195 SPALSVGSGTILDIFDVDQVSVAMTYFVLSPFLGPVLSPIMAGFATEAKGWRWSEWIQ-- 252

Query: 315 AALISGCFIQAFL-ILPKVHHG---------NGIAL------ANKESLKT 348
             LI+G  I  F+ ++P+ H G           IAL      A KE LKT
Sbjct: 253 --LIAGGLILPFIALMPETHKGIILRKRAKKRNIALKKFSREAQKEFLKT 300

>Smik_12.27 Chr12 (69102..70865) [1764 bp, 587 aa] {ON} YLL028W
           (REAL)
          Length = 587

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 53/129 (41%), Gaps = 2/129 (1%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           +Y  LS+++GRK +L+ S   F +      TA  +  +   RF          ++     
Sbjct: 202 VYAPLSELYGRKGVLVLSAFGFAIFQFAVATAENLQTIFICRFFGGFIGAAPMAVVPAAF 261

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           +D+     R     LF +   +G  L   MG ++A+   WR  +L  VV    S  F+  
Sbjct: 262 ADMFDTNIRGKAIALFALGVFVGPILSPVMGSYIAQRTTWR--WLEYVVGCFASAVFVAI 319

Query: 326 FLILPKVHH 334
            L   + HH
Sbjct: 320 VLFFEETHH 328

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 60/128 (46%), Gaps = 7/128 (5%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L D++GR+  L+ + ++F +G ++   +   W+  + GR VA      +  +  ++IS
Sbjct: 135 GRLGDMYGRRIGLIVAAVIFIVGNIIQIASIRAWYQYMIGRIVAGVGAGLIAILSPMLIS 194

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG---WRLVFLLQVVAALISGCFI 323
           ++ P  SR +    + +   LGI LG         Y     WR+   LQ    L   C I
Sbjct: 195 EVAPKNSRGAMVSCYQLMITLGIFLGYCTNFGTKRYHNSTQWRVGVGLQFAWCL---CMI 251

Query: 324 QAFLILPK 331
            A + +P+
Sbjct: 252 SAMMFVPE 259

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 63/151 (41%), Gaps = 5/151 (3%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           L G L+D  GR+ I+L S  ++ + C+   +A     +L  R +       + ++ + II
Sbjct: 134 LMGGLADKVGRRPIVLCSIALYAVACIGLASAQNYGEVLFLRCLQSAGISPVVAVNNGII 193

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
            DI     R  Y  L     V+G   G  +G  +    GWR +F    + +  S     A
Sbjct: 194 GDITTKAERGGYLGLMAGTQVIGSAFGALIGAGITARWGWRAIFWFLAIGSGFS--LAVA 251

Query: 326 FLILPKVHH---GNGIALANKESLKTKLYMM 353
             +LP+      GNG  +      K+ + ++
Sbjct: 252 SFLLPETKRTVVGNGSIVPKNPVCKSPVLLL 282

>TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 58/133 (43%), Gaps = 17/133 (12%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L DI+GR+  L+ +  +F +G ++   +   W+    GR +A      +  +  ++IS
Sbjct: 137 GRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVIAILSPMLIS 196

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG--------WRLVFLLQVVAALI 318
           ++ P   R      F +   LGI LG        EYG         WR+   LQ   +L 
Sbjct: 197 EVSPKEVRGGMVSCFQMMITLGIFLGDC-----TEYGSKEYSNSAQWRVGLGLQFAWSL- 250

Query: 319 SGCFIQAFLILPK 331
             C +   L +P+
Sbjct: 251 --CMVAGMLFVPE 261

>KLTH0D12320g Chr4 complement(1001954..1003720) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q12256 Saccharomyces cerevisiae
           YOR273C TPO4 Polyamine transport protein
          Length = 588

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 59/128 (46%), Gaps = 10/128 (7%)

Query: 210 LSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIIS 266
           LS+IFGRK I + S   +++F +G  + G    V  +L  RF A        S+ S  I 
Sbjct: 105 LSEIFGRKPIYVASLPLSMLFTMGVALSGGKMRV--VLPVRFFAGVFASPALSVASGTIV 162

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAF 326
           DI  +   +    LF +   LG  +   + G+  E  GWR    +Q    L +G  I  F
Sbjct: 163 DIFDMDEVSVAMSLFCLAPFLGPVISPVIAGFATEKQGWRWATYIQ----LFAGGLIMPF 218

Query: 327 -LILPKVH 333
            L++P+ H
Sbjct: 219 VLLMPETH 226

>KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.30
           YLL028W
          Length = 567

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 58/129 (44%), Gaps = 2/129 (1%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           +Y  LS+I+GR+ +L+ S+L F +      TA  +  ++  RF          ++     
Sbjct: 182 IYAPLSEIYGRRGVLVLSSLGFCIFQFAVATAENLQTIMICRFFGGLIGAAPMAVVPAAF 241

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           +D+     R     LF++   +G  +   MG ++ ++  WR  +L  VV  L +  F+  
Sbjct: 242 ADMFDTNMRGKAVCLFSLGVFVGPIISPVMGSYIVQHTTWR--WLEYVVGCLAALVFVLV 299

Query: 326 FLILPKVHH 334
            L   + HH
Sbjct: 300 ALFFEETHH 308

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 67/157 (42%), Gaps = 6/157 (3%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           YL+   I   + G L+D FGR+ I+L   L++ +  +    AP+   ++  R V      
Sbjct: 145 YLMFQGIAPTVCGGLADCFGRRPIILGGMLVYVVASVGLACAPSYGVIIFLRCVQSIGIS 204

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
              ++ S ++ D      R ++    +   +LG   G  +G  L     WR +F    + 
Sbjct: 205 PTIAISSGVVGDFTLKHERGTFVGATSGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIG 264

Query: 316 ALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYM 352
                CF+ AF ILP+        +A   S++ K ++
Sbjct: 265 C--GTCFLIAFFILPETKR----TIAGNLSVRPKRFI 295

>TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 210 LSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIV 269
           LS+ FGRK  L+ S + + +G +VC  A     + AGRF+             + I++ V
Sbjct: 160 LSETFGRKKALVMSCIFYTVGAIVCAAAGNHHEMYAGRFLIGVGVGIEGGGIGVYIAESV 219

Query: 270 PLRSRASYQDL--FNIC------YVLGITLGGSMGGW 298
           P   R S   L  FNI       Y++G+      GGW
Sbjct: 220 PSSVRGSLVSLYQFNIALGELFGYIVGVIFFDVKGGW 256

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 63/133 (47%), Gaps = 17/133 (12%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L DI+GR+  L+ ++ +F +G ++   +   W+  + GR VA      +  +  ++IS
Sbjct: 132 GRLGDIYGRRIGLIVASFIFIVGTVIQIASVKAWYQYMIGRIVAGLGCGLIAILSPMLIS 191

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG--------GWRLVFLLQVVAALI 318
           ++ P   R +       CY L ITLG  + G+   YG         WR+   LQ    L 
Sbjct: 192 EVSPKNMRGAMVS----CYQLMITLGIFL-GYCTNYGTKRYHDSTQWRVGLGLQFAWCL- 245

Query: 319 SGCFIQAFLILPK 331
             C I A L +P+
Sbjct: 246 --CMIVAMLFVPE 256

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 59/135 (43%), Gaps = 5/135 (3%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           L G L+D  GR+ ++L+S +++   C+    +     ++  R +       + ++ S I+
Sbjct: 130 LMGGLADSLGRRPVVLWSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAINSGIM 189

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
            D+     R  Y        +LG  LG  +G  L+    WR +F    + +    C + +
Sbjct: 190 GDVTTKAERGGYVGYVAGFQILGSALGALIGAALSSRWDWRAIFWFLAIGS--GACALVS 247

Query: 326 FLILPKVHH---GNG 337
           F +LP+      GNG
Sbjct: 248 FFVLPETKRTVVGNG 262

>CAGL0L10912g Chr12 complement(1167086..1169041) [1956 bp, 651 aa]
           {ON} similar to uniprot|Q12256 Saccharomyces cerevisiae
           YOR273c
          Length = 651

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 66/148 (44%), Gaps = 9/148 (6%)

Query: 208 GKLSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSII 264
             LS++FGRK I LFS   +++F +G  + G       +L  RF A        S+ S  
Sbjct: 141 APLSEVFGRKPIYLFSLPISMLFTMGVGLSGGHMRT--ILPLRFFAGFFASPCLSVGSGT 198

Query: 265 ISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQ 324
           I D+  +   +     F++   LG  +   + G+  E   WR    +Q+ A   SG  + 
Sbjct: 199 ILDVFDVDEVSVAMTFFSLAPFLGPVISPIIAGFAVEERSWRYTQWIQLWA---SGLILP 255

Query: 325 AFLILPKVHHGNGI-ALANKESLKTKLY 351
              I+P+ H G  +   A K ++K K +
Sbjct: 256 LIAIMPETHKGLILRKRAQKRNIKLKAF 283

>Suva_10.43 Chr10 (89159..90922) [1764 bp, 587 aa] {ON} YLL028W
           (REAL)
          Length = 587

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 53/129 (41%), Gaps = 2/129 (1%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           +Y  LS+++GRK +L+ S   F L      TA  +  +   RF          ++     
Sbjct: 202 IYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFICRFFGGFIGAAPMAVVPAAF 261

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           +D+     R     LF +   +G  L   MG ++A+   WR  +L  VV    S  F+  
Sbjct: 262 ADMFDTNVRGKAIALFALGVFVGPILAPVMGSYIAQRTTWR--WLEYVVGCFASLVFVLI 319

Query: 326 FLILPKVHH 334
            L   + HH
Sbjct: 320 ALFFEETHH 328

>TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.30
           YLL028W
          Length = 671

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 61/138 (44%), Gaps = 1/138 (0%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQP-LYGKLSDIFGRKAILLFSNLMFG 228
           +I S+ +  +  ++  +  ++ +  +  +    F P +Y  LS+++GR+ +++ S   F 
Sbjct: 249 SIFSSGMPQLEEKYHIIEVVAILGVTLYVLGFAFSPVIYAPLSELYGRRGVIVISAFGFS 308

Query: 229 LGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLG 288
           L      TA  +  ++  RF A         +     +D+     R     LF++   LG
Sbjct: 309 LFQFAVATAENIQTIMICRFFAGFLGAAPFPVVPAAFADMFDTNLRGKAICLFSMGVFLG 368

Query: 289 ITLGGSMGGWLAEYGGWR 306
             +   MG ++A+Y  WR
Sbjct: 369 PVIAPVMGSYMAKYTTWR 386

>TPHA0K02160 Chr11 complement(461256..463082) [1827 bp, 608 aa] {ON}
           Anc_4.30 YLL028W
          Length = 608

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 66/148 (44%), Gaps = 8/148 (5%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           +  S  IF PL    S++FGR+ ++L S+    L      TA  +  +L  RF A     
Sbjct: 216 FAFSPIIFAPL----SELFGRQKVILISSFGNALFQYAVATAANLQTILICRFFAGLIGA 271

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
              ++   + +DI     R     LF++   +G  LG  +G ++ ++  WR  +   V++
Sbjct: 272 APIAVVPAVFADIFDTNIRGKAIALFSLGVFIGPILGPIIGSYIVQHTTWR--WTEYVIS 329

Query: 316 ALISGCFIQAFLILPKVHHGNGIALANK 343
            L +   +   L L + HH   I L NK
Sbjct: 330 FLSTFVTLLILLFLEETHH--PIILVNK 355

>TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 632

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 2/112 (1%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGR-FVAXXXX 254
           Y+L       LY  LS+++GRK +L+ S L F L  +   TA  +  ++  R F      
Sbjct: 237 YVLGFAAVPVLYAPLSELYGRKGVLVLSGLRFCLIQIAVATAENLQTIMICRVFNELICS 296

Query: 255 XXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWR 306
             +  +P+ + +D+     R     LF +   +G  LG  MG ++ ++  WR
Sbjct: 297 APMVVVPA-VFADMFDTNFRGKAICLFTVFVFIGPILGPVMGSYIVQHTTWR 347

>Skud_15.438 Chr15 complement(773226..775205) [1980 bp, 659 aa] {ON}
           YOR273C (REAL)
          Length = 659

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 64/141 (45%), Gaps = 12/141 (8%)

Query: 198 LSACIFQPLYGKLSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXX 254
           LS  I  PL    S++FGRK I LFS   +++F +G  +      +  +L  RF++    
Sbjct: 141 LSTVIGAPL----SEVFGRKPIYLFSLPLSMLFTMGVGLSNGHMRI--ILPLRFLSGVFA 194

Query: 255 XXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVV 314
               S+ S  I DI  +   +     F +   LG  L   M G+  +  GWR    +Q++
Sbjct: 195 SPALSVGSGTILDIFDVDQVSVAMTYFVLSPFLGPVLSPIMAGFATQAEGWRWSEWIQLI 254

Query: 315 AALISGCFIQAFLILPKVHHG 335
           A  I   FI    ++P+ H G
Sbjct: 255 AGGIILPFIA---VMPETHKG 272

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 64/141 (45%), Gaps = 20/141 (14%)

Query: 200 ACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLT 258
            C F    G+L DI+GR+  L+ ++++F +G ++   +   W+  + GR VA      + 
Sbjct: 132 GCFF---LGRLGDIYGRRIGLIVASVIFIIGSVIQIASVKAWYQYMIGRIVAGIGCGLIA 188

Query: 259 SMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG--------GWRLVFL 310
            +  ++IS++ P   R +    + +   LGI L     G+   YG         WR+   
Sbjct: 189 ILSPMLISEVSPKNMRGAMVSCYQLMVTLGIFL-----GYCTNYGTKRYHNSAQWRIGEG 243

Query: 311 LQVVAALISGCFIQAFLILPK 331
           LQ    L   C I A + +P+
Sbjct: 244 LQFAWCL---CMIGAMMFVPE 261

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 61/133 (45%), Gaps = 17/133 (12%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L D++GR+  L+ +  +F +G ++   +   W+  + GR VA      +  +  ++IS
Sbjct: 128 GRLGDMYGRRIGLIIATTIFIVGTIIQVASVKAWYQYMIGRIVAGVGCGVIAMLSPMLIS 187

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG--------GWRLVFLLQVVAALI 318
           ++ P   R +    + +   +GI L     G+ A YG         WR+   LQ   AL 
Sbjct: 188 EVSPKHLRGAMVSCYQLMVTMGIFL-----GYCANYGTKRYSNSVQWRVPEGLQFAWALF 242

Query: 319 SGCFIQAFLILPK 331
               I A L +P+
Sbjct: 243 ---MISAMLFVPE 252

>Smik_15.455 Chr15 complement(784048..786027) [1980 bp, 659 aa] {ON}
           YOR273C (REAL)
          Length = 659

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 65/142 (45%), Gaps = 14/142 (9%)

Query: 198 LSACIFQPLYGKLSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXX 254
           LS  I  PL    S++FGRK I LFS   +++F +G  +      +  +L  RF++    
Sbjct: 141 LSTVIGAPL----SEVFGRKPIYLFSLPISMLFTMGVGLSNGHMRI--ILPLRFLSGVFA 194

Query: 255 XXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVV 314
               S+ S  I DI  +   +     F +   LG  L   M G+  +  GWR    +Q  
Sbjct: 195 SPALSVGSGTILDIFDVDQVSVAMTYFVLSPFLGPVLSPIMAGFATQAKGWRWSEWIQ-- 252

Query: 315 AALISGCFIQAFL-ILPKVHHG 335
             LI+G  I  F+ ++P+ H G
Sbjct: 253 --LIAGGLILPFIALMPETHKG 272

>TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 58/133 (43%), Gaps = 17/133 (12%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L DI+GR+  L+ +  +F +G ++   +   W+    GR +A      +  +  ++IS
Sbjct: 137 GRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVIAILSPMLIS 196

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG--------GWRLVFLLQVVAALI 318
           ++ P   R +    F +   LGI LG        EYG         WR+   LQ    L 
Sbjct: 197 EVSPREMRGAMVSCFQLMITLGIFLGDC-----TEYGTKTYSNSVQWRVGLGLQFAWCL- 250

Query: 319 SGCFIQAFLILPK 331
             C +   + +P+
Sbjct: 251 --CMVGGMMFVPE 261

>Kwal_33.12950 s33 complement(12899..14599) [1701 bp, 566 aa] {ON}
           YHR094C (HXT1) - High-affinity hexose (glucose)
           transporter [contig 123] FULL
          Length = 566

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 57/135 (42%), Gaps = 3/135 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           +AA YL +ACI  PL   L    GR+ I+ +S L+   G L+ G A     LL  R +  
Sbjct: 144 VAAPYLAAACIGSPLTVYLDKYTGRRWIVFWSCLIGFAGSLIQGFANGFGCLLFARLLLG 203

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG---WRLV 308
                 ++   I  ++  P  SR +   L+     LG+ LG           G   WRL+
Sbjct: 204 VGMGLNSATVPIYTAECSPANSRGALLMLWQTFIALGVCLGSVFNRAFVNINGSLSWRLM 263

Query: 309 FLLQVVAALISGCFI 323
                VA +I+   I
Sbjct: 264 IGSSAVAPVITAALI 278

>TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30
           YLL028W
          Length = 584

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 67/155 (43%), Gaps = 6/155 (3%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           Y+L       +Y  LS+I+GRK +++ S   F +      TA  +  +   RF       
Sbjct: 189 YVLGFAASPVIYAPLSEIYGRKGVIIISAFGFSIFQFAVATAENLQTIFICRFFGGLIGA 248

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWR-LVFLLQVV 314
              ++     +D+     R     LF++   +G  LG  +G ++ ++  WR L +++   
Sbjct: 249 APMAVVPAAFADMFDNNMRGKAISLFSLGVFVGPVLGPVIGSYIVQHTTWRWLEYVIGCF 308

Query: 315 AALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
           +ALI   F+   + + + HH     L NK  +  K
Sbjct: 309 SALI---FVLICIFMEETHHPT--ILVNKAIMMRK 338

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 63/133 (47%), Gaps = 17/133 (12%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L DI+GR+  L+ ++++F +G ++   +   W+  + GR +A      +  +  ++IS
Sbjct: 139 GRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQYMIGRIIAGLGCGLIAILSPMLIS 198

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG--------GWRLVFLLQVVAALI 318
           ++ P   R +       CY L ITLG  + G+   YG         WR+   LQ    L 
Sbjct: 199 EVSPKNMRGAMVS----CYQLMITLGIFL-GYCTNYGTKKYHNSRQWRIPLGLQFAWCLF 253

Query: 319 SGCFIQAFLILPK 331
               I A L +P+
Sbjct: 254 ---MIGAMLFVPE 263

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 59/139 (42%), Gaps = 2/139 (1%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           YLL   I   + G L+DI+GR+ ++LF  L++ +  +    A +   ++  R +      
Sbjct: 147 YLLFQGISPTVCGGLADIYGRRPVILFGMLVYIVASIALACANSYGVIIFLRCLQSCGIS 206

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
            + ++ S  + D      R ++    +   +LG   G  +G  LA    WR +F    + 
Sbjct: 207 PIIAISSGCVGDFTMKAERGTFVGAVSGLVLLGQAFGSLIGAALAAAWDWRAIFWFLAIG 266

Query: 316 ALISGCFIQAFLILPKVHH 334
           A    C     L+LP+   
Sbjct: 267 A--GCCLFVGILVLPETKR 283

>SAKL0H25498g Chr8 complement(2229233..2231041) [1809 bp, 602 aa]
           {ON} similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force-dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 602

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 55/129 (42%), Gaps = 2/129 (1%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           +Y  LS+++GR+ +L+ S+  F L      TA  +  ++  RF          ++     
Sbjct: 216 IYAPLSELYGRQGVLVISSFGFALFQFAVATAKDLQTIMICRFFGGFIGAAPLAVVPAAF 275

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           SD+   +SR +   LF +   +G  L    G ++ ++  WR V    V     S  F+  
Sbjct: 276 SDMFDNKSRGTAVALFALGVFVGPILSPVFGSYITQHTTWRWV--EYVTGIFASVVFVLV 333

Query: 326 FLILPKVHH 334
            +   + HH
Sbjct: 334 AIFFEETHH 342

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 115/280 (41%), Gaps = 10/280 (3%)

Query: 190 SWIAASYLLSACIFQPLYGKLSDIFGR-KAILLFSNLMFGLGCLVCGTAPTV--WWLLAG 246
           SWI ASYL++  I Q L  ++S  +   K +     ++F +G  +  T  TV  WW++  
Sbjct: 234 SWIIASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSIL-TIKTVSFWWIVMA 292

Query: 247 RFVAXXXXXXLT-SMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGW 305
           RF+       L   M +II   I+  R       +F I  V G++L  +   ++     W
Sbjct: 293 RFILGLASGSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLAYATAIFIT---SW 349

Query: 306 RLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALAN-KESLKTKLYMMDWLGTFCLVIF 364
           + V+ L  + +  +   I  +    + +  N   L++   +L   L     L  F L+I 
Sbjct: 350 QNVYFLLAIFSFFTLFLIMFYFPSNESYKTNNTNLSSIVATLDIDLIGCTILSVFLLLIA 409

Query: 365 LASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPILSVHLLTDRNVLASSL 424
           + + T   +               + + G   +  E     +PI+ +  + ++ +   SL
Sbjct: 410 VIT-TGNSNGFSITSPYSATLVISIILVGILLLLSETTTNKNPIIPLDFIENKVIFFKSL 468

Query: 425 ANFFCMLNDVLTIFYVPMYFASVLYMGPKEIGKRTIISFL 464
             FF  ++ +  I Y P Y    L +   +I KRT   FL
Sbjct: 469 TVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFL 508

 Score = 38.1 bits (87), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 34/79 (43%), Gaps = 16/79 (20%)

Query: 1  MGRKRSGIKTKERNRLKEFAKLKGRQRTLKSDE--AGETYLGDK---------SNTISFG 49
          MGRK      K+R RL++FAKLK +QR L  D+  A    L +K           TI   
Sbjct: 1  MGRKD-----KQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQ 55

Query: 50 PYSRSSDESQGETIPFLTR 68
          P     D    E  P L +
Sbjct: 56 PTGNIEDNDSTELTPLLLK 74

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 2/139 (1%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           YLL   I     G L+D +GR+ I+L   L++ +  +    AP+   ++  R V      
Sbjct: 158 YLLFQGIAPTFSGGLADRYGRRPIILGGMLVYVVASIGLARAPSYGVIVFLRIVQSIGIS 217

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
              ++ S ++SD    R R ++    +   ++G  +G  +G  +A    WR +F   V+ 
Sbjct: 218 PTIAISSGVVSDYTLKRERGTFVGATSGFVLIGQGIGPLLGAVIAARWDWRAIFWFLVIG 277

Query: 316 ALISGCFIQAFLILPKVHH 334
              S   + AF +LP+   
Sbjct: 278 CGTS--MLIAFFLLPETKR 294

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 42/97 (43%), Gaps = 8/97 (8%)

Query: 210 LSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIV 269
            S+ FGRK  L  S + + +G +VC  A     + AGRF+             + I++ V
Sbjct: 160 FSEYFGRKKSLAISCVFYTVGAIVCAAASNHHEMYAGRFLIGIGVGLEGGGIGVYIAESV 219

Query: 270 PLRSRASYQDL--FNIC------YVLGITLGGSMGGW 298
           P   R S   L  FNI       Y++G+      GGW
Sbjct: 220 PSSVRGSLVSLYQFNIALGELFGYIVGVIFFDVKGGW 256

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 65/154 (42%), Gaps = 6/154 (3%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           YLL   +   +   L+D +GR+ ++L   L+F +  +    + +   ++A R +      
Sbjct: 114 YLLFQGVAPTVCSGLADTYGRRPVILMGMLIFIVSSIGIACSNSFALVIALRCIQSSGIS 173

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
            + ++ S ++ D      R ++    +   +LG   G  +G  L     WR VF    + 
Sbjct: 174 PIIAINSGVVGDFTLKSERGTFIGAVSGLTLLGQAFGSLIGASLTAAYNWRAVFWFMTIG 233

Query: 316 ALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
             +  CF+  FL LP+ H      +    SLK K
Sbjct: 234 CGV--CFLANFLFLPETHR----CIVGNLSLKPK 261

>Suva_8.322 Chr8 complement(573995..575953) [1959 bp, 652 aa] {ON}
           YOR273C (REAL)
          Length = 652

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 60/130 (46%), Gaps = 10/130 (7%)

Query: 210 LSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIIS 266
           LS++FGRK + LFS   +++F +G  +      +  +L  RF++        S+ S  I 
Sbjct: 142 LSEVFGRKPVYLFSLPASMLFTMGVGLSNGHMRI--ILPLRFLSGVFASPALSVGSGTIL 199

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAF 326
           DI  +   +     F +   LG  L   M G+  E  GWR    +Q    LI+G  +  F
Sbjct: 200 DIFDVDQVSVAMTYFVLSPFLGPVLSPIMAGFATEAKGWRWSEWIQ----LIAGGMVLPF 255

Query: 327 L-ILPKVHHG 335
           +  +P+ H G
Sbjct: 256 IATMPETHKG 265

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 103/243 (42%), Gaps = 27/243 (11%)

Query: 190 SWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCG----TAPTVWWLLA 245
           +W+ AS+ L++  F  + G++ DI+G KA  +  N++F +  ++CG    T    ++++ 
Sbjct: 113 TWLMASFTLASGSFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIIC 172

Query: 246 GRFVAXXXXXXLTSMPSII--ISDIVPLRSRASYQDLFNICYV-LGITLGGSMGGWLAEY 302
             F        L ++  ++  I ++  +R        F  C   +G T GG  GG + + 
Sbjct: 173 RAFQGLGVAFVLPNVMGLVGNIYNVGSMRKNIVIS--FIGCMAPVGQTFGGMWGGLIVDS 230

Query: 303 GG--WRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTFC 360
               W  +F    +A  I+   I     +P  +H       N  +LK     MDW+G+  
Sbjct: 231 NKDQWPWIFFATAIAVFIN--LIMGIYSIP--NH----VPTNIYNLK-----MDWIGSLL 277

Query: 361 LVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYY---FVYHELNIAADPILSVHLLTDR 417
            VI L  +    +               + V+ ++   F  +EL  A  P+L   +  +R
Sbjct: 278 GVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELKKAESPLLPPEVTKNR 337

Query: 418 NVL 420
           +++
Sbjct: 338 HIV 340

>KLTH0B00484g Chr2 complement(51712..53412) [1701 bp, 566 aa] {ON}
           weakly similar to uniprot|Q12300 Saccharomyces
           cerevisiae YDL138W RGT2 Plasma membrane glucose receptor
          Length = 566

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 56/135 (41%), Gaps = 3/135 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           +AA YL +AC+  PL   L +  GRK I+  S  +   G L+ G +  +  LL  R    
Sbjct: 144 VAAPYLAAACLGSPLTIYLDNYVGRKWIVFLSCFIGFAGSLIQGFSNGLGCLLFARLFLG 203

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG---WRLV 308
                 +S   I  ++  P  SR +   L+     LG+ LG           G   WRL+
Sbjct: 204 IGMGLNSSTVPIYTAECSPAISRGAILMLWQTFIALGVCLGSVFNRAFVNISGSLSWRLM 263

Query: 309 FLLQVVAALISGCFI 323
                VA  ++G  I
Sbjct: 264 IGSSAVAPFVTGILI 278

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 97/245 (39%), Gaps = 34/245 (13%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q +Y +LSD FGR  + + + +++ +G ++   A  V    AG          +  +  +
Sbjct: 120 QIVYARLSDAFGRFRLFVVAIVLYSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLL 179

Query: 264 IISDIVPLRSRASYQDLFNICYVLGITLGGSMG-------GWLAEYGGWRLVFLLQVVAA 316
           I+SD+  LR R  YQ +    Y++   + G++         W  + G W  +F L  +  
Sbjct: 180 ILSDMSTLRWRLFYQFVPTWPYIINTWISGNITSAANPIENWSWDVGMWAFIFPLSCLPI 239

Query: 317 LISGCFIQAFLILPKVHHGNGIALANK--------ESLKTKLYMMDWLGTFCLVIFLASL 368
           L   C I       K      +             +SL +  + +D +G     + L + 
Sbjct: 240 L--ACMIHMQWRARKTQEWKDLKTQKTYYQQHGLMKSLVSLFWKIDIIG-----VLLMAA 292

Query: 369 TLTCSLVDXXXXXXXXXXXX------MFVSGY-----YFVYHELNIAADPILSVHLLTDR 417
           +L C LV                   +FV G+     +F++ E   A DPI+   L+ DR
Sbjct: 293 SLGCILVPLTLAGGTSSKWRDSRIIGVFVLGFVLIPIFFIW-EKKFATDPIVPYKLVKDR 351

Query: 418 NVLAS 422
            V AS
Sbjct: 352 GVWAS 356

>NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa]
           {ON} Anc_4.30
          Length = 639

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 60/140 (42%), Gaps = 4/140 (2%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           Y+L   +   +Y  LS+I+GR+ +L+ S   F +      TA  +  ++  RF +     
Sbjct: 244 YVLGFAVSPVIYAPLSEIYGRRGVLVISAFAFCIFQFAVATAENLQTIMICRFFSGVIGS 303

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
              ++     +D+     R     LF++   +G  L    G ++A+   WR    L+ V 
Sbjct: 304 APMAVVPAAFADMFDTNLRGKAICLFSLFVFVGPILSPVFGSYMAQRTTWR---WLEYVV 360

Query: 316 ALISG-CFIQAFLILPKVHH 334
            + +G  F+   L   + HH
Sbjct: 361 GIFAGVVFVLIVLFYEETHH 380

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 70/142 (49%), Gaps = 4/142 (2%)

Query: 190 SWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFV 249
            +I ++  L A I     G  +D+FGR+  ++FSN++F +G ++   A   W ++ GR V
Sbjct: 108 EYITSATSLGALIAALGAGICADLFGRRKCIMFSNILFVVGTVLQVAAFNFWQMVVGRLV 167

Query: 250 AXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMG-GWLAEYGGWRLV 308
                   + +  + IS+I P   R     + ++    G  +  + G G+     GWR++
Sbjct: 168 MGFGIGFGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYACGAGFQHVKHGWRIL 227

Query: 309 FLLQVVAALISGCFIQAFLILP 330
             + ++ A++   F+ +F+ LP
Sbjct: 228 VGISMLPAVLQ--FV-SFIFLP 246

>KLTH0H05698g Chr8 (503691..505202) [1512 bp, 503 aa] {ON} similar
           to uniprot|P53142 Saccharomyces cerevisiae YGL104C VPS73
           Mitochondrial protein involved in vacuolar protein
           sorting
          Length = 503

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 61/128 (47%), Gaps = 8/128 (6%)

Query: 208 GKLSDIFGRKAILLFSNLMFG-LGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIIS 266
           G+++D +GRK    F+N + G +G L+   A +   L+AGRF+A         +  + I+
Sbjct: 101 GRVADRYGRKK-YSFTNCVIGIIGSLLLFRANSYAQLIAGRFIAGISCGSCIVVTPLFIN 159

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAF 326
           +I P   R S   +  +C  +GI L   +    A+   WR + L   + ALI       F
Sbjct: 160 EISPKELRGSLGSMNQVCINVGILLTQLLALKYADSYRWRWLMLAGAILALIQ------F 213

Query: 327 LILPKVHH 334
           L+L K+  
Sbjct: 214 LLLFKIDE 221

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 96/242 (39%), Gaps = 28/242 (11%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q +Y +LSD+FGR  + + + +++ +G ++   A  V    AG          +  +  I
Sbjct: 127 QIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLI 186

Query: 264 IISDIVPLRSRASYQDLFNICYVLGITLGGSMG-------GWLAEYGGWRLVFLLQVVAA 316
           I+SD   L+ R  YQ +    +++   + G++         W  + G W  +F L  V  
Sbjct: 187 ILSDFSSLKWRLLYQFVPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCVPI 246

Query: 317 LISGCFIQ-AFLILPKVHHGNGIALANKES-----LKTKLYMMDWLGTFCLVIFLASLTL 370
           ++    +Q      P+ H   G     +E      LK   +M+D +G     + L   +L
Sbjct: 247 VLCMLHMQWRARKTPEWHALKGQKSYYQEHGFIKILKQLFWMLDVVG-----VLLMGCSL 301

Query: 371 TCSLVDXXXXXXXXXXXX------MFVSGYYFV----YHELNIAADPILSVHLLTDRNVL 420
            C LV                    FV G+  +      E   A DPIL   L+ DR V 
Sbjct: 302 GCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPILWIWEYRFARDPILPYRLVKDRAVW 361

Query: 421 AS 422
           +S
Sbjct: 362 SS 363

>Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON}
           (12238..13980) [1743 nt, 581 aa]
          Length = 580

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/155 (20%), Positives = 64/155 (41%), Gaps = 3/155 (1%)

Query: 181 SEFEALPYISWIAAS-YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPT 239
            EF  +  +S +  + Y+L       +Y  LS+++GRK +++ S   F +       +  
Sbjct: 169 EEFHVITVVSVLGITLYVLGFAASPIIYAPLSELYGRKGVIILSAFGFSVFQFAVAVSKD 228

Query: 240 VWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWL 299
              ++  RF          ++     +D+     R     LF++   +G  LG  MG ++
Sbjct: 229 FQSIMICRFFGGLIGAAPMAVVPACFADMFDTNMRGKAIALFSLGVFVGPILGPVMGSYI 288

Query: 300 AEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHH 334
            ++  WR  +L  V+    +  F+     + + HH
Sbjct: 289 VQHTTWR--WLEYVIGCFSAAIFVALLFFMEETHH 321

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 98/249 (39%), Gaps = 32/249 (12%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q +Y +L+D+FGR  + + + + + +G ++   +  +    AG          +  +  +
Sbjct: 148 QIVYARLADVFGRLTLFITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGYVGVVLVLLL 207

Query: 264 IISDIVPLRSRASYQDLFNICYVLGITLGGSM-------GGWLAEYGGWRLVFLLQVVAA 316
           I+SD   L+ R  YQ      +++   + G++         W  + G W  +F L  V  
Sbjct: 208 ILSDFSSLKWRLFYQFAPTWPFIINTWISGNITSRANPQENWSWDIGMWAFIFPLSCVPL 267

Query: 317 LISGCFIQAFLILPKVHHGNGIALANKES-----------LKTKLYMMDWLGTFCLVI-- 363
           +   C +  +    K        + N+E            +K   + +D +GTF + +  
Sbjct: 268 IC--CMLHMWW---KARRTEEWKILNEEKTYFKTHGLVSFIKELFWKLDTIGTFIMTVSL 322

Query: 364 --FLASLTL---TCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPILSVHLLTDRN 418
              L  LTL   T S  D            + +     + +EL  A +PIL   L+ DR 
Sbjct: 323 GCILVPLTLAGGTSSKWDDSQIIGPLVLGVVLLP--MLIVYELKWAREPILPWKLIKDRA 380

Query: 419 VLASSLANF 427
           V AS   +F
Sbjct: 381 VWASMSISF 389

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 69/314 (21%), Positives = 127/314 (40%), Gaps = 47/314 (14%)

Query: 190 SWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAP----TVWWLLA 245
           SW+ AS+ L +  F  + G+L DI+G K +LL   +   +  L+CG +       +++ +
Sbjct: 103 SWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITS 162

Query: 246 GRFVAXXXXXXLTSMPSIIISDIVP-LRSRASYQDLFNICYVLGITLGGSMGGWLA--EY 302
             F        L ++  I+ +   P  R +     L  +C  +G T GG   G +   + 
Sbjct: 163 RAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKD 222

Query: 303 GGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTFC-- 360
             W   F    +AA ++   I ++ ++P           N   +    + MDW+G+    
Sbjct: 223 SDWPWAFYAYTIAAFLTT--IISYFVIP-----------NSIPVNVNKFAMDWIGSALGV 269

Query: 361 --LVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSGYYFVYHELNIAADPILSVHLLTDRN 418
             LV+F      +  +              +F+   +F++ E+  A  P+L   +   R+
Sbjct: 270 SGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIF-EIKYAKVPLLPKEVTESRS 328

Query: 419 ---VLASSLANF-------FCMLNDVLTIF-YVPMYFASVLYMGPKEIGKRTIISFLGTS 467
              +LAS +A +       F     VLT+  Y P++     +M          +S +G  
Sbjct: 329 IIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFM----------VSIVGC- 377

Query: 468 IGSFGTGYYIKRRG 481
           I +   G+ IKR G
Sbjct: 378 IAALTVGFSIKRVG 391

>TPHA0G01430 Chr7 (292540..294453) [1914 bp, 637 aa] {ON} Anc_8.723
           YOR273C
          Length = 637

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 66/147 (44%), Gaps = 13/147 (8%)

Query: 208 GKLSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSII 264
             LS++FGRK I L S   +++F +G  + G    +  +L  RF +        S+ S  
Sbjct: 129 APLSEVFGRKPIYLISLPISMLFTMGVGLSGGHMRI--ILPLRFFSGVFGSPALSVGSGT 186

Query: 265 ISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQ 324
           I D+  +        +F +   LG  +   M G+  E  GWR    +Q    LI+G  I 
Sbjct: 187 ILDVFDMDEVPMAMAMFCLAPFLGPIISPVMAGFATEKQGWRWAEWIQ----LIAGGLIL 242

Query: 325 AFL-ILPKVHHGNGIALANKESLKTKL 350
            F+ ++P+ H    + +  K + + KL
Sbjct: 243 PFIALMPETHK---VVILTKRAKERKL 266

>KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} similar
           to uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton-motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 589

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 64/155 (41%), Gaps = 6/155 (3%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           Y+L       +Y  LS+++GR+ +LL ++  F L      TA  +  +L  RF       
Sbjct: 192 YVLGFAASPVIYAPLSELYGRQGVLLIASFGFALFQFAVATAENLQTILICRFFGGFIGA 251

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLV-FLLQVV 314
              ++     SD+     R +   +F +   +G  L    G ++ +Y  WR   ++  + 
Sbjct: 252 APLAVVPASFSDMFDNTQRGTAVTMFALGVFVGPILAPVFGSYIVQYTSWRWTEYVTGIF 311

Query: 315 AALISGCFIQAFLILPKVHHGNGIALANKESLKTK 349
           A++I   F+       + HH     L NK  +  K
Sbjct: 312 ASVI---FVLLCYFFEETHHPT--ILVNKAKMMRK 341

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 52/115 (45%), Gaps = 4/115 (3%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           GKL D++GR+  L+F   +F +G ++   + + W+    GR +A      +  +  ++IS
Sbjct: 142 GKLGDLYGRRWGLIFGTSIFVVGVIIQIASVSKWFQYFIGRIIAGIGMGVIAVLSPMLIS 201

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG---WRLVFLLQVVAALI 318
           ++ P   R +    + +    GI LG         Y     WR+   LQ +  +I
Sbjct: 202 EVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYQNSKQWRIAVGLQFLWCII 256

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 97/240 (40%), Gaps = 25/240 (10%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q ++ +LSDIFGR  + L   +++ +G ++   A  +     G          ++ +  I
Sbjct: 130 QIIFAQLSDIFGRLQLFLVGTVLYIVGTIIQCEARDIRTYAVGAAFYNSGYVGVSILLII 189

Query: 264 IISDIVPLRSRASYQ-----DLFNICYVLG--ITLGGSMGGWLAEYGGWRLVFLLQVVAA 316
           ++SD+ P + R  +Q         IC++ G  +        W  + G W  +F +  +  
Sbjct: 190 VLSDLSPSKWRLLFQFATSWPCIIICWISGDIVQSANPAKNWRFDIGMWAFLFPISALPF 249

Query: 317 LISGCFI--QAFLILPKVHHGNGIALANKES-------LKTKLYMMDWLGTFCLVI---- 363
           +I   +   QA     K      I   NKE        +K+    +D +GT  + +    
Sbjct: 250 IIFLLYFTRQA----SKTAEWKEIQGDNKEPSVRIVYWIKSIYSNIDVVGTSLVTVSLGC 305

Query: 364 FLASLTLTCSLVDXXXXXXXXXXXXM-FVSGYYFVYHELNIAADPILSVHLLTDRNVLAS 422
            L  LTL   + D            + FVS  +F+  ++  A + +L   LL DR V AS
Sbjct: 306 ILVPLTLAGGISDDWNKPGIIATIVVGFVSFMFFLAWDIKFAKNAVLPFKLLKDRGVWAS 365

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 46/112 (41%), Gaps = 1/112 (0%)

Query: 198 LSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           L A     L    S++ GRK  L+ S   + +G ++C  A  V  + AGRF         
Sbjct: 142 LGAVAGSILLTPFSEMLGRKTSLVISCGFYTMGAIICAAALNVQTMYAGRFFIGVGVGLE 201

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE-YGGWRLV 308
                + I++ VP   R     L+     LG   G  +G    E +GGWR +
Sbjct: 202 GGGIGVYIAECVPSTVRGRLVSLYQFNIALGELFGYIVGVIFFEVHGGWRFM 253

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 63/133 (47%), Gaps = 17/133 (12%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L DI+GR+  L+ ++++F  G ++   +   W+  + GR VA      +  +  ++IS
Sbjct: 142 GRLGDIYGRRIGLIVASVIFIAGTIIQIASIKAWYQYMIGRIVAGLGCGLIAILSPMLIS 201

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG--------GWRLVFLLQVVAALI 318
           ++ P   R +       CY L ITLG  + G+   YG         WR+   LQ    L+
Sbjct: 202 EVSPKNMRGAMVS----CYQLMITLGIFL-GYCTNYGTKRYHDSTQWRVGLGLQFAWCLL 256

Query: 319 SGCFIQAFLILPK 331
               I A L +P+
Sbjct: 257 ---MIGAMLFVPE 266

>KLTH0E10406g Chr5 (938423..940624) [2202 bp, 733 aa] {ON} weakly
           similar to uniprot|Q12407 Saccharomyces cerevisiae
           YDL199C Hypothetical ORF
          Length = 733

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 61/130 (46%), Gaps = 11/130 (8%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           + G+L + +GR+  + + + +F LG L+  +A  +  L+ GR ++      L+++  I  
Sbjct: 181 MVGRLGEKWGRRRTIRYGSFVFILGGLIQTSATRMLHLIIGRVISGLGVGLLSTIVPIYQ 240

Query: 266 SDIVPLRSRASYQ------DLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALIS 319
           S+I P  +R          ++   C  + +  G S   ++     WRL   +Q V  L  
Sbjct: 241 SEISPPHNRGKLACIEFTGNIVGYCSSVWVDYGCS---YINNNAAWRLPLFIQCVMGL-- 295

Query: 320 GCFIQAFLIL 329
           G F+  F+I+
Sbjct: 296 GLFMGTFVIV 305

>SAKL0H05412g Chr8 (486897..488639) [1743 bp, 580 aa] {ON} similar
           to uniprot|Q12256 Saccharomyces cerevisiae YOR273C TPO4
           Polyamine transport protein
          Length = 580

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 66/147 (44%), Gaps = 13/147 (8%)

Query: 208 GKLSDIFGRKAILLFS---NLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSII 264
             LS++FGRK I + S   +++F +G  + G    V  +L  RF +        S+ S  
Sbjct: 97  APLSEVFGRKPIYVASLPLSMLFTMGVGLSGGKMRV--ILPLRFFSGVFASPALSVASGT 154

Query: 265 ISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQ 324
           I DI  +   +     F +   LG  +   M G+ A+  GWR    +Q    LI+G  I 
Sbjct: 155 IVDIWDMDEVSIAMAFFCLAPFLGPVISPVMAGFAAQSKGWRWPSWIQ----LIAGGIIL 210

Query: 325 AFLI-LPKVHHGNGIALANKESLKTKL 350
            F++ +P+ H      L  K + K KL
Sbjct: 211 PFIVFMPETHK---TVLLTKRAKKRKL 234

>TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {ON}
           Anc_5.395 YHR094C
          Length = 574

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 65/141 (46%), Gaps = 20/141 (14%)

Query: 200 ACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLT 258
            C F    G+L D++GR+  ++ ++++F +G ++   +   W+  + GR VA      + 
Sbjct: 133 GCFF---LGRLGDMYGRRMAIIIASIIFVVGTIIQIASVKAWYQYMIGRIVAGLGCGIIA 189

Query: 259 SMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG--------GWRLVFL 310
               ++IS++ P   R +       CY L IT+G  + G+ A YG         WR+   
Sbjct: 190 ISSPMLISEVSPKHLRGAMVS----CYQLMITMGIFL-GYCANYGTKKYDDSRQWRVPLG 244

Query: 311 LQVVAALISGCFIQAFLILPK 331
           LQ    L     + A L +P+
Sbjct: 245 LQFAWCLF---LVGAMLFVPE 262

>TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {ON}
           Anc_5.394 YHR092C
          Length = 574

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 62/133 (46%), Gaps = 17/133 (12%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L D++GR+  L+ ++++F +G ++   +   W+    GR VA      +  +  ++IS
Sbjct: 137 GRLGDMYGRRMGLIIASIIFIVGNVIEIASVEAWYQYFIGRIVAGVGMGVIAVLSPMLIS 196

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG--------GWRLVFLLQVVAALI 318
           ++ P   R +       CY L IT+G  + G+ A YG         WR+   LQ    L 
Sbjct: 197 EVSPKAMRGAMVS----CYQLMITMGIFL-GYCANYGTKTYDDSRQWRIPLGLQFAWCLF 251

Query: 319 SGCFIQAFLILPK 331
               +   L +P+
Sbjct: 252 ---MVAGMLFVPE 261

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 95/249 (38%), Gaps = 44/249 (17%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q +Y +LSD FGR  + L + + + +G ++   A  +    AG             + ++
Sbjct: 112 QVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTL 171

Query: 264 IISDIVPLRSR-----ASYQDLFNICYVLG--ITLGGSMGGWLAEYGGWRLVFLLQVVAA 316
           I+SD   L+ R     ASY     I ++ G  IT       W      W  ++ L  +  
Sbjct: 172 ILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSTLPI 231

Query: 317 LISGCFIQAFLILPKVHHGNGIA-------LANK-------ESLKTKLYMMDWLGTFCLV 362
           +        FLIL   +  +  A        A K       E+L    + +D +G     
Sbjct: 232 I--------FLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVG----- 278

Query: 363 IFLASLTLTCSLV------DXXXXXXXXXXXXMFVSG----YYFVYHELNIAADPILSVH 412
           I L +++L C LV      +              VSG    + F+Y E   A  P+L   
Sbjct: 279 ILLITVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLFFIFLYWEAKFAKSPLLPFK 338

Query: 413 LLTDRNVLA 421
           LL+DR + A
Sbjct: 339 LLSDRGIWA 347

>AFR602W Chr6 (1523461..1525137) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YNL318C (HXT14),
           YHR096C (HXT5) and YMR011W (HXT2)
          Length = 558

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 209 KLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIISD 267
           +L DI GRK  +L S L++ +G  V   +   W+    GR +A         +  + +S+
Sbjct: 159 RLGDIKGRKIAILTSLLVYAVGMFVQLGSGHFWYRYFIGRLIAGLAVGATMVLVPMFLSE 218

Query: 268 IVPLRSRASYQDLFNICYVLGITLG 292
           + P+R R +   L+ +   LGI LG
Sbjct: 219 LAPVRIRGAMIVLYQVVICLGIALG 243

>Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}
           similar to Ashbya gossypii AGL069C
          Length = 638

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 81/178 (45%), Gaps = 4/178 (2%)

Query: 170 TILSTLLDYIASEFEA-LPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFG 228
           ++L++    +++E +  L  IS++    +LS  +        + +FG++ + L   L+F 
Sbjct: 133 SMLASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFM 192

Query: 229 LGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLG 288
           +G + C  + +  WLL  R V+      + S+PS  I++I     RA    ++ +  + G
Sbjct: 193 IGSIGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTLLLLGG 252

Query: 289 ITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESL 346
             L   +G  + E+     +F +  + A     F+   L +P+    +   + NK SL
Sbjct: 253 KNLVPLLGSLVFEHLSTHWLFWILTIIA--GSNFVLHLLFVPETFW-DRTPVPNKRSL 307

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 51/245 (20%), Positives = 91/245 (37%), Gaps = 22/245 (8%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q  + +LSD+FGR  +L+ + + + +G ++   A  V    AG          +     +
Sbjct: 120 QVFFARLSDVFGRLTLLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGLVGVVLQVIL 179

Query: 264 IISDIVPLRSRASYQDLFNICYVLGITLGGS-------MGGWLAEYGGWRLVFLLQVVAA 316
           I+SD   LR R  Y  + +  +++ + + G+       +  W    G W  +F L  +  
Sbjct: 180 ILSDFSSLRWRLFYTFVPSWPFIINMWVSGNVVNAANPLENWSWSIGMWAFIFPLTCLP- 238

Query: 317 LISGCFIQAFLILPKVHHGNGIALANK--------ESLKTKLYMMDWLGTFCLVIFLASL 368
            +  C +       K      + L           ++L    + +D +G   L + L  +
Sbjct: 239 -LVCCILHMRYRASKTEAWRHLQLEKTYYQSHGLLQTLIQLFWKLDVVGVLLLTVTLGCI 297

Query: 369 TLTCSLVDXXXXXXXXXXXXM-FVSGYY----FVYHELNIAADPILSVHLLTDRNVLASS 423
            +  +L                FV G+     FV  E   A DPI    LL DR V ++ 
Sbjct: 298 LVPLTLAGGVSQKWNNPHVIAPFVLGFVLLPIFVVWESKWALDPIAPFELLKDRGVWSAL 357

Query: 424 LANFF 428
              F 
Sbjct: 358 TIQFL 362

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 63/278 (22%), Positives = 116/278 (41%), Gaps = 44/278 (15%)

Query: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229
           +I++ L D   SE  +    SW+ AS+ L +  F  + G+L DI+G K +LL   ++  +
Sbjct: 91  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 147

Query: 230 GCLVCG----TAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICY 285
             L+CG    +    +++++  F        L ++  II +  V      +++    I +
Sbjct: 148 WSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYV----GGTFRKNIVISF 203

Query: 286 V-----LGITLGGSMGGWLA--EYGGWRLVFLLQVVAALISGCFIQAFLILP-----KVH 333
           V     +G TLG    G +   +   W   F    +AA I+  F+ +   +P      +H
Sbjct: 204 VGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFIN--FVLSIYAIPSTIPTNIH 261

Query: 334 HGNGIALANKESLKTKLYMMDWLGTFCLVIFLASLTLTCSLVDXXXXXXXXXXXXMFVSG 393
           H                + MDW+G+   VI L  L    +               + +S 
Sbjct: 262 H----------------FSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISV 305

Query: 394 YY---FVYHELNIAADPILSVHLLTDRNVLASSLANFF 428
            +   F+ +E+  A  P+L   ++ DR+++   LA FF
Sbjct: 306 IFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFF 343

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 95/249 (38%), Gaps = 44/249 (17%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q +Y +LSD FGR  + L + + + +G ++   A  +    AG             + ++
Sbjct: 112 QVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTL 171

Query: 264 IISDIVPLRSR-----ASYQDLFNICYVLG--ITLGGSMGGWLAEYGGWRLVFLLQVVAA 316
           I+SD   L+ R     ASY     I ++ G  IT       W      W  ++ L  +  
Sbjct: 172 ILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSALPI 231

Query: 317 LISGCFIQAFLILPKVHHGNGIA-------LANK-------ESLKTKLYMMDWLGTFCLV 362
           +        FLIL   +  +  A        A K       E+L    + +D +G     
Sbjct: 232 I--------FLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVG----- 278

Query: 363 IFLASLTLTCSLV------DXXXXXXXXXXXXMFVSG----YYFVYHELNIAADPILSVH 412
           I L +++L C LV      +              VSG    + F+Y E   A  P+L   
Sbjct: 279 ILLITVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLFFIFLYWEAKFAKSPLLPFK 338

Query: 413 LLTDRNVLA 421
           LL+DR + A
Sbjct: 339 LLSDRGIWA 347

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 17/133 (12%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L D++GR+  ++ ++++F +G ++   +   W+  + GR VA      +     ++IS
Sbjct: 133 GRLGDMYGRRIAIIVASIIFIVGTVIQIASVKAWYQYMIGRIVAGLGCGIIAISSPMLIS 192

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG--------GWRLVFLLQVVAALI 318
           ++ P   R +       CY L IT+G  + G+ A YG         WR+   LQ    L 
Sbjct: 193 EVSPKHLRGAMVS----CYQLMITMGIFL-GYCANYGTKRYDDSTQWRVPLGLQFAWCLF 247

Query: 319 SGCFIQAFLILPK 331
               + A L +P+
Sbjct: 248 ---LVGAMLFVPE 257

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 54/129 (41%), Gaps = 6/129 (4%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGC--LVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           G L+D++GR+ I+L   L++ +    L C  +  V   L  R V       L ++ S ++
Sbjct: 154 GGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFL--RCVQSAGISPLIAISSGVV 211

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
            D      R S+    +   ++G   G  +G  L     WR +F    +      CF+  
Sbjct: 212 GDFTTKSERGSFVGAVSGFALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC--GTCFVIN 269

Query: 326 FLILPKVHH 334
           F +LP+   
Sbjct: 270 FFLLPETKR 278

>KNAG0I03080 Chr9 (617011..618789) [1779 bp, 592 aa] {ON} Anc_4.30
           YLL028W
          Length = 592

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 53/129 (41%), Gaps = 2/129 (1%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           +Y  LS+I+GRK +L+ +   F L      TA  +  +   RF          ++     
Sbjct: 207 IYAPLSEIYGRKGVLVIAAFGFALFQFAVATAENLQTIFICRFFGGLIGAAPMAVVPAAF 266

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           +D+     R     LF++   +G  L   MG ++A+   WR  +L  VV    S  F+  
Sbjct: 267 ADMFDTNMRGKAICLFSLGVFVGPILSPVMGSYIAQRTTWR--WLEYVVGCFASFNFLLL 324

Query: 326 FLILPKVHH 334
                + HH
Sbjct: 325 SYFYDETHH 333

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 58/136 (42%), Gaps = 9/136 (6%)

Query: 203 FQP-LYGKLSDIFGRKAILLFSNLMF---GLGCLVCGTAPTVWWLLAGRFVAXXXXXXLT 258
           F P + G L+DI+GR+ ++LF  L++    +G   C +   + +L   R +       L 
Sbjct: 149 FAPAVSGGLADIYGRRPVILFGMLVYVVASIGIAACNSYGVIIFL---RCLQSTGISPLI 205

Query: 259 SMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALI 318
           ++ S  + D      R ++    +   ++G   G  +G  LA    WR +F    +    
Sbjct: 206 AISSGAVGDFTVKAERGTFVGAVSGLVLMGQAFGSLIGAALAAAYNWRAIFWFLAIGC-- 263

Query: 319 SGCFIQAFLILPKVHH 334
             C   A ++LP+   
Sbjct: 264 GACMAIAGIVLPETKR 279

>TBLA0A03420 Chr1 (824716..826449) [1734 bp, 577 aa] {ON} 
          Length = 577

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 58/128 (45%), Gaps = 7/128 (5%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G++ D++GR+  ++F+  +F +G ++   +   W+  + GR VA         +  ++IS
Sbjct: 130 GRVGDLYGRRIGIVFATTIFIVGTIIQIASVKAWYQYMIGRIVAGVGCGLFPVLCPMLIS 189

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG---WRLVFLLQVVAALISGCFI 323
           ++ P   R +    + +   +GI LG         Y     WR+   LQ   AL     I
Sbjct: 190 EVSPKHLRGALVSCYQLMVTMGIFLGDCTNYGTKVYHDSRQWRIGLGLQFAWALF---LI 246

Query: 324 QAFLILPK 331
            A L +P+
Sbjct: 247 TAMLFVPE 254

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 62/297 (20%), Positives = 114/297 (38%), Gaps = 39/297 (13%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q +Y + SD+FGR ++ + S + + +G ++   A  V    AG F        +  +  +
Sbjct: 165 QIVYARASDVFGRLSLFIVSVVFYAVGTIIQCQAYDVQRYCAGSFFYNIGYVGVILVLLL 224

Query: 264 IISDIVPLRSRASYQDLFNICYVLGITLGGS-------MGGWLAEYGGWRLVFLLQVVAA 316
           I+SD   L+ R  YQ      Y++   + G+       +  W  + G W  +F L  +  
Sbjct: 225 ILSDFSSLKWRLFYQFAPTWPYIINTWISGNITSAANPLKHWSWDIGMWAFIFPLSSIPI 284

Query: 317 LISGCFIQAFLILPKVHHGNGIALANK--------ESLKTKLYMMDWLGTFCLVIFLASL 368
           ++  C I    +  K      +              ++    + +D +G     + L   
Sbjct: 285 IL--CLIHMRWMASKTKEWKLLKQEKSYIQQHTFVSAITDLFWRLDVIG-----VLLMGA 337

Query: 369 TLTCSLVDXXXXXXXXXXXXM------FVSGYY----FVYHELNIAADPILSVHLLTDRN 418
           +L C LV                    F  G+     F + E   +  P++   L+ DR 
Sbjct: 338 SLGCILVPLTLAGGTSSKWNHGNIIAPFALGFVLIPIFTFWEWKFSKSPLIPSKLVKDRA 397

Query: 419 VLASSLANFFCMLNDVLTIFYVPM-YFASVLYMGPKE-IGKRTIISFLGTSIGSFGT 473
           V +S   +F         IFY+ + Y  +VL +G  E +   T IS L + + + G+
Sbjct: 398 VWSSMAISFLIDF-----IFYMAVDYLYTVLIVGVNESVKSATRISSLSSFVSTVGS 449

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 51/112 (45%), Gaps = 1/112 (0%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           ++  +SD++GR+    FS  ++ +  + C  AP +  LLA RF+          +    I
Sbjct: 237 IWSPVSDLYGRQVAYFFSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSGLCLVGGSI 296

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLA-EYGGWRLVFLLQVVAA 316
           +D+ P  +R      F  C   G  LG  + G+++   G   L+F + +  A
Sbjct: 297 ADMFPSETRGKAIAFFAFCPYTGPVLGPVVNGFISVSTGRMDLIFWVNMAFA 348

>SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]
           {ON} weakly similar to uniprot|Q06451 Saccharomyces
           cerevisiae YPR156C TPO3 Polyamine transport protein
          Length = 621

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 58/133 (43%), Gaps = 10/133 (7%)

Query: 206 LYGKLSDIFGRKAIL---LFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPS 262
           ++  LS+ FGR  +    LF  ++F    + CG A  +  LLA RF+          +  
Sbjct: 194 VFAPLSEEFGRNWVYHPTLFVAIVF---IVPCGAAKNIGTLLAFRFLDGLAFSAPMCLIG 250

Query: 263 IIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCF 322
             +SD+   + R     +F+    +G  +G  +G  L+    WR V+   ++    S C 
Sbjct: 251 GSLSDMWRNKERGVAMSVFSAAPFMGPVMGPIVGSLLSVKCSWRWVYWFMLI---FSACL 307

Query: 323 IQAFLI-LPKVHH 334
               ++ LP+ HH
Sbjct: 308 YGVMVVFLPETHH 320

>TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 56/128 (43%), Gaps = 7/128 (5%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L DI+GR+  L+ +  +F +G ++   +   W+    GR +A      +  +  ++IS
Sbjct: 136 GRLGDIYGRRLGLIMATAIFVVGVVIEIASIDKWYQYFIGRIIAGIGMGVIAVLSPMLIS 195

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG---WRLVFLLQVVAALISGCFI 323
           ++ P   R +    + +   +GI LG         Y     WR+   LQ    L   C +
Sbjct: 196 EVSPKDMRGAMVSCYQLMITMGIFLGDCCNYGTKTYSDSTQWRVGLGLQFAWCL---CMV 252

Query: 324 QAFLILPK 331
              + +P+
Sbjct: 253 GGMMFVPE 260

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 62/149 (41%), Gaps = 7/149 (4%)

Query: 189 ISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCG---TAPTVWWLLA 245
           +SW A+++ L+   F  + G+L D FG K   +   L + L  ++ G    +  +++   
Sbjct: 69  LSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYSNQIFFDCC 128

Query: 246 GRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGW 305
             F        L +  +II     P R +     LF  C   G  +G      L+E+  W
Sbjct: 129 RAFQGIGPAFTLPNAIAIIARTYRPGRKQNMIFSLFGACAPSGFVVGAVFSSLLSEFAWW 188

Query: 306 RLVFLLQVVAALISGCFIQAFLILPKVHH 334
              + +  +   + G  +  +L++P  HH
Sbjct: 189 PWAYWIMGITCFLLG--VAGYLVIP--HH 213

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 1/123 (0%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           L+  +SD++GRK    FS  ++ +  + C  AP +  LLA RF+          +    I
Sbjct: 233 LWSPVSDLYGRKVAYFFSMGLYTIFNIPCALAPNLGCLLACRFICGIFASSGLCLVGGSI 292

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGCFIQA 325
           +D+ P  SR      F      G  +G  + G+++   G R+  +  V  A     +I A
Sbjct: 293 ADMFPSNSRGKAIAFFAWAPYAGPCIGPLVNGFISVSTG-RMDLIFWVNMAFCGTMWIVA 351

Query: 326 FLI 328
            LI
Sbjct: 352 SLI 354

>TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 17/133 (12%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L D++GR+  ++ ++++F +G ++   +   W+  + GR VA      +     ++IS
Sbjct: 67  GRLGDMYGRRIAIIVASIIFVVGTVIQIASVKAWYQYMIGRIVAGLGCGIIAISSPMLIS 126

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG--------GWRLVFLLQVVAALI 318
           ++ P   R +       CY L IT+G  + G+ A YG         WR+   LQ    L 
Sbjct: 127 EVSPKHLRGAMVS----CYQLMITMGIFL-GYCANYGTKRYDDSTQWRVPLGLQFAWCLF 181

Query: 319 SGCFIQAFLILPK 331
               + A L +P+
Sbjct: 182 ---LVGAMLFVPE 191

>KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weakly
           similar to uniprot|P42833 Saccharomyces cerevisiae
           YNL318C, HXT14 protein with similarity to hexose
           transporter family members, expression is induced in low
           glucose and repressed in high glucose; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studie
          Length = 528

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 209 KLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIISD 267
           K++DI GRK  +  +  ++ LG L+  T  + WW     RF++         M  + I++
Sbjct: 129 KIADINGRKPGIYAAITIYSLGTLIGWTCGSSWWYFFFARFISGLGVGATAVMIPMFIAE 188

Query: 268 IVPLRSRASYQDLFNICYVLGITLG 292
             P+  R +   L+ +   LGI LG
Sbjct: 189 SAPINIRGAMVVLYQLMITLGILLG 213

>SAKL0E06864g Chr5 (563946..565667) [1722 bp, 573 aa] {ON} similar
           to uniprot|Q9HFF8 Saccharomyces carlsbergensis FSY1
           Fructose symporter
          Length = 573

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 59/134 (44%), Gaps = 13/134 (9%)

Query: 210 LSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIV 269
           L++ FGRKA ++ S + + +G ++C  +     + AGRF+             I IS+ V
Sbjct: 163 LNEWFGRKASIIISCVWYTVGAILCAASHDHHLMYAGRFMLGVGVGIEGGCVGIYISESV 222

Query: 270 PLRSRASYQDLFNICYVLGITLGGSMGGWLAEY-GGWRLVFLLQVV--AALISGCFIQAF 326
           P   R +   L+     LG   G  +G    +  GGWR +    +V   AL+ G F    
Sbjct: 223 PSSVRGNLVSLYQFNIALGELFGYIIGVIFFDVKGGWRFMVGSSLVFSTALLIGLF---- 278

Query: 327 LILPK-----VHHG 335
             LP+     VH G
Sbjct: 279 -FLPESPRWLVHKG 291

>KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {ON}
           conserved hypothetical protein
          Length = 572

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 1/100 (1%)

Query: 210 LSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIV 269
           L++ FGRK+ ++ S + + +G ++C  + +   + AGRF+             I +S+ V
Sbjct: 159 LNEWFGRKSSIMISCIWYTVGAILCAASTSHHLMYAGRFILGVGVGIEGGCVGIYVSESV 218

Query: 270 PLRSRASYQDLFNICYVLGITLGGSMGG-WLAEYGGWRLV 308
           P   R +   ++     LG   G  +G  +   +GGWR +
Sbjct: 219 PSTVRGNLVSMYQFNIALGELFGYIVGVIFFDVHGGWRFM 258

>KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 5/102 (4%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLA-GRFVA 250
           + + + L   I   L+ KL D +GR+  L+   L++ +G ++C +A + W+  A GR  A
Sbjct: 107 VVSIFCLGCAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVICISANSKWYQYAIGRVFA 166

Query: 251 XXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLG 292
                 +     ++IS+  P   R +       CY L IT G
Sbjct: 167 GLGVGGIAVYSPLLISEASPKHLRGTLVS----CYQLMITAG 204

>TDEL0A00150 Chr1 (24714..26414) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 56/135 (41%), Gaps = 3/135 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           +AA YL +A    PL   LS   GRK ++L S  +   G L+ G A  +  +L  R    
Sbjct: 143 VAAPYLAAAVFGAPLTVFLSSHIGRKWVVLISCFIAFAGSLIQGFANGLPAMLFARLFMG 202

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG---WRLV 308
                 +S   I  ++  P  SR +   L+     LG+ LG        +  G   WRL+
Sbjct: 203 IGMGLNSSTVPIYTAECSPAVSRGAILMLWQTFIALGVALGSIFNRAFVQINGSLSWRLM 262

Query: 309 FLLQVVAALISGCFI 323
                V  LI+G  I
Sbjct: 263 IGSASVPPLITGFLI 277

>TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}
          Length = 574

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 55/119 (46%), Gaps = 14/119 (11%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G+L DI+GR+  L+ + ++F +G ++   +   W+    GR +A      +  +  ++IS
Sbjct: 137 GRLGDIYGRRLGLIMATVIFVVGVVIEIASIDKWYQYFIGRIIAGIGMGVIAVLSPMLIS 196

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG--------WRLVFLLQVVAAL 317
           ++ P   R +       CY L IT+G  +G    EYG         WR+   LQ    L
Sbjct: 197 EVSPKDMRGAMVS----CYQLMITMGIFLGD-CTEYGSKTYSDSTQWRVGLGLQFAWCL 250

>ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]
           {ON} similar to uniprot|P38142 Saccharomyces cerevisiae
           YBR241C Hypothetical ORF
          Length = 488

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 55/112 (49%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISD 267
           G L+D+FGRK   L ++++   G LV   + +   LL GR +          + S+ I++
Sbjct: 105 GPLADMFGRKKASLIASVLGLFGSLVLFGSNSYAALLVGRVIVGLASGVYVVITSLFINE 164

Query: 268 IVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALIS 319
           I P+  + ++  +  +    GI L  ++   LA+   WR +     +A++I+
Sbjct: 165 ICPIELKGAFGSMNQLSINSGILLTQTLALKLADTYRWRWLMFAAGIASVIN 216

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 57/139 (41%), Gaps = 2/139 (1%)

Query: 196 YLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXX 255
           YLL   +     G L+D FGR+ +LL   L++ +  +    AP+   ++  R V      
Sbjct: 144 YLLFQGLAPTCSGGLADKFGRRPVLLIGMLIYVVASIGLACAPSYGVIVFLRCVQSIGIS 203

Query: 256 XLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVA 315
              ++ S ++ D      R ++    +   +LG   G  +G  LA    WR +F    + 
Sbjct: 204 PSIAISSGVVGDFTVKSERGTFVGATSGFVLLGQAFGSLIGAALAAAWDWRAIFWFLTIG 263

Query: 316 ALISGCFIQAFLILPKVHH 334
              S  F   F +LP+   
Sbjct: 264 CGAS--FAICFALLPETKR 280

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 39.3 bits (90), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 98/246 (39%), Gaps = 36/246 (14%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q +Y +LSD+FGR  + + + +++ +G ++   A  V    AG          +  +  I
Sbjct: 132 QIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGSIFYNAGYVGVILILLI 191

Query: 264 IISDIVPLRSRASYQDLFNICYVLGITLGGSMG-------GWLAEYGGWRLVFLLQVVAA 316
           I+SD   L+ R  YQ      +++   + G++         W  + G W  +F L  +  
Sbjct: 192 ILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSKANPVENWSWDIGMWAFIFPLSCIPI 251

Query: 317 LISGCFIQAFLILPKVHHGNGIALANKES----------LKTKLYMMDWLGTFCLVIFLA 366
           ++  C +    I  K    +  AL +++S          L+   + +D +G     + L 
Sbjct: 252 VL--CMLHMQWIARKTPEWH--ALKDEKSYYQEHGFVKVLEQLFWKLDVIG-----VLLM 302

Query: 367 SLTLTCSLVDXXXXXXXXXXXX------MFVSGYYFV----YHELNIAADPILSVHLLTD 416
             +L C LV                    FV G+  +      E  +A DPI+   L+ D
Sbjct: 303 GCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPILWVWEYRVARDPIIPYKLVKD 362

Query: 417 RNVLAS 422
           R V +S
Sbjct: 363 RGVWSS 368

>KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 5/102 (4%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLA-GRFVA 250
           + + + L   I   L+ KL D +GR+  L+   L++ +G ++C +A + W+  A GR  A
Sbjct: 110 VVSIFCLGCAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVICISANSKWYQYAIGRVFA 169

Query: 251 XXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLG 292
                 +     ++IS+  P   R +       CY L IT G
Sbjct: 170 GLGVGGIAVYSPLLISEASPKHLRGTLVS----CYQLMITAG 207

>KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {ON} 
          Length = 549

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 5/102 (4%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLA-GRFVA 250
           + + + L   I   L+ KL D +GR+  L+   L++ +G ++C +A + W+  A GR  A
Sbjct: 108 VVSIFCLGCAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVICISANSKWYQYAIGRVFA 167

Query: 251 XXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLG 292
                 +     ++IS+  P   R +       CY L IT G
Sbjct: 168 GLGVGGIAVYSPLLISEASPKHLRGTLVS----CYQLMITAG 205

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 55/250 (22%), Positives = 99/250 (39%), Gaps = 29/250 (11%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q +Y +L+D FGR ++ + + + + +G ++   A  V    AG          +  +  +
Sbjct: 115 QLVYARLADTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNIGYVGVILVLLL 174

Query: 264 IISDIVPLRSRASYQDLFNICYVLGITLGGSM-------GGWLAEYGGWRLVFLLQVVAA 316
           ++SD   LR R  Y  +    +++   + G++         W  + G W  +F L  V  
Sbjct: 175 MLSDFSSLRWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGMWAFIFPLSCVPL 234

Query: 317 LISGCFIQAFLILPKVHHGNGIALANKES----------LKTKLYMMDWLGTFCLVIFLA 366
           +   C I   +   K      IAL  ++S          L    + +D +G   L+  L 
Sbjct: 235 I--ACMIHMRIKARKTPE--WIALKQEKSYFQTNGLWDTLVELFWKLDVVGVLLLIATLG 290

Query: 367 SLTLTCSLVDXXXXXXXX-XXXXMFVSGYYFV----YHELNIAADPILSVHLLTDRNV-- 419
            + +  +L                FV G+  V    + E+  A DP++   L+ DR V  
Sbjct: 291 CILVPLTLAGGYNSKWNNPHIIGPFVLGFVLVPILMFWEMRWARDPLVPYGLIKDRGVWS 350

Query: 420 -LASSLANFF 428
            LA S  N+F
Sbjct: 351 ALAISFLNYF 360

>NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 44/88 (50%), Gaps = 1/88 (1%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSII 264
           L+ +L DI+GR+  L+F  +++ +G ++   +   W+    GR ++      +     ++
Sbjct: 136 LFSRLGDIYGRRKALVFVTVVYMVGLIISIASIDKWYQYFIGRIISGMGVGGIAVYSPLL 195

Query: 265 ISDIVPLRSRASYQDLFNICYVLGITLG 292
           IS++ P   R +    + +   LGI LG
Sbjct: 196 ISEVSPKHVRGTLVSCYQLMITLGIFLG 223

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 95/242 (39%), Gaps = 28/242 (11%)

Query: 204 QPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSI 263
           Q +Y +LSD+FGR  + + + +++ +G ++   A  V    AG          +  +  I
Sbjct: 127 QIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLI 186

Query: 264 IISDIVPLRSRASYQDLFNICYVLGITLGGSMG-------GWLAEYGGWRLVFLLQVVAA 316
           I+SD   L+ R  YQ      +++   + G++         W  + G W  +F L  +  
Sbjct: 187 ILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCIPI 246

Query: 317 LISGCFIQAFL-ILPKVHHGNGIALANKES-----LKTKLYMMDWLGTFCLVIFLASLTL 370
           ++    +Q      P+ H   G     +E      +K   +M+D +G     + L   +L
Sbjct: 247 VLCMLHMQWRAKKTPEWHTLKGQKSYYQEHGFIKIIKQLFWMLDIIG-----VLLMGCSL 301

Query: 371 TCSLVDXXXXXXXXXXXX------MFVSGYYFV----YHELNIAADPILSVHLLTDRNVL 420
            C LV                    FV G+  +      E   A DPIL   L+ DR V 
Sbjct: 302 GCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPVLWIWEYRFARDPILPYKLVKDRAVW 361

Query: 421 AS 422
           +S
Sbjct: 362 SS 363

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 64/140 (45%), Gaps = 23/140 (16%)

Query: 198 LSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXL 257
           + A +   L G+L + +GR+  + + +L+F +G L  G A  +  L+ GR ++      L
Sbjct: 156 IGALVSSLLVGRLGEKWGRRRTIKYGSLIFVIGGLFQGFADKMMHLIIGRTISGLGVGLL 215

Query: 258 TSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLA----EYG--------GW 305
           +++  I  S+I P  +R         C    I   G++ G+ A    +YG         W
Sbjct: 216 STIVPIYQSEISPPHNRGKLA-----C----IEFTGNIVGYAASVWIDYGCSFIEGNASW 266

Query: 306 RLVFLLQVVA--ALISGCFI 323
           R+  LLQ V   AL  G F+
Sbjct: 267 RIPLLLQSVIGFALFCGTFV 286

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (44%)

Query: 171 ILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLG 230
           I  ++  Y A+ F+  P I  I     + A      Y +LSD FGR    +F+ +++ +G
Sbjct: 81  ISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYARLSDRFGRIECWIFALVLYTVG 140

Query: 231 CLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGIT 290
            ++    PT   L AG  +          + + + +DI  LR R    ++F I  ++   
Sbjct: 141 DIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADISGLRDRTFAMNIFLIPVIINTW 200

Query: 291 LGGSM 295
           + G++
Sbjct: 201 VSGNI 205

>TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 58/133 (43%), Gaps = 17/133 (12%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSIIIS 266
           G + DI+GR+  L+ + ++F  G ++   +   W+    GR ++      +  +  ++IS
Sbjct: 134 GNIGDIYGRRLGLIIATIIFVAGVVIEIASIDKWYQYFIGRIISGVGMGVVVILSPMLIS 193

Query: 267 DIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYG--------GWRLVFLLQVVAALI 318
           ++ P   R +    F +   LG+ LG        EYG         WR+   LQ   +L 
Sbjct: 194 EVSPKELRGAMVSSFQLMITLGMFLGDC-----TEYGTKKYSNSTQWRVGLGLQFAWSL- 247

Query: 319 SGCFIQAFLILPK 331
             C +   L +P+
Sbjct: 248 --CMVGGMLFVPE 258

>NCAS0I03160 Chr9 (587668..589395) [1728 bp, 575 aa] {ON} 
          Length = 575

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWW-LLAGRFVAXXXXXXLTSMPSII 264
           L+ +L D++GR+  L+F   ++ +G ++   A   W+    GR ++      +     ++
Sbjct: 137 LWSRLGDMWGRRKALVFVTTVYMIGLIISIAAVKHWYQYFIGRIISGLGVGGIAVYSPLL 196

Query: 265 ISDIVPLRSRASYQDLFNICYVLGITLG 292
           IS++ P   R +    + +   LGI LG
Sbjct: 197 ISEVAPKHVRGTLVSCYQLMITLGIFLG 224

>TBLA0H00750 Chr8 (171288..172742) [1455 bp, 484 aa] {ON} Anc_2.241
           YIL121W
          Length = 484

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 45/102 (44%)

Query: 208 GKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIIISD 267
           G L+D  GR+ I++ +  ++   C+          L+  R +       + +M S I+ D
Sbjct: 58  GNLADSMGRRPIVIIAVTLYFCACVGLSCCNNYAQLVGLRCLQAAGISPVIAMNSGIMGD 117

Query: 268 IVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVF 309
           +     RA Y    +   ++G  LG  +G  L+   GWR +F
Sbjct: 118 VTTRAERAGYVGYVSGFQIIGTALGALIGARLSSRWGWRGIF 159

>NCAS0H01230 Chr8 (233917..235386) [1470 bp, 489 aa] {ON} Anc_6.155
          Length = 489

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 62/131 (47%), Gaps = 3/131 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           I AS+ +   +   + GKL++ +GRK + + + L+  LG  +   + +V  ++ GR +  
Sbjct: 87  ITASFSIGGLVGSFVAGKLAEKYGRKYVSVVNCLIAFLGSFIMFFSNSVLPMILGRTIVG 146

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLA---EYGGWRLV 308
                   + S+ I+D+ P+  R S   +  +   LGI L    G       + G WR V
Sbjct: 147 IAAGVSVVVTSLFINDVAPVDWRGSLGTMNQLSINLGILLTQFAGLKFVRNEDDGKWRWV 206

Query: 309 FLLQVVAALIS 319
             + +V A+++
Sbjct: 207 MFIGMVLAILN 217

>TDEL0E04480 Chr5 complement(836068..837918) [1851 bp, 616 aa] {ON} 
          Length = 616

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 56/130 (43%), Gaps = 4/130 (3%)

Query: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTSMPSIII 265
           L+  LS+ FGR  +   + L+  +  + C  A  +  LLA RF+          +    +
Sbjct: 197 LFAPLSEEFGRNWVYHTTLLVAVVFIVPCAVAKNIGTLLAFRFLDGLAFSAPMCLIGGSL 256

Query: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRLVFLLQVVAALISGC-FIQ 324
           SD+     R     +F+    +G  +G  +G  L+    WR  +   ++    SGC +I 
Sbjct: 257 SDMWRNEERGVAMSVFSAAPFIGPVMGPIIGSLLSVKINWRWPYYFMII---FSGCLYII 313

Query: 325 AFLILPKVHH 334
             + LP+ HH
Sbjct: 314 MVIFLPETHH 323

>SAKL0B00264g Chr2 (22039..23598) [1560 bp, 519 aa] {ON} similar to
           uniprot|Q12300 Saccharomyces cerevisiae YDL138W RGT2
           Plasma membrane glucose receptor, highly similar to
           Snf3p; both Rgt2p and Snf3p serve as transmembrane
           glucose sensors generating an intracellular signal that
           induces expression of glucose transporter (HXT) genes
          Length = 519

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 62/139 (44%), Gaps = 17/139 (12%)

Query: 200 ACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAXXXXXXLTS 259
             I  PL    SD  GR+  LL +  +F  G ++   A T   L+AGR +A      L++
Sbjct: 80  GAILAPL---ASDTIGRRLGLLVACAIFSAGAILQTAATTQALLIAGRVIAGAGVGVLSA 136

Query: 260 MPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAE-------YGGWRLVFLLQ 312
           +  +  S+  P   R +       CY   IT+G  +   + +        G +R+ F LQ
Sbjct: 137 IVPLYQSETTPKWIRGAVVS----CYQWAITIGLLLAACVNQGTHNRNDSGSYRIPFGLQ 192

Query: 313 VVAALISGCFIQAFLILPK 331
           ++ ALI    +   LILP+
Sbjct: 193 LLWALI---MVIGLLILPE 208

>ZYRO0D17864g Chr4 (1481311..1483047) [1737 bp, 578 aa] {ON} some
           similarities with uniprot|Q12300 Saccharomyces
           cerevisiae YDL138W RGT2 Plasma membrane glucose receptor
          Length = 578

 Score = 38.5 bits (88), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 58/135 (42%), Gaps = 3/135 (2%)

Query: 192 IAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAX 251
           +A+ YL +A    PL    +  FGRK ++  S L    G L+   A  +  LL  R +  
Sbjct: 150 VASPYLTAAIFGSPLAVLFNKYFGRKWVVFVSCLFGVAGSLIQAFANHLGVLLFARLLLG 209

Query: 252 XXXXXLTSMPSIIISDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGG---WRLV 308
                 +++  I  ++  P  SR +   L+ +   LG+ LG        +  G   WRL+
Sbjct: 210 VGMGLNSAVVPIYTAECSPAVSRGAILMLWQMFIALGVCLGSVFNRAFIKIPGSASWRLM 269

Query: 309 FLLQVVAALISGCFI 323
               VV  L++G  I
Sbjct: 270 IGSSVVPPLVTGILI 284

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,160,983
Number of extensions: 2263060
Number of successful extensions: 8913
Number of sequences better than 10.0: 641
Number of HSP's gapped: 9057
Number of HSP's successfully gapped: 650
Length of query: 678
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 562
Effective length of database: 40,180,143
Effective search space: 22581240366
Effective search space used: 22581240366
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)