Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_42828.286ON34034016540.0
AGR065W8.286ON3263357153e-92
KLTH0G13112g8.286ON3493537025e-90
KLLA0F19690g8.286ON3243356832e-87
SAKL0H16434g8.286ON5552726812e-84
NDAI0J010008.286ON3393286407e-81
ZYRO0D06600g8.286ON3303426399e-81
TDEL0F041308.286ON3283416362e-80
Skud_4.3878.286ON3363346251e-78
TBLA0D040408.286ON3293456181e-77
Kwal_56.236978.286ON3383166163e-77
KAFR0B053708.286ON3293426128e-77
TPHA0C010708.286ON3333306015e-75
YDR126W (SWF1)8.286ON3363345972e-74
NCAS0B035908.286ON3293355921e-73
Smik_4.3728.286ON3353205782e-71
Kpol_1033.168.286ON3213415632e-69
CAGL0B01991g8.286ON3303285581e-68
Suva_2.2898.286ON3353195563e-68
KNAG0H031108.286ON3313455311e-64
TDEL0F051308.389ON3591131964e-16
TPHA0C023608.389ON4041951957e-16
Smik_12.3068.389ON3591681893e-15
YLR246W (ERF2)8.389ON3592251894e-15
TBLA0H009208.389ON3601221875e-15
KAFR0H019808.389ON3611071876e-15
Suva_10.3428.389ON3561351876e-15
Skud_12.3218.389ON3561341867e-15
ZYRO0C04092g8.389ON3661271868e-15
Kwal_23.33028.389ON3531071859e-15
NCAS0C029208.389ON374511832e-14
CAGL0G08217g8.389ON326941813e-14
SAKL0H13860g8.389ON3521431823e-14
NDAI0G022508.389ON389501805e-14
CAGL0E02497g6.28ON3762351806e-14
KLTH0F08668g8.389ON3581351781e-13
KLLA0D18370g8.389ON3551371752e-13
Ecym_41788.389ON3681351734e-13
KNAG0A027108.389ON354991682e-12
TPHA0P015603.12ON331541653e-12
NDAI0C026506.28ON3892321664e-12
AGL125C8.389ON367511654e-12
TPHA0J003906.28ON3801261654e-12
ZYRO0C07546g6.28ON3771081637e-12
KNAG0F029306.28ON3861441639e-12
TBLA0H001503.12ON345521592e-11
Smik_15.1676.28ON378491575e-11
NCAS0D021406.28ON3761081575e-11
TDEL0A003103.12ON329501556e-11
TDEL0G044106.28ON3811261541e-10
Kpol_1014.293.12ON326731531e-10
NCAS0E013003.12ON3271341531e-10
YOL003C (PFA4)6.28ON3781151531e-10
NDAI0G013403.12ON3351451522e-10
SAKL0C13596g3.12ON333501522e-10
KLTH0F19580g3.12ON3421281522e-10
KNAG0K025703.12ON328501503e-10
KLTH0C10978g6.28ON3772281495e-10
Suva_15.1726.28ON3981401495e-10
Kwal_56.224596.28ON383501495e-10
KAFR0A051306.28ON396491495e-10
Ecym_30326.28ON3772261486e-10
Skud_15.1596.28ON379491477e-10
KLLA0C06204g6.28ON377491478e-10
KAFR0A085903.12ON331501469e-10
ZYRO0C03410g3.12ON327501461e-09
Ecym_20143.12ON3391231461e-09
KLLA0E02069g3.12ON3251451451e-09
Kpol_1037.236.28ON3781551461e-09
SAKL0E01518g6.28ON3791351415e-09
Smik_14.63.12ON3341421406e-09
Kwal_55.221263.12ON3601311397e-09
ADL197C3.12ON390491391e-08
CAGL0D02508g3.12ON332661381e-08
Skud_14.153.12ON3361421343e-08
YNL326C (PFA3)3.12ON3361421343e-08
Suva_14.153.12ON3301051282e-07
ACL003C6.28ON3751391246e-07
TBLA0B004806.28ON377501211e-06
CAGL0K06347g5.579ON3521501211e-06
KAFR0I011105.579ON370491158e-06
Kpol_1004.575.579ON3621131131e-05
KNAG0C028305.579ON3541271132e-05
Kwal_47.183665.579ON3561021122e-05
YDR459C (PFA5)5.579ON374881113e-05
KLTH0G04972g5.579ON3671011104e-05
Ecym_41145.579ON372951087e-05
TBLA0E028305.579ON3861051087e-05
Smik_4.7375.579ON378491061e-04
TDEL0A044405.579ON365941061e-04
NCAS0F013905.579ON374441033e-04
KLLA0D06149g5.579ON349931014e-04
Skud_4.7345.579ON380501014e-04
Suva_2.6345.579ON388501006e-04
ABR203W5.579ON35949997e-04
SAKL0G06160g5.579ON36447980.001
NDAI0H008505.626ON786155910.009
Kpol_526.325.626ON77755910.011
CAGL0M08712g5.626ON763149910.011
NDAI0H018905.579ON40646890.014
ZYRO0D13860g5.579ON36546870.025
Suva_2.4325.626ON76358860.036
Smik_4.5155.626ON76450860.037
TDEL0A049205.626ON75048860.038
KAFR0H005705.626ON75750850.060
SAKL0G07326g5.626ON73749840.075
Smik_15.2135.626ON74450830.085
YOR034C (AKR2)5.626ON74950830.099
Suva_8.875.626ON73053830.10
KLTH0E02420g5.626ON73456820.12
Skud_4.5275.626ON76448820.14
Skud_15.1995.626ON74156810.17
ZYRO0C11132g5.626ON75955810.17
TPHA0C003705.626ON75950790.25
YDR264C (AKR1)5.626ON76448790.26
NDAI0C060308.218ON57369780.33
KNAG0C062305.626ON75244760.63
NCAS0C052805.626ON75749760.74
KLLA0E16721g5.626ON75239741.1
TBLA0J008305.626ON73948741.1
SAKL0C05918g1.199ON87542741.3
NCAS0A037508.218ON57969712.5
TPHA0B035108.218ON56532712.6
Kpol_1055.418.218ON57332702.9
KNAG0B031405.626ON68255694.7
Ecym_13305.626ON73941685.7
NDAI0I007406.279ON103323685.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4282
         (340 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...   641   0.0  
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...   280   3e-92
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...   275   5e-90
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...   267   2e-87
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...   266   2e-84
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....   251   7e-81
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...   250   9e-81
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...   249   2e-80
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...   245   1e-78
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...   242   1e-77
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...   241   3e-77
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...   240   8e-77
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...   236   5e-75
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...   234   2e-74
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}     232   1e-73
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...   227   2e-71
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....   221   2e-69
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...   219   1e-68
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...   218   3e-68
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...   209   1e-64
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    80   4e-16
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    80   7e-16
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    77   3e-15
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    77   4e-15
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    77   5e-15
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    77   6e-15
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    77   6e-15
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    76   7e-15
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    76   8e-15
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    76   9e-15
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     75   2e-14
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    74   3e-14
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    75   3e-14
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     74   5e-14
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...    74   6e-14
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    73   1e-13
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    72   2e-13
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    71   4e-13
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    69   2e-12
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    68   3e-12
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28      69   4e-12
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    68   4e-12
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...    68   4e-12
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...    67   7e-12
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...    67   9e-12
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    66   2e-11
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...    65   5e-11
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...    65   5e-11
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    64   6e-11
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...    64   1e-10
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    64   1e-10
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    64   1e-10
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...    64   1e-10
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      63   2e-10
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    63   2e-10
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    63   2e-10
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    62   3e-10
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...    62   5e-10
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...    62   5e-10
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...    62   5e-10
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...    62   5e-10
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...    62   6e-10
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...    61   7e-10
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...    61   8e-10
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    61   9e-10
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    61   1e-09
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    61   1e-09
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    60   1e-09
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...    61   1e-09
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...    59   5e-09
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    59   6e-09
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    58   7e-09
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    58   1e-08
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    58   1e-08
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    56   3e-08
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    56   3e-08
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    54   2e-07
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...    52   6e-07
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...    51   1e-06
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    51   1e-06
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    49   8e-06
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    48   1e-05
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    48   2e-05
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    48   2e-05
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    47   3e-05
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    47   4e-05
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    46   7e-05
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    46   7e-05
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    45   1e-04
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    45   1e-04
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    44   3e-04
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    44   4e-04
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    44   4e-04
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    43   6e-04
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    43   7e-04
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    42   0.001
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    40   0.009
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    40   0.011
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    40   0.011
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    39   0.014
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    38   0.025
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    38   0.036
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    38   0.037
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    38   0.038
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    37   0.060
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    37   0.075
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    37   0.085
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    37   0.099
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    37   0.10 
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    36   0.12 
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    36   0.14 
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    36   0.17 
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    36   0.17 
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    35   0.25 
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    35   0.26 
NDAI0C06030 Chr3 complement(1385827..1387548) [1722 bp, 573 aa] ...    35   0.33 
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    34   0.63 
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    34   0.74 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    33   1.1  
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    33   1.1  
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    33   1.3  
NCAS0A03750 Chr1 (756284..758023) [1740 bp, 579 aa] {ON} Anc_8.218     32   2.5  
TPHA0B03510 Chr2 (816477..818174) [1698 bp, 565 aa] {ON} Anc_8.218     32   2.6  
Kpol_1055.41 s1055 complement(106667..108388) [1722 bp, 573 aa] ...    32   2.9  
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    31   4.7  
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    31   5.7  
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    31   5.9  

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/340 (95%), Positives = 324/340 (95%)

Query: 1   MSMLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYT 60
           MSMLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYT
Sbjct: 1   MSMLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYT 60

Query: 61  GIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEI 120
           GIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEI
Sbjct: 61  GIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEI 120

Query: 121 PFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL 180
           PFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL
Sbjct: 121 PFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL 180

Query: 181 LSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTT 240
           LSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTT
Sbjct: 181 LSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTT 240

Query: 241 NEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTNPY 300
           NEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIKN                YQYEYYSTNPY
Sbjct: 241 NEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIKNSPTPSSHTSTSTRTTHYQYEYYSTNPY 300

Query: 301 DPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRCVL 340
           DPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRCVL
Sbjct: 301 DPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRCVL 340

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score =  280 bits (715), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 145/335 (43%), Positives = 206/335 (61%), Gaps = 24/335 (7%)

Query: 3   MLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGI 62
           M+  L  LA+ Q  L+L +P  +++ PF WYY  VFR + +  + ++WKYW  PAFY G+
Sbjct: 1   MMGALCALAVTQAGLILAAPALRAYWPFSWYYHVVFRTVLQDTQRHRWKYWATPAFYAGV 60

Query: 63  YIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEIPF 122
           Y YC ++FY  VY EI   L+  E   LP  +  P  +G     T              +
Sbjct: 61  YAYCVWLFYGEVYAEIAKALWVPERWVLPAAVVAPAAAGVAAAATPAAVPADAA-----Y 115

Query: 123 DGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           DG++FHD + CR+CR++K ARS+HC +CGRC+ +ADHHCVWLNNC+G GNY  FYL L +
Sbjct: 116 DGLLFHDGVECRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLFYLALGA 175

Query: 183 NCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNE 242
           +C++L+Y  +RL   AP+G W   ++ L+L +LV  FAV+ + FT  Q ALVRDGMTTNE
Sbjct: 176 HCALLTYGAVRLPLAAPAGRW--PRALLALELLVASFAVLCVWFTATQVALVRDGMTTNE 233

Query: 243 KDKWYTIHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTNPYDP 302
           +DKWY + + MR   L++L    +FY R++                    E+YSTN YD 
Sbjct: 234 QDKWYAVQESMREGTLVRLRG--RFYHRVEGGDGV---------------EFYSTNAYDH 276

Query: 303 KTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQR 337
           +TY+L +  Y VV S+++IPN+YD  SF +NL+QR
Sbjct: 277 RTYALHNEPYAVVTSHEEIPNVYDTGSFCENLRQR 311

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score =  275 bits (702), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 148/353 (41%), Positives = 205/353 (58%), Gaps = 24/353 (6%)

Query: 1   MSMLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYT 60
           M M + +W+L + Q+VL L SPLF++   FRWYY  VF P+F     ++WK+  +PAFY 
Sbjct: 1   MKMGLFIWILIIPQLVLSLFSPLFRTKPVFRWYYTRVFHPIFEDVNRFRWKFRAIPAFYL 60

Query: 61  GIYIYCSFVFYVHVYGEIRSGLYTLEAR-CLPVVLALPLLSGYYTIVTSPHDTITYVGPE 119
            IY YC+F+F+  + G IRS L+ +E    +PV L+ P+++G  TI   P  T  Y  P 
Sbjct: 61  SIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTIWIKPKST--YASPM 118

Query: 120 I-PFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYL 178
           +  +D +IFH  + CR+C+L K AR+KHC IC +C+ +ADHHCVW NNCIG GNYQYFYL
Sbjct: 119 LDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYL 178

Query: 179 FLLSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGM 238
           FL+SN  + +Y  +RL  +     +  ++  L L IL+ CF VI   F+Y QF LVRDGM
Sbjct: 179 FLVSNVFLTNYGFLRLLFLQ---RFVHSRQLLILSILLGCFGVILAVFSYFQFVLVRDGM 235

Query: 239 TTNEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQ------- 291
           TTNE++KW  IH ++R  Q++  ++  K+Y R+                   Q       
Sbjct: 236 TTNEENKWLVIHDMIRARQMVT-DDTGKYYFRLLADCQEDSAESLTNPRHSSQGPNEFHL 294

Query: 292 -------YEYYSTNPYDPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQR 337
                  Y YYSTNPYD  TY + +     + S   I NIYD   FW+NL  R
Sbjct: 295 NDSSPDIYVYYSTNPYDNATYDVKNPKE--ILSTAAITNIYDEGGFWKNLMAR 345

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score =  267 bits (683), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 138/335 (41%), Positives = 197/335 (58%), Gaps = 16/335 (4%)

Query: 3   MLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGI 62
           M ++  L  + Q+ L++ SP FK    FRWYY  ++ PLF     Y+WKYWLVP FY  I
Sbjct: 1   MFLLFLLFVVSQVGLLVFSPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACI 60

Query: 63  YIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEIPF 122
            I+C  +FY  +   +   LY+LE   +P+ +A   L+G  ++   P       GP+   
Sbjct: 61  LIFCVHLFYNKLNDTVNPYLYSLEKAFIPITIAFTSLTGVASVFVKPLGL--QAGPQFQP 118

Query: 123 DGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           D IIFH + VC++C+  K  RSKHC IC RCI + DHHC+W+NNC+G GNY+YFY FLLS
Sbjct: 119 DYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178

Query: 183 NCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNE 242
           NC +L+YA++RL ++     ++ +K FLSL +L   F++I+I FTY Q  LV DGMT NE
Sbjct: 179 NCLLLTYASLRLLTLFRITAFKKDKFFLSLFLLTTAFSLIAIVFTYYQLKLVNDGMTNNE 238

Query: 243 KDKWYTIHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTNPYDP 302
           +DKWY + + MRN  L+K  +   +Y  +                      +YSTN YD 
Sbjct: 239 QDKWYLVQEYMRNGNLVKDMDGVLYYRSMSTDAQTAEPI------------FYSTNLYDH 286

Query: 303 KTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQR 337
             Y L + +   + S+++I N+YDR SF  NLK+R
Sbjct: 287 SKYHLINPA--KILSHEEIINLYDRGSFLDNLKER 319

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score =  266 bits (681), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 131/272 (48%), Positives = 178/272 (65%), Gaps = 4/272 (1%)

Query: 3   MLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGI 62
           M+++ WL  + QIVL+L SPLFKS  PF WYYA +F PLF+    Y+WKY +VP FYT I
Sbjct: 1   MILLFWLFVVPQIVLLLFSPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSI 60

Query: 63  YIYCSFVFYVHVYGEIRSGLYTLEA-RCLPVVLALPLLSGYYTIVTSPHDTITYVGPEIP 121
           YIYC  +FY  +Y ++   L  LE    +P++L  P+++GY  +   P  T +     +P
Sbjct: 61  YIYCVLMFYKDLYRDLSPYLLFLERFLIVPLLLLGPIITGYLCMTIEPDSTKSLADCRVP 120

Query: 122 FDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           FD IIFH   +C++C   K ARSKHCSIC +CIL+ DHHC+W+NNCIG GNY+YFY FLL
Sbjct: 121 FDEIIFHPGTICQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLL 180

Query: 182 SNCSMLSYATIRLSSVAPSGLWRS--NKSFLSLMILVCCFAVISISFTYMQFALVRDGMT 239
           SN ++LSY+ +RL+S+       +   K  L L IL  CF +I   F Y QF LV DGMT
Sbjct: 181 SNVTLLSYSFLRLTSIQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMT 240

Query: 240 TNEKDKWYTIHKLMRNEQLLKLNNDCKFYIRI 271
           TNE+DKW+T+ + MR+  L++ +    +Y RI
Sbjct: 241 TNEQDKWFTVQEFMRDGNLVR-DKKGHYYFRI 271

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 291 QYEYYSTNPYDPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQR 337
            Y +YSTNPYD  TY + D  Y V+   +D+ NIYD+ +FW NL  R
Sbjct: 508 NYRFYSTNPYDDLTYHVED--YDVIKDPKDLNNIYDKGNFWANLWDR 552

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score =  251 bits (640), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 135/328 (41%), Positives = 195/328 (59%), Gaps = 14/328 (4%)

Query: 17  LVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSFVFYVHVYG 76
           L+L+SP +K+  PF  YY  VF+P+ +    Y+WKY LVP FY  ++IY ++ +Y  V  
Sbjct: 17  LLLLSPRYKNRSPFSIYYRHVFQPIVQDSHRYRWKYHLVPFFYLTLFIYLTYCYYTKVEP 76

Query: 77  EIRSGLYTLEARC-LPVVLALPLLSGYYTIVTSPHDTITYVGPE-----IPFDGIIFHDN 130
            I S LY +E    +P ++  P++ G  T+VT P+        E      P+D I+++ N
Sbjct: 77  LIASQLYFIEVWIWIPFMIFSPVIFGILTMVTIPNTVNNRRNQEKVLYRYPYDEIMYYPN 136

Query: 131 IVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYA 190
           I CR+C + K ARSKHC IC  CIL+ DHHC+W+NNCIG GNY YFY FLL NC  ++Y+
Sbjct: 137 IECRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYS 196

Query: 191 TIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWYTIH 250
            IRL  +   G   S+++ L+L+IL   FAVI   FT++Q  LV+DGMTTNE+DKW+T+ 
Sbjct: 197 FIRLFLMYCQGHAPSSRNILTLLILCGSFAVICAGFTFLQLQLVKDGMTTNEQDKWFTLQ 256

Query: 251 KLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTNPYDPKTYSLSDT 310
           + MR+ +L++  ++ K++I   N                    +YSTN YD + Y LS  
Sbjct: 257 EYMRDGKLIRTKDENKWFIANPNDDATITINADTI--------FYSTNAYDHEGYHLSSD 308

Query: 311 SYHVVNSYQDIPNIYDRCSFWQNLKQRC 338
            Y +V   + I N+YD   F+ NLK  C
Sbjct: 309 EYTIVEDPRQITNLYDSGDFFTNLKDFC 336

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score =  250 bits (639), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 137/342 (40%), Positives = 205/342 (59%), Gaps = 18/342 (5%)

Query: 3   MLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGI 62
           M+++L    + QI ++L+SPLFK   PF  YY  VF PLF+  + ++WK++LVP FY+ I
Sbjct: 1   MMLILIAALILQIAVLLISPLFKYQWPFSLYYKYVFLPLFQDNDRFRWKFYLVPLFYSSI 60

Query: 63  YIYCSFVFYVHVYGEIRSGLYTLEA-RCLPVVLALPLLSGYYTIVTSPHDTITYVGPEIP 121
           Y+    +   +V  ++  GL   +    +P  + L   +G    +  P  T +     I 
Sbjct: 61  YLGVVHLAIKNVIPQLSPGLNFFDYWFFIPFFIVLTPATGILAAIIGPETTKSCKRRNID 120

Query: 122 ---FDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYL 178
              +D ++F+ NI CR+C+L K ARSKHC++C +C+L  DHHC+W+NNC+GLGNY YFYL
Sbjct: 121 KFRYDNLLFYPNINCRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYL 180

Query: 179 FLLSNCSMLSYATIR-LSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDG 237
           FL+ N   +SYA IR +S V      +  +S L+  +L  CFA+I I FTY+Q  +VR+G
Sbjct: 181 FLVLNSLSMSYAFIRSMSIVGLKPNIKYPRSILAFNLLTGCFALICIVFTYLQLCMVREG 240

Query: 238 MTTNEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYST 297
           MTTNEKDKW+TIH+ MR ++L+K ++  K+Y  + +                 Q+E++ST
Sbjct: 241 MTTNEKDKWFTIHEYMREKRLVK-SSSGKWYYDLTDRLDLPTD----------QHEFFST 289

Query: 298 NPYDPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRCV 339
           NPYD + Y L   SY ++   + I NIYD  SF  NL+  C+
Sbjct: 290 NPYDGRLYRLQ--SYTLIEDAERINNIYDEGSFMANLRTLCL 329

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score =  249 bits (636), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 139/341 (40%), Positives = 203/341 (59%), Gaps = 26/341 (7%)

Query: 5   VVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYI 64
           V+L+L+   QI+++L+SP +K   PF WYY  +FRPL ++++ ++WK+++VPAFY  +Y 
Sbjct: 6   VLLFLVVAAQIIVLLLSPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYC 65

Query: 65  YCSFVFYVHVYGEIRSGLYTLEARCL-PV-VLALPLLSGYYTIVTSPHDTITYVGP--EI 120
           Y  FV    V   I + L ++E  C+ PV V+A P+L      V +        G   E 
Sbjct: 66  YIIFVLIRDVIPVIGNRLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEY 125

Query: 121 PFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL 180
            +D I+++ N+ CR+C ++K ARS+HC++C  C+LVADHHCVW+NNCIG GNYQ+FY FL
Sbjct: 126 DYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFL 185

Query: 181 LSNCSMLSYATIR---LSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDG 237
           + N   LSY  +R   +S +    +    +S L   IL   FA+I   FTY+Q  LV DG
Sbjct: 186 VVNVISLSYGFLRVLWISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDG 245

Query: 238 MTTNEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYST 297
           MTT EKDKWYTI ++MR   L++   D +F+I+ +                    ++YST
Sbjct: 246 MTTGEKDKWYTIQQIMREGNLVR-TLDGQFFIQDQQNPN----------------QFYST 288

Query: 298 NPYDPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRC 338
           N YD K Y     +Y +VN  +DI NIYD+ SFW  L++ C
Sbjct: 289 NAYDSKLY--VPQNYSIVNDPKDITNIYDQGSFWYKLERLC 327

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score =  245 bits (625), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 136/334 (40%), Positives = 205/334 (61%), Gaps = 14/334 (4%)

Query: 6   VLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIY 65
           VL++L +  +VL+L SP+FKS  PF   Y  VF+P    +++Y+WK+ LVP FYT IY+Y
Sbjct: 5   VLFVLLVSIVVLILFSPVFKSTWPFSTLYRRVFQPFVSDDQKYRWKFHLVPLFYTSIYLY 64

Query: 66  CSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLS-GYYTIVTSPHDTITY---VGPEIP 121
             + ++  V   I++ L+ LE   +  ++ LP ++ G   +VT   D+  +      + P
Sbjct: 65  LVYTYHAKVEPLIKNDLFLLERILIGPIIILPPVALGILAMVTKAEDSNVHRPGSTEKYP 124

Query: 122 FDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           +D +I++ ++ C +CR+ K ARS+HCSIC RCILVADHHC+W+NNCIG GNY  FYLFL+
Sbjct: 125 YDYLIYYPDVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLI 184

Query: 182 SNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTN 241
           SN   +SYA +RL S++        ++ L+L IL  CF +I   FTY+Q A+VR+GMTTN
Sbjct: 185 SNIVSMSYAFLRLCSISLKSSTALPRAVLTLSILCGCFTIICAIFTYLQLAIVREGMTTN 244

Query: 242 EKDKWYTIHKLMRNEQLLK-LNNDCK-FYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTNP 299
           E+DKWYTI + MR  +L++ LN+D + +++++                   Q  +YSTN 
Sbjct: 245 EQDKWYTIQEYMREGKLVRSLNDDPQSWFLKLTEKGDAAEPLQDQ------QGTFYSTNA 298

Query: 300 YDPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQN 333
           YD K Y L    Y  +    +I N+YD+ +F  N
Sbjct: 299 YDHKRYIL--MHYITIKDASEITNVYDKGTFLAN 330

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  242 bits (618), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 197/345 (57%), Gaps = 24/345 (6%)

Query: 1   MSMLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYT 60
           M     L +L + QI+++ +SP FK+      YY   + P+ +  ++Y+WK+ +VP FY 
Sbjct: 1   MGFGTFLVVLVILQILILFISPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYI 60

Query: 61  GIYIYCSFVFYVHVYGEIRSGLYTLEARC-LPVVLALPLLSGYYTIVTSPHDTITYVGPE 119
            ++IY    FY  V   I   L   E    +P+ +      G  T++ +P   + Y    
Sbjct: 61  TLFIYLVINFYAKVEPLIHDKLTYFERFFFIPISIISTPFFGIITMLINPDTALMYSNDS 120

Query: 120 I---PFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYF 176
           I    +D I++  +  C++C+++K ARSKHC++C +CILV DHHCVW+NNCIG GN+ YF
Sbjct: 121 IKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYF 180

Query: 177 YLFLLSNCSMLSYATIRLSSVAPSGLWRSN---KSFLSLMILVCCFAVISISFTYMQFAL 233
           YLFL  N   +SYA++RL  +  +         +  ++L IL  CF  I  +F+YMQ  +
Sbjct: 181 YLFLFDNTLFMSYASMRLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLI 240

Query: 234 VRDGMTTNEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYE 293
           V+DGMTTNEKDKWYTI  LM +++L+K ++D  +YI   N                 + E
Sbjct: 241 VKDGMTTNEKDKWYTIQCLMEDKKLVK-SSDNNWYISFVNDQG--------------ETE 285

Query: 294 YYSTNPYDPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRC 338
           +YSTN YD K Y L  T Y V+++ +DIPNIYD+ S W+N K  C
Sbjct: 286 FYSTNAYDHKKYQL--TEYKVIDNVEDIPNIYDKGSLWKNFKDFC 328

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score =  241 bits (616), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 133/316 (42%), Positives = 189/316 (59%), Gaps = 16/316 (5%)

Query: 30  FRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRSGLYTLEA-R 88
           F+WYY  VF P+F   +++++K+ +VP  Y  IY+YC  +F+  + G I S LY +E   
Sbjct: 28  FKWYYRNVFYPIFEDADKFRFKFHVVPILYLAIYLYCCLLFFRDIEGLIHSRLYAIERWF 87

Query: 89  CLPVVLALPLLSGYYTIVTSPHDTITYVGPEIP-FDGIIFHDNIVCRSCRLKKAARSKHC 147
            +PV L  P+  G  T++  P  T  Y+ P +  FDGI+FH  + CR+C++ K ARSKHC
Sbjct: 88  IIPVALMTPISCGLLTMLVKPEST--YIAPPVDQFDGILFHAGVECRTCKMPKYARSKHC 145

Query: 148 SICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATIRLSSVAPSGLWRSNK 207
           +ICGRC  +ADHHCVW NNCIG GNY+YFYLFL SN  +  Y   RL  + P+     ++
Sbjct: 146 AICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVYGFTRLLYLQPT---VKSR 202

Query: 208 SFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWYTIHKLMRNEQLLKLNNDCKF 267
           + L+L +L+  FA+I + F+Y Q  L++DGMTTNE+ KW  +H +MR  +L+ ++N  KF
Sbjct: 203 TLLTLALLLGSFALILVIFSYFQVVLIKDGMTTNEESKWLVVHDMMRARKLV-VDNAGKF 261

Query: 268 YIRIKNXXXXXXXXXXX------XXXXXYQYEYYSTNPYDPKTYSLSDTSYHVVNSYQDI 321
           Y RI                         +Y +YSTNPYD  TY++      V   Y++I
Sbjct: 262 YYRIPENEDSLSPELKSNEGPELTTTSPSRYTFYSTNPYDNCTYTVKYPREIV--DYEEI 319

Query: 322 PNIYDRCSFWQNLKQR 337
            NIYD+ SF  NLK R
Sbjct: 320 TNIYDKGSFCNNLKDR 335

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  240 bits (612), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 194/342 (56%), Gaps = 19/342 (5%)

Query: 1   MSMLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYT 60
           M   ++L +  + QI+ +L+SP  K +  F +YY  +F P  + + +YKWKY LVP FY 
Sbjct: 1   MMFRILLNIFVISQIIFLLLSPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIFYV 60

Query: 61  GIYIYCSFVFYVHVYGEIRSGLYTLEA-RCLPVVLALPLLSGYYTIVTSPHDTITYVGP- 118
            +Y Y   +++  +   I+S L  LE    +P  L + LLSG  T+   P  ++ +    
Sbjct: 61  TLYTYMVLLYFTKLNPIIKSQLTILERWVIIPFSLLISLLSGILTMRIRPESSLGFNSSP 120

Query: 119 --EIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYF 176
             +  FD +IF+ N  C +CRL+K ARSKHC+IC RC+L++DHHC+W NNCIGLGNYQYF
Sbjct: 121 YQDFEFDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYF 180

Query: 177 YLFLLSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRD 236
           Y FL+SN  +L YA +R+  +            L+ +IL   F  I + FTY+QFALV D
Sbjct: 181 YTFLVSNTLLLGYAFLRIILLTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYD 240

Query: 237 GMTTNEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYS 296
           GMTTNEKDKW+TI + MR  +L++ +N        +                     +YS
Sbjct: 241 GMTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQAT-------------RFYS 287

Query: 297 TNPYDPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRC 338
           TN YD   Y     ++  +  + +IPNIYD+ SF +NLK+ C
Sbjct: 288 TNAYDHTIY--CPVNFRPITHHDEIPNIYDKGSFLKNLKELC 327

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score =  236 bits (601), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 186/330 (56%), Gaps = 29/330 (8%)

Query: 21  SPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRS 80
           SP  K+  PF  YY  ++ P  +    YKWKY +VP FY  IY+Y  + +Y  V   I +
Sbjct: 19  SPFLKNRWPFSVYYRRLYVPYLKDVNSYKWKYHVVPGFYFSIYLYLVYCYYAKVEYLIVN 78

Query: 81  GLYTLE-ARCLPVVLALPLLSGYYTIVTSP----------HDTITYVGPEIPFDGIIFHD 129
            L   E    LP+++ L    G  T+VT P          HD +     + PFD II+H 
Sbjct: 79  HLNLFERGILLPLLIVLTPSFGILTMVTKPINIHGNGISQHDKLK---NKFPFDNIIYHS 135

Query: 130 NIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSY 189
             VC +C ++K ARSKHC+ICG CIL+ DHHC+W+NNCIGLGNY+YF++FLL N   LSY
Sbjct: 136 GNVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSY 195

Query: 190 ATIRLSSVAPSGL-WRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWYT 248
           A +RL  +  S      +K+ L+L IL   F+VI   F Y+Q   V +GMTTNE DKWY 
Sbjct: 196 AFLRLLHITLSKPDVPKSKNILALCILTGSFSVICGVFFYLQMKQVNNGMTTNETDKWYA 255

Query: 249 IHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTNPYDPKTYSLS 308
           + +LMR  +L+K  ++  F +  ++                   + YSTN YD KTY +S
Sbjct: 256 VQELMREGKLIKSEDNNWFALSTEDAPDSPS-------------QVYSTNFYDNKTYKIS 302

Query: 309 DTSYHVVNSYQDIPNIYDRCSFWQNLKQRC 338
           +  YH+V    +IPN+YDR +F  NLK  C
Sbjct: 303 N-DYHIVKDASEIPNVYDRGTFLDNLKGFC 331

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score =  234 bits (597), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 135/334 (40%), Positives = 204/334 (61%), Gaps = 11/334 (3%)

Query: 6   VLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIY 65
           +L++L +  +VL+L+SP+FKS  PF  +Y  VF+P    +++Y+WK  LVP FYT IY+Y
Sbjct: 5   LLFVLLIGFVVLILLSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLY 64

Query: 66  CSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLS-GYYTIVTSPHDTITYVG---PEIP 121
             + +++ V   I++ L+ LE   +  ++ LP ++ G   +V+   D+  +      E P
Sbjct: 65  LVYTYHMRVESTIKNELFLLERILIVPIIILPPVALGILAMVSRAEDSKDHKSGSTEEYP 124

Query: 122 FDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           +D ++++  I C +CR+ K ARSKHCSIC RC+LVADHHC+W+NNCIG GNY  FYLFL+
Sbjct: 125 YDYLLYYPAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184

Query: 182 SNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTN 241
           SN   + YA +RL  ++ +      ++ L+L IL  CF +I   FTY+Q A+V++GMTTN
Sbjct: 185 SNIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTN 244

Query: 242 EKDKWYTIHKLMRNEQLLK-LNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTNPY 300
           E+DKWYTI + MR  +L++ L++DC  +                         +YSTN Y
Sbjct: 245 EQDKWYTIQEYMREGKLVRSLDDDCPSWF----FKCTEQKDDAAEPLQDQHVTFYSTNAY 300

Query: 301 DPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNL 334
           D K Y+L  T Y  +    +IPNIYD+ +F  NL
Sbjct: 301 DHKHYNL--THYITIKDASEIPNIYDKGTFLANL 332

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  232 bits (592), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 131/335 (39%), Positives = 201/335 (60%), Gaps = 19/335 (5%)

Query: 9   LLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSF 68
           LL + Q++L+L+SP ++   PF  YY  VF PL +  +++K K++++P FY  +Y+Y  +
Sbjct: 8   LLIVSQVILLLISPRYRLIWPFSVYYKKVFHPLIQDNKKFKIKFYIIPIFYFVLYLYLIY 67

Query: 69  VFYVHVYGEIRSGLYTLEARC-LP-VVLALPLLSGYYTIVTSPHDTITY---VGPEIPFD 123
            +Y  V   I + L+  E    +P +++A PL+ G +T+ T P  T  Y   +  E  FD
Sbjct: 68  CYYSKVAPFINNQLWAFEKYMWIPLIIIASPLIFGVFTMFTKPTYTKKYSDEIDNEYAFD 127

Query: 124 GIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSN 183
            +IF+  I+CR+C+  K ARSKHCSIC RC+LVADHHC+W+NNC+G GNY YFY+FL++N
Sbjct: 128 NLIFYPQILCRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITN 187

Query: 184 CSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEK 243
              L+YA IRL ++  +      K+ L+L IL  CF+VI   FT++Q  L ++GMTTNEK
Sbjct: 188 TFSLTYAFIRLLTIFYTTNVYLPKNTLTLTILCGCFSVICGIFTFLQLNLAQEGMTTNEK 247

Query: 244 DKWYTIHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTNPYDPK 303
           DKW+T+H+ MR+ +L++  +   ++    +                    +YSTN YD  
Sbjct: 248 DKWFTVHEFMRDGKLVRTQSGRWYFADPHDSDISEDSV------------FYSTNGYDHT 295

Query: 304 TYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRC 338
            Y+L +  + ++     I NIYDR  F  NL+  C
Sbjct: 296 EYTLRN--FEIIEDPSRITNIYDRGDFLANLRDLC 328

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  227 bits (578), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 188/320 (58%), Gaps = 15/320 (4%)

Query: 21  SPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRS 80
           SP+FKS  PF  +Y  VF+P    +++Y+WK+ LVP FYT IY+Y  + ++  V   +RS
Sbjct: 20  SPVFKSTWPFSTFYRNVFQPFIADDQKYRWKFHLVPIFYTLIYLYLVYTYHTRVEWLVRS 79

Query: 81  GLYTLEA-RCLPVVLALPLLSGYYTIVTSPHDTITYV--GPEIPFDGIIFHDNIV-CRSC 136
            L+  E    +P++   P+  G   +VT   D+  +     E      + +  +V C +C
Sbjct: 80  ELFLCERILVVPIITLAPIACGILVMVTKAEDSYHHKPGSTEKYPYDYLLYYPVVKCSTC 139

Query: 137 RLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATIRLSS 196
            + K ARSKHCSIC RCILVADHHC+W+NNCIG GNY  FYLFL+SN   L YA +RL  
Sbjct: 140 HIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFSLLYAFLRLWC 199

Query: 197 VAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWYTIHKLMRNE 256
           ++ +      ++ L+L IL  CF +I I FTY+Q  +VR+GMTTNE+DKWYTI + MR  
Sbjct: 200 ISLNSKTALPRAVLTLTILCGCFTIICIIFTYLQLTIVREGMTTNEQDKWYTIQEYMREG 259

Query: 257 QLLK-LNNDCK-FYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTNPYDPKTYSLSDTSYHV 314
           +L++ LN++C+ +++++                      +YSTN YD K Y+L+   Y  
Sbjct: 260 KLVRSLNDNCQSWFLKLTEDDTTKLTQDQ-------HATFYSTNAYDHKQYNLA--HYIT 310

Query: 315 VNSYQDIPNIYDRCSFWQNL 334
           +    +I NIYD+ +F  N 
Sbjct: 311 IKDASEISNIYDKGTFLANF 330

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score =  221 bits (563), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 189/341 (55%), Gaps = 25/341 (7%)

Query: 3   MLVVLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGI 62
           ML+ L  L + Q++L+++SP+FK   P   YY   +RP F  +E Y+WKY+LVP  Y G+
Sbjct: 1   MLIYLGGLVVIQVLLLVLSPIFKLTWPLSIYYTKFYRPFFLDKERYRWKYYLVPGLYLGL 60

Query: 63  YIYCSFVFYVHVYGEIRSGLYTLE-ARCLPVVLALPLLSGYYTIVTSPHDTITY---VGP 118
           Y++    +++ V   +   LY  E    LP++       G  T++T P ++I +      
Sbjct: 61  YLFVIIYYHLRVNFMVNPHLYWFEKGLILPIMFTSLPYFGVMTMITKPENSIEHGINSNN 120

Query: 119 EIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYL 178
              FD I++  N+ C++CR  K ARSKHCSIC +CIL+ DHHC+W+NNCIG+GNY++FYL
Sbjct: 121 RYRFDEILYFPNVSCKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYL 180

Query: 179 FLLSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGM 238
           F+  N   + Y   RL  ++      S+++ L++ IL   FA+I   FTY+Q  LV  G+
Sbjct: 181 FIGGNSLTMIYCFTRLLFISIKYKVTSSRAILTMNILCGSFAIICSVFTYLQLDLVSQGI 240

Query: 239 TTNEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTN 298
           TTNE DKWYTIH+  R+ +L +  +   F I   N                    +YSTN
Sbjct: 241 TTNEMDKWYTIHEYCRDGKLARSKSGNWFLIDSNN-------------------TFYSTN 281

Query: 299 PYDPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRCV 339
            YD   Y  S T Y ++N   DI NIYD+ S W N    C 
Sbjct: 282 IYDHTRY--SPTQYTIINDPTDIQNIYDKGSCWLNFIDICT 320

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score =  219 bits (558), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 123/328 (37%), Positives = 182/328 (55%), Gaps = 34/328 (10%)

Query: 22  PLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRSG 81
           P F+    FRWYY  V++P+      Y+ K+++VP FY  +Y Y  ++FY   +  I   
Sbjct: 21  PQFRDKFIFRWYYDEVYKPMILDNSRYRIKFYVVPVFYLSVYSYMVYIFYSRTFAIISPM 80

Query: 82  LYTLEARC-LPVVLALPLLSGYYTIVTSPHDTITY-VGPE--IPFDGIIFHDNIVCRSCR 137
           L ++E    +P++L LPL  G  +++  P  +  + +G E   P+D +++     CR+C+
Sbjct: 81  LTSIETYVVIPLMLILPLFFGSMSMIIKPDSSNAHQIGSEKRYPYDNLLYFPQHECRTCK 140

Query: 138 LKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATIRL--- 194
             K ARSKHC++C  CI +ADHHCVW+NNC+G+GNY YFY FL SN  +LSY+ IRL   
Sbjct: 141 QVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFIRLIFI 200

Query: 195 ------SSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWYT 248
                  +  P+G     KS L L IL   F VI   + Y  F LV  GMTTNEKDKW  
Sbjct: 201 QFNKSAYNTTPTG----EKSLLILSILCGSFTVILAVYCYFVFELVNSGMTTNEKDKWQM 256

Query: 249 IHKLMRNEQLLKLNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTNPYDPKTYSLS 308
           +H  +    L++ + + K++I+ +N                  YE+YST+ YD   Y++ 
Sbjct: 257 VHDYINTGDLVR-DPEGKYFIKYQNGGN--------------NYEFYSTDSYDGTQYTIV 301

Query: 309 DTSYHVVNSYQDIPNIYDRCSFWQNLKQ 336
           D  Y  V S  +I NIYD+ +F  NL++
Sbjct: 302 D--YFTVKSPAEITNIYDKGNFINNLRE 327

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  218 bits (556), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 128/319 (40%), Positives = 188/319 (58%), Gaps = 12/319 (3%)

Query: 21  SPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRS 80
           SP+FKS  PF  +Y  VF+P    + +Y+WK+ LVP FYT IY+Y  F ++  V   I++
Sbjct: 20  SPVFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKN 79

Query: 81  GLYTLE-ARCLPVVLALPLLSGYYTIVTSPHDTITY---VGPEIPFDGIIFHDNIVCRSC 136
            L+ LE    +P+++  P++ G   +VT   D+  +      + P+D ++++  + C +C
Sbjct: 80  ELFLLERILIVPIIILPPVVLGILAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTC 139

Query: 137 RLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATIRLSS 196
           R  KAARSKHCSIC RC+LVADHHC+W+NNCIG GNY  FYLFL SN   +SYA +RL  
Sbjct: 140 RTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYF 199

Query: 197 VAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWYTIHKLMRNE 256
           ++ +      ++ L+L IL  CF +I   FTY+Q A+V++GMTTNE+DKWYTI + MR  
Sbjct: 200 ISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259

Query: 257 QLLK-LNNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYEYYSTNPYDPKTYSLSDTSYHVV 315
           +L++ L++D + +                         +YSTN YD   Y L    Y  +
Sbjct: 260 KLVRSLDDDSRSWF-----LKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLK--HYTTI 312

Query: 316 NSYQDIPNIYDRCSFWQNL 334
               +I NIYD+ +F  NL
Sbjct: 313 KDASEITNIYDKGTFLANL 331

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score =  209 bits (531), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 135/345 (39%), Positives = 196/345 (56%), Gaps = 31/345 (8%)

Query: 6   VLWLLALCQIVLVLVSPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIY 65
           +L +LA+ Q+ L+L+SPL +   P  WYY  V+RP       Y+ KY++VP FY  +Y Y
Sbjct: 5   LLLILAVLQVFLLLLSPLARLQWPLSWYYEKVYRPFLADPTRYRVKYYIVPVFYFSLYCY 64

Query: 66  CSFVFYVHVYGEIRSGLYTLEARCL-PVVLALPLLSGYYTIVTSPH------DTITYVGP 118
              ++   +   I   LY +E     P++LA   +SG  T+ T P         +     
Sbjct: 65  MLNLYRSELLPVIWGRLYFIELYFFQPLLLAAIPVSGLLTMFTRPEGCGGRDQGVAPSEG 124

Query: 119 EIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYL 178
           + P+DGI+++ N  CRSC   K ARSKHCSIC RCI +ADHHC+W N CIG GN+ YFY+
Sbjct: 125 QWPYDGILYYPNTTCRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYV 184

Query: 179 FLLSNCSMLSYATIRL---SSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVR 235
           FL  +C +L+YA  RL     VA + L  S +S L+L++L   FA++   FTY Q  LV+
Sbjct: 185 FLACHCLILTYAFARLFFFVVVADNKL-TSTRSTLTLLMLTGTFALLVDLFTYWQMMLVK 243

Query: 236 DGMTTNEKDKWYTIHKLMRNEQLLKL--NNDCKFYIRIKNXXXXXXXXXXXXXXXXYQYE 293
           +GMTTNE+DKW+ IH+ MR+ + + +  N   K +    +                   +
Sbjct: 244 EGMTTNEQDKWFLIHEYMRDGKCVNVSCNGSTKKWFLESDEDG----------------K 287

Query: 294 YYSTNPYDPKTYSLSDTSYHVVNSYQDIPNIYDRCSFWQNLKQRC 338
           +YSTN YD   Y+L  T+YH+V +  +I N+YD+ SFW+N K  C
Sbjct: 288 FYSTNAYDHTAYTL--TNYHIVKNASEIINMYDKGSFWENFKDMC 330

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 10/113 (8%)

Query: 84  TLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEIPFDGIIFHDNIVCRSCRLKKAAR 143
           T +   LP  + +  L   Y I    + +I+   P+   D +   D   C SCR+ +  R
Sbjct: 132 TADPGALPKNIHIAQLRNNYQIPQEYYSSISLPTPKSNVDPLSKIDIRYCTSCRIWRPPR 191

Query: 144 SKHCSICGRCILVADHHCVWLNNCIGLGNYQYF----------YLFLLSNCSM 186
           + HCS CG C++  DHHC+W+NNC+G  NY+YF           LFL++NCS+
Sbjct: 192 ASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVLAELFLIANCSI 244

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 93/195 (47%), Gaps = 29/195 (14%)

Query: 84  TLEARCLPVVLALPLLSG-------YYTIVTSP-HDTITYVGPEIPFDGIIFHDNIVCRS 135
           T +   LP  + +P L+        YY ++  P  D   YV  EI +          CR+
Sbjct: 151 TSDPGILPKNIHIPKLANNFQLPQEYYNLIRLPIKDESQYV--EITY----------CRT 198

Query: 136 CRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATIRLS 195
           CR+ +  RS HCSIC  C++  DHHC+WLNNC+G  NY+YF +FL S    + +  I   
Sbjct: 199 CRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFLLINTG 258

Query: 196 -SVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFA----LVRDGMTTNEKDKW-YTI 249
             +  +   +   S + + IL+  +  +SIS+  +  A    L     TT E  K+ Y I
Sbjct: 259 IHIGKNRHEKKPASNIPVTILLTVYGSLSISYPIILLAYHLVLTGTNQTTREFLKYVYEI 318

Query: 250 ---HKLMRNEQLLKL 261
              H+  +N   +K+
Sbjct: 319 RDQHRKSKNPVFMKI 333

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 82/168 (48%), Gaps = 19/168 (11%)

Query: 84  TLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEIPFDGIIFHDNIV--CRSCRLKKA 141
           T +   LP  + L  L   Y I    ++ IT     +P    +  D  +  C+SCR+ + 
Sbjct: 129 TSDPGVLPRNIHLGQLRNNYQIPQEYYNLIT-----LPTHSSVSKDITIKYCQSCRIWRP 183

Query: 142 ARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSN--CSMLSYATIRLSSVAP 199
            RS HCS C  C++V DHHC+W+NNCIG  NY++F +FLLS    S++  A   +     
Sbjct: 184 PRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIILLANCAIHIARE 243

Query: 200 SGLWRSNKSFLSLMILVCCFAVIS-----ISFTYMQFALVRDGMTTNE 242
           SG          + IL+ C+A ++     I FTY  F +     TT E
Sbjct: 244 SG----GPGHYPVAILLLCYAGLTLWYPAILFTYHVF-MAGTQQTTRE 286

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 106/225 (47%), Gaps = 31/225 (13%)

Query: 51  KYWLVPAFYTGIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPH 110
           K W     Y  + I+  + + + +   IR+   T +   LP  + L  L   Y I    +
Sbjct: 98  KLWHTQNGYKVLVIFFYYFWVITLASFIRTA--TSDPGVLPRNIHLSQLRNNYQIPQEYY 155

Query: 111 DTITYVGPEIPFDGIIFHDNIV--CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCI 168
           + IT     +P    I  D  +  C SCR+ +  RS HCS C  C++V DHHC+W+NNCI
Sbjct: 156 NLIT-----LPTHSSISKDITIKYCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCI 210

Query: 169 GLGNYQYFYLFL----LSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVIS- 223
           G  NY++F +FL    LS+  +L+   I ++    SG  R       + IL+ C+A ++ 
Sbjct: 211 GKRNYRFFLIFLLGAILSSVILLTNCAIHIAR--ESGGPRD----CPVAILLLCYAGLTL 264

Query: 224 ----ISFTYMQFALVRDGMTTNE------KDKWYTIHKLMRNEQL 258
               I FTY  F +  +  TT E        K    H++++ E +
Sbjct: 265 WYPAILFTYHIF-MAGNQQTTREFLKGIGSKKNPVFHRVVKEENI 308

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 76.6 bits (187), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 63/122 (51%), Gaps = 23/122 (18%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS---------- 182
           C +C + +  R+ HCSIC  CI V DHHC+W+NNC+G  NY+YF +FL+           
Sbjct: 190 CSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFIII 249

Query: 183 NCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVI--SISFTYMQFALVRDGMTT 240
           NCS +  A IR +S AP  +         L+I+  C  +I   I   Y   AL   G TT
Sbjct: 250 NCS-IHVARIRRASNAPVAI---------LLIVYGCLTIIYPGILLGY-HIALTGTGQTT 298

Query: 241 NE 242
            E
Sbjct: 299 RE 300

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 76.6 bits (187), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 16/107 (14%)

Query: 84  TLEARCLPVVLALPLLSG--------YYTIVTSPHDTITYVGPEIPFDGIIFHDNIVCRS 135
           T++  CLP  + L  ++         YY ++  P   IT   P    D I+      CR+
Sbjct: 129 TMDPGCLPRNIHLSQVNDGKYQIPQEYYNLINLP---ITRGNPN--GDSILMK---YCRT 180

Query: 136 CRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           CR+ +  R+ HCSIC  C++  DHHC+W+NNC+G  NY+YF  FL+S
Sbjct: 181 CRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLIS 227

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 76.6 bits (187), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 69/135 (51%), Gaps = 11/135 (8%)

Query: 51  KYWLVPAFYTGIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPH 110
           K W     Y  + I+  + + V     IR+   T +   LP  + L  L   Y I    +
Sbjct: 98  KLWYTKNGYKVLVIFFYYFWVVTFIAFIRTA--TSDPGVLPRNIHLGQLQNNYQIPQEYY 155

Query: 111 DTITYVGPEIPFDGIIFHDNIV---CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNC 167
           + IT   P  P      H++I    C SCR+ +  RS HCS C  C++V DHHC+W+NNC
Sbjct: 156 NLITL--PTHP----SVHNDITIKYCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNC 209

Query: 168 IGLGNYQYFYLFLLS 182
           IG  NY++F +FLLS
Sbjct: 210 IGKRNYRFFLIFLLS 224

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 76.3 bits (186), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 69/134 (51%), Gaps = 9/134 (6%)

Query: 51  KYWLVPAFYTGIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPH 110
           K W     Y  + I+  + + + +   IR+   T +   LP  + L  L   Y      +
Sbjct: 98  KLWHTQKGYKVLVIFFYYFWAIMLISFIRTA--TSDPGVLPRNIHLGQLQNNYQTPQEYY 155

Query: 111 DTITYVGPEIPFDGIIFHDNIV--CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCI 168
           + IT     +P    +  D  +  C+SCR+ +  R+ HCS C  C++V DHHCVW+NNC+
Sbjct: 156 NLIT-----LPTHSSVLEDITIKYCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCV 210

Query: 169 GLGNYQYFYLFLLS 182
           G  NY++F +FLLS
Sbjct: 211 GKRNYRFFLIFLLS 224

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 76.3 bits (186), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 62/127 (48%), Gaps = 11/127 (8%)

Query: 84  TLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEIPFDGIIFHDNIV-CRSCRLKKAA 142
           T +   LP  + L  L   + I    + TI+   P+     I     +  C SCR+ +  
Sbjct: 131 TSDPGILPRNIHLGQLKRNFQIPQEYYSTISLPAPQTIRGDIQAKIELKYCTSCRIWRPP 190

Query: 143 RSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYL----------FLLSNCSMLSYATI 192
           R+ HCS C  CIL  DHHC+W+NNCIG  NY+YF L          FL++NCS+  Y   
Sbjct: 191 RASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFLIANCSIHIYHHR 250

Query: 193 RLSSVAP 199
            L S  P
Sbjct: 251 NLPSKVP 257

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 75.9 bits (185), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 59/107 (55%), Gaps = 17/107 (15%)

Query: 84  TLEARCLPVVLALPLLS-------GYYTIVTSPHDTITYVGPEIPFDGIIFHDNIVCRSC 136
           T +   LP  + +P++S       GYY I++ P      +  ++ +          C +C
Sbjct: 127 TSDPGVLPRNVHVPIVSSEFELPQGYYNIISLPSANSNGLTVDVKY----------CPTC 176

Query: 137 RLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSN 183
           R+ +  R+ HCS+CG CIL  DHHC W+NNCIG  NY+YF  FL+S+
Sbjct: 177 RIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSS 223

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 39/51 (76%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSN 183
           C++CR+ +  RS HCSIC  C+L+ DHHCVW+NNC+G  NY+YF  FL S+
Sbjct: 184 CKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSS 234

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 74.3 bits (181), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 59/94 (62%), Gaps = 5/94 (5%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSN---CSML-S 188
           C +C++ +  R+ HCS+C  C+L  DHHC+W+NNC+G  NY+YF  FLLS+   C++L +
Sbjct: 160 CHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLIA 219

Query: 189 YATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVI 222
              + L      G+  S++  L + +L+C +A +
Sbjct: 220 NCALHLHRALHEGIRVSHRP-LPVAVLLCVYAAV 252

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 70/143 (48%), Gaps = 11/143 (7%)

Query: 102 YYTIVTSPHDTITYVGPEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHC 161
           YY ++T P         E+ +          C +CR+ +  R+ HCS C  CI+  DHHC
Sbjct: 151 YYNMITLPTGNPLIANIEVKY----------CTTCRIWRPPRASHCSTCEACIITHDHHC 200

Query: 162 VWLNNCIGLGNYQYFYLFLLSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAV 221
            W+NNCIG  NY YF+ FL+S C + +   I   ++  S    +  + +++++L+ C  V
Sbjct: 201 KWVNNCIGQRNYHYFFTFLVS-CVIATAFIIANCAIRVSRSVHAKDAPVAILLLIYCGLV 259

Query: 222 ISISFTYMQFALVRDGMTTNEKD 244
           +   F  + + +   G     ++
Sbjct: 260 VCYPFILLVYHIFLTGSQQTTRE 282

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 37/50 (74%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           C +CR+ +  RS HCSIC  CI+  DHHC+W+NNCIG  NY++F  FLLS
Sbjct: 217 CTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLS 266

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 107/235 (45%), Gaps = 24/235 (10%)

Query: 47  EYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIV 106
           ++ W    +P+F      YC+  F +  +  +R  L+     C  ++     LS Y  I 
Sbjct: 6   KWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWY--QFCQTMIW----LSYYLAIY 59

Query: 107 TSPHDTITYVGPEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNN 166
           T P    T   P            + C+ C+  K  RS HC  C +C+L+ DHHC W  N
Sbjct: 60  TPPGKPPTNFKPSK------NEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMN 113

Query: 167 CIGLGNYQYFYLFL----LSNCSMLSYATIRLSSV-----APSGL-WRSNKSFLSLMILV 216
           C+G  N+ +F  FL    +   S+  + T R+ S+     +PS L ++S   FL+++  +
Sbjct: 114 CVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPL 173

Query: 217 CCFAVISISFTYMQ--FALVRDGMTTNEKDKWYTIHKLMRNEQLLKLNNDCKFYI 269
             F +++IS   ++  F  + +G +  E  +   +  L R  +LL +  +  +YI
Sbjct: 174 NAFILLTISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYI 228

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 71/135 (52%), Gaps = 4/135 (2%)

Query: 84  TLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEIPFDGIIFHDNIVCRSCRLKKAAR 143
           T +   LP  + +P++   + +  S ++ IT   P    +G    D   C +CR+ +  R
Sbjct: 132 TSDPGVLPRNVHVPIVGEEFQLPRSYYNIITL--PSAHPEGKTV-DVKYCATCRIWRPPR 188

Query: 144 SKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATIRLSSVAPSGLW 203
           + HCS C  C+L  DHHC W+NNCIG  NY+YF  FL S C + +   I    +  +   
Sbjct: 189 ASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLAS-CCLATTLCIVGCGIRVAQAT 247

Query: 204 RSNKSFLSLMILVCC 218
           R ++  +++++++ C
Sbjct: 248 RPDRVVVAILLIIYC 262

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 70/137 (51%), Gaps = 18/137 (13%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS---NCSMLSY 189
           C++CR+ +  RS HCS+C  C+L  DHHC WLNNCIG  NY++F  FL++   +C +L  
Sbjct: 174 CQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCILL-- 231

Query: 190 ATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFA----LVRDGMTTNE--- 242
             I LSS   S  +     +  + +L+ C+  + I +  + F     L     TT+E   
Sbjct: 232 --ILLSSFRLS--YSPQVRYTPVSLLIICYCGLGIWYPLILFIYHIFLAGTQQTTHEYLR 287

Query: 243 --KDKWYTIHKLMRNEQ 257
               K    HK+ RN  
Sbjct: 288 SIGSKHPIFHKITRNRD 304

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 66/135 (48%), Gaps = 34/135 (25%)

Query: 84  TLEARCLPVVLALPLL-------SGYYTIVTSPHDTITYVGPEIPFDGIIFHDNIVCRSC 136
           T +   LP  + LP L       S YY+I+T P  + T    ++ +          C +C
Sbjct: 144 TTDPGTLPRNIHLPQLRNDYELPSEYYSIITLPSSS-TNSPIQLKY----------CTTC 192

Query: 137 RLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS----------NCSM 186
           R+ +  R+ HCS C  CI+  DHHC+W+NNC+G  NY+YF  F+ S          NCS 
Sbjct: 193 RIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLTIILLVINCS- 251

Query: 187 LSYATIRLSSVAPSG 201
                +RLS  +P+ 
Sbjct: 252 -----VRLSKGSPTA 261

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 90  LPVVLALPLLSG--YYTIVTSPHDTITYVGPEIPFDGIIFHDNIV-CRSCRLKKAARSKH 146
           LP  + +P + G    T V SP +    V   +P      H  +  C +C++ +  R+ H
Sbjct: 142 LPRNIHVPKVGGPPGQTPVQSPQEYYNIV--TLPTAQRSAHVEVKYCTACKIWRPPRASH 199

Query: 147 CSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCS 185
           C IC  C+   DHHC W+NNC+G  NY+YF  FL + C+
Sbjct: 200 CRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATCA 238

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 68.2 bits (165), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (64%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCS 185
           VCR+C + K  RS HCS C RC+L  DHHC W + CIG  N ++F  FL+ N +
Sbjct: 109 VCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYNTT 162

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 106/232 (45%), Gaps = 30/232 (12%)

Query: 47  EYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIV 106
           +Y W    +P+F      Y S  F +  +  I+  ++          L++  +S    I 
Sbjct: 6   KYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIW------FQFSLSMIWVSYLLAIF 59

Query: 107 TSPHDTITYVGPEIPFDGIIFHD----NIVCRSCRLKKAARSKHCSICGRCILVADHHCV 162
           T+P        P      I F+D    N  C+ C   K  RS HC  C +C+L+ DHHC 
Sbjct: 60  TNPGKPPKNCKP------IDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCP 113

Query: 163 WLNNCIGLGNYQYFYLFLL----SNCSMLSYATIRLSSV-----APSGLWRSNK-SFLSL 212
           W  NC+G  N+ +F  FL+    +   +L +   R  ++      PS ++  N+  FL++
Sbjct: 114 WTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTI 173

Query: 213 MILVCCFAVISISFTYMQ---FALVRDGMTTNEKDKWYTIHKLMRNEQLLKL 261
           +I +  F +++IS  +++     +VR GMT  E  +   +  L  N++LL +
Sbjct: 174 LIPMDAFILLTISLLFIRCFNNQIVR-GMTQIEFWELERLENLFYNKKLLPM 224

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 36/51 (70%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSN 183
           C +CR+ +  R+ HC++C  CIL  DHHC WLNNCIG  N++YF  FL S+
Sbjct: 187 CTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSS 237

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (47%), Gaps = 9/126 (7%)

Query: 59  YTGIYIYC---SFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITY 115
           + GI I C   SF+ Y+  Y  +R  L  ++       L +  +S Y  I+ +P      
Sbjct: 9   WMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIIINPGKPGKN 68

Query: 116 VGPEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQY 175
             P +P +   F     C+ C   K  RS HC  C +C+L+ DHHC W  NCIG  N+ +
Sbjct: 69  FKP-LPHEWRNF-----CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPH 122

Query: 176 FYLFLL 181
           F  FLL
Sbjct: 123 FMRFLL 128

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 67.4 bits (163), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (51%), Gaps = 10/108 (9%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATI 192
           C+ CR  K  R+ HC  C +C+L  DHHC W  NC+G  N+ +F  FL    +   Y   
Sbjct: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139

Query: 193 RL---------SSVAPSGLW-RSNKSFLSLMILVCCFAVISISFTYMQ 230
            L         +  +P+ LW +S   FL+++I +  F +++IS  +++
Sbjct: 140 ELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLTISILFIR 187

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 66/144 (45%), Gaps = 11/144 (7%)

Query: 61  GIYIYCSFVFYVHVYGE---IRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITYVG 117
           GI I CS +F++        +R+ L           L +  +S Y  I T+P     +  
Sbjct: 11  GIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYTNPGKP-PHGS 69

Query: 118 PEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFY 177
            +   DG +   N  C  C   K  RS HC  C +C+L+ DHHC W  NC+G GN+  F 
Sbjct: 70  AQQHTDGDM---NRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFM 126

Query: 178 LFL----LSNCSMLSYATIRLSSV 197
            FL    ++   +  Y  +R++++
Sbjct: 127 RFLIWVIITTSQLFWYLLLRIAAI 150

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 33/52 (63%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSN 183
           VCR+C + K  R  HCS C RCIL  DHHC W   CIG  N++YF  FL+ N
Sbjct: 105 VCRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYN 156

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 31/49 (63%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           C+ C+  K  RS HC  C +C+L+ DHHC W  NC+G GNY +F  FL 
Sbjct: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFLF 128

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 10/108 (9%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL---LSNCSMLSY 189
           C+ C+L K  R+ HC  C +C+L+ DHHC W  NC+G  N+ +F  FL   +     L Y
Sbjct: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139

Query: 190 A----TIRLSSVA--PSGLWRSNK-SFLSLMILVCCFAVISISFTYMQ 230
                TI L  V   PS L+   + +FL ++I +  F +I+++  +++
Sbjct: 140 QLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFIR 187

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           +CR+C + K  R  HCS C RCIL  DHHC WL +C+G  N +YF  FL+
Sbjct: 107 LCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLM 156

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 60/126 (47%), Gaps = 9/126 (7%)

Query: 59  YTGIYIYC---SFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITY 115
           + GI I C   SF+ Y   +  + + L   +       LAL  LS YY I T+P      
Sbjct: 9   WLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYTNPGR---- 64

Query: 116 VGPEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQY 175
             P   F+   +     C+ C+  K  R+ HC  C +C+L+ DHHC W  NC+G  N+ +
Sbjct: 65  --PRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPH 122

Query: 176 FYLFLL 181
           F  FL+
Sbjct: 123 FLRFLV 128

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 40/73 (54%), Gaps = 8/73 (10%)

Query: 117 GPEIPFDGI------IFHDNI--VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCI 168
           G E+P D +      + HD    VCR+C + K  R  HCS C +CIL  DHHC W   C+
Sbjct: 82  GIELPPDFLAQRSFTLKHDGRFRVCRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECV 141

Query: 169 GLGNYQYFYLFLL 181
           G  N +YF  FL+
Sbjct: 142 GFKNQKYFVQFLI 154

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 19/134 (14%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYAT 191
           +C++C++ K  R  HCS C +CIL  DHHC W   CIG  N +YF  FL+  C+  S   
Sbjct: 100 LCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIY-CTAYSIVV 158

Query: 192 IRLSSVAPSGLWRSNKSF----LSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWY 247
           +  +S      W S K +    + LM+L      I I+ + + F+              +
Sbjct: 159 LFFTSCELH-YWFSGKQYEDELIDLMLLTVWILAIVITVSLIFFSS-------------F 204

Query: 248 TIHKLMRNEQLLKL 261
           +I++L++N+  +++
Sbjct: 205 SIYQLLKNQTTIEM 218

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 56/115 (48%), Gaps = 6/115 (5%)

Query: 67  SFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEIPFDGII 126
           SF+ Y   Y  + + L   +       L++  LS Y  I T+P   +    P  P D  I
Sbjct: 20  SFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICTNPGRPLPNYKP--PPD--I 75

Query: 127 FHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           + +   C+ C+  K  RS HC  C +C+L+ DHHC W  NC+G  NY +F  FL 
Sbjct: 76  WRN--FCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLF 128

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 71/145 (48%), Gaps = 14/145 (9%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYAT 191
           +C++C++ K  R  HCS C +CIL  DHHC W   CIG  N ++F  FL+  C++ ++  
Sbjct: 108 LCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIY-CTIYAFVA 166

Query: 192 IRLSSVAPSGLWRSNKSFL------SLMILVCCFAVISIS---FTYMQFALVRDGMTTNE 242
           + L S      W  N++++      +L+I+     VISIS   F+      V    TT E
Sbjct: 167 LGLISYQFVN-WYKNQNYMNEYIDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNRTTIE 225

Query: 243 KDKWYTIHKLMRNEQLLKLNNDCKF 267
               Y I +  R+  +L    +  F
Sbjct: 226 M---YGIRRYNRDFAILNGTEESDF 247

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           +CR+C++ K  RS HCS C +C L  DHHC W  +CIG  N + F  FLL
Sbjct: 104 ICRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLL 153

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 58/128 (45%), Gaps = 21/128 (16%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYAT- 191
           CR C + K  R  HCS C +C L  DHHC W  +C+G  N +YF  FL+       Y T 
Sbjct: 106 CRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLI-------YGTV 158

Query: 192 ----IRLSSVAPSGLW----RSNKSFLSLMILVCCFAVISISFTYMQFA-----LVRDGM 238
               I L S     LW    R N+  + L +LV     ++IS + + F      L+    
Sbjct: 159 FSILIFLLSGTELLLWFKNQRYNQEMIQLPLLVVWILSVAISISMLAFTSYTVYLITKNQ 218

Query: 239 TTNEKDKW 246
           TT E  +W
Sbjct: 219 TTIEMYEW 226

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 31/50 (62%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           VC+SCR  K  R  HCS C RCIL  DHHC W+  C+G  N + F  FLL
Sbjct: 102 VCQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLL 151

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 90/228 (39%), Gaps = 29/228 (12%)

Query: 47  EYKWKYWL---VPAFYTGIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYY 103
           E KW  WL   VP+F      Y S  F +  +      L+          L L  +S  +
Sbjct: 4   ELKWP-WLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLW------FEFSLTLIWVSYAF 56

Query: 104 TIVTSPHDTITYVGPEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVW 163
            I  +P        P   F+  I      C+ C   K  R+ HC  C +C+L  DHHC W
Sbjct: 57  AIFKNPG------RPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPW 110

Query: 164 LNNCIGLGNYQYFYLFLLSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCF---- 219
             NC+G  N+ +F  FL       SY  + L+  A    W S  +   +     CF    
Sbjct: 111 TMNCVGHNNFPHFVRFLTWVVLTTSYLGLLLTQRA-FDHWASRNTRKFVHTSELCFLFVN 169

Query: 220 ----AVISISFTYMQFALVR----DGMTTNEKDKWYTIHKLMRNEQLL 259
               A I ++ + + F  V+    +GMT  E  +   I  L  NE+L+
Sbjct: 170 APLNAFILLTVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLV 217

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 71/140 (50%), Gaps = 12/140 (8%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYA-T 191
           C+ C+  K  RS HC  C +C+L+ DHHC W  NC+G  NY +F  F+    +   +   
Sbjct: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFC 159

Query: 192 IRLSSVA--------PSGLWRSNK-SFLSLMILVCCFAVISISFTYMQ--FALVRDGMTT 240
           I+L  V+        P  L++ ++  FL+++  +  F +++I   +++  F  + +G + 
Sbjct: 160 IQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLTIVILFLRCLFNQIINGRSQ 219

Query: 241 NEKDKWYTIHKLMRNEQLLK 260
            E      +  L  +++L+K
Sbjct: 220 IESWDMDRLESLFDSQRLIK 239

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           +C+ C+  K  R+ HC  C +C+LV DHHC W  NC+G  N+ +F  FL+
Sbjct: 79  ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 29/49 (59%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           C+ C   K  R+ HC  C +CIL+ DHHC W  NC+G  NY +F  FL 
Sbjct: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLF 129

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 96/226 (42%), Gaps = 26/226 (11%)

Query: 47  EYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIV 106
           ++ W    +P F      Y + +F +  +  ++  ++          L +  LS Y  I 
Sbjct: 6   KWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIW------FQFSLTMIWLSYYKAIY 59

Query: 107 TSPHDTITYVGPEIPFDGIIFHD-NIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLN 165
           T+P       G  +P    + H+    C+ C+  K  R+ HC  C +C+LV DHHC +  
Sbjct: 60  TNP-------GSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTM 112

Query: 166 NCIGLGNYQYFYLFLLSNCSMLSYATIR----------LSSVAPSGLWRSNKSFLSLMIL 215
           NC+G  N+ +F  FL    +  +Y +I+          +       + +    FL+++  
Sbjct: 113 NCVGYNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTP 172

Query: 216 VCCFAVISISFTYMQ--FALVRDGMTTNEKDKWYTIHKLMRNEQLL 259
              F +++IS  + +     V +GMT  E  +   I  +  N +L+
Sbjct: 173 ANAFVLLTISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLV 218

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           C+ C+  K  RS HC  C +C+L+ DHHC W  NC+G  NY +F  FL 
Sbjct: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFLF 128

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           C+ CR+ K  R+ HC  C +C+L  DHHC W  NC+G  N+ +F  FL 
Sbjct: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLF 128

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 60.8 bits (146), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 29/50 (58%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           +C++C   K  R  HCS C RCIL  DHHC W   CIG  N +YF  FL 
Sbjct: 105 ICQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLF 154

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           VCR+C + K  R  HCS C +CIL  DHHC W   CIG  N ++F  +LL
Sbjct: 106 VCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLL 155

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 61/123 (49%), Gaps = 19/123 (15%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL----LSNCSMLS 188
           C +C + K  RS HCS C +C L  DHHC W ++CIG  N ++F  FL    L + S+  
Sbjct: 110 CATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIFI 169

Query: 189 YATIRLSSVAPSGLWRSNKSFLSLMI--------LVCCFAVISI-SFTYMQFALVRDGMT 239
            AT+++ S      W  N+++ +  I        L+   A +S+  FT     L+    T
Sbjct: 170 AATLQIVS------WFRNQNYTTQYIDINLLVVWLLSTGASVSLFCFTGFSIYLLTKNQT 223

Query: 240 TNE 242
           TNE
Sbjct: 224 TNE 226

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 66/145 (45%), Gaps = 13/145 (8%)

Query: 118 PEIPFDGIIFHDNI----VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNY 173
           P+I  D  IF         C++C + K  R  HCS C +C L  DHHC W  +C+G  N 
Sbjct: 86  PDIIKDNCIFVKRDGSFRFCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQ 145

Query: 174 QYFYLFLLSNCSMLSYATIRLSSVAPSGLWRSNK---SFLSLMILV-----CCFAVISIS 225
           ++F  F L+  ++ S   + ++S      +R  K     L L +LV        A+ + +
Sbjct: 146 KFFVQF-LAYTTVYSLYVLLMTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIATFA 204

Query: 226 FTYMQFALVRDGMTTNEKDKWYTIH 250
           FT     LV    TT E+ +W  I 
Sbjct: 205 FTTYTIWLVTKNETTIEQYEWGNIR 229

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 77/155 (49%), Gaps = 16/155 (10%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL----LSNCSMLS 188
           C+ C   K  R+ HC  C +C+L+ DHHC W  NC+G  N+ +F  FL    ++   +L 
Sbjct: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLY 139

Query: 189 YATIRL-----SSVAPSGLW-RSNKSFLSLMILVCCFAVISISFTYM-----QFALVRDG 237
           +   R+     S   PS L+ +S   FL++   +  F +++IS  ++     Q    R  
Sbjct: 140 FLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQ 199

Query: 238 MTTNEKDKWYTIHKLMRNEQLLKLNNDCKFYIRIK 272
           + T E ++  ++  L R +  L ++N  +F+  +K
Sbjct: 200 IETWENERLESLFYLRRLKPQL-ISNLWEFHPELK 233

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 54/135 (40%), Gaps = 12/135 (8%)

Query: 47  EYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIV 106
           ++ W    +P F      YC+  F +  +   +  L+          L +  +S Y  I 
Sbjct: 6   KWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLW------FEFSLGMIWISYYLAIY 59

Query: 107 TSPHDTITYVGPEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNN 166
           T+P        P   F    F     C  C   K  R+ HC  C +C+L  DHHC W  N
Sbjct: 60  TNPGK------PTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMN 113

Query: 167 CIGLGNYQYFYLFLL 181
           C+G  N+ +F  FL 
Sbjct: 114 CVGHRNFAHFIRFLF 128

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 64/142 (45%), Gaps = 17/142 (11%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL-SNC---SML 187
           VC+ C + K  R  HCS C  C+L  DHHC W   C G  N ++F  FL+ + C    +L
Sbjct: 105 VCQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYTTCYAFLVL 164

Query: 188 SYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFAL-----VRDGMTTNE 242
            Y    L +   SG +  N+  +   +L      +++  T + F +     V    TT E
Sbjct: 165 IYTCYELGTWFNSGSF--NRELIDFQLLGVALLAVAVFITVLAFTVFSIYQVCKNQTTIE 222

Query: 243 KDKWYTIHKLMRNEQLLKLNND 264
                 +H + R  + L++ ND
Sbjct: 223 ------VHGMRRYRRDLEIIND 238

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 58.2 bits (139), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 63/131 (48%), Gaps = 10/131 (7%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATI 192
           CR+C + K  R  HCS C +C L  DHHC W  +C+G  N +YF  FLL   +  S    
Sbjct: 133 CRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTA-YSILVF 191

Query: 193 RLSSVAPSGLWRS---NKSFLSLMILVCCFAVISISFTYMQFA-----LVRDGMTTNEKD 244
            L+       +RS   N+  ++L +L+     + I+ + + F      LV    TT E  
Sbjct: 192 FLTGADLLMWFRSQGYNQELINLPLLIVWILSLVITISMLAFTSYTIYLVAKNQTTIEMY 251

Query: 245 KWYTIHKLMRN 255
           +W T ++  RN
Sbjct: 252 EW-TNYRNQRN 261

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 30/49 (61%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           C  C++ K  R  HCS C +C L  DHHCVW   CIG  N+++F  FLL
Sbjct: 171 CVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLL 219

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYAT 191
           VC+SC   K  R  HCS C  C+L  DHHC W   C+G  N ++F  FL+  C++ S   
Sbjct: 105 VCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIY-CTVYSILV 163

Query: 192 IRLSSV 197
           + LSS+
Sbjct: 164 LILSSM 169

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 62/142 (43%), Gaps = 17/142 (11%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYAT 191
           VC+ C + K  R  HCS C  CIL  DHHC W   C G  N ++F  FL+       Y T
Sbjct: 105 VCQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLM-------YTT 157

Query: 192 -----IRLSSVAPSGLWRSNKSF----LSLMILVCCFAVISISFTYMQFALVRDGMTTNE 242
                + + +    G W ++ SF    + L +L      I++  + + F+        N 
Sbjct: 158 FYAFLVLIDTCYELGTWFNSGSFSRELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNN 217

Query: 243 KDKWYTIHKLMRNEQLLKLNND 264
           +     +H + R  + L++ ND
Sbjct: 218 QTT-IELHSMRRYRRDLEILND 238

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 62/142 (43%), Gaps = 17/142 (11%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYAT 191
           VC+ C + K  R  HCS C  CIL  DHHC W   C G  N ++F  FL+   + L    
Sbjct: 105 VCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMY--TTLYAFL 162

Query: 192 IRLSSVAPSGLWRSNKSF---------LSLMILVCCFAVISISFTYMQFALVRDGMTTNE 242
           + + +    G W ++ SF         L + +L     +  ++FT      V    TT E
Sbjct: 163 VLIYTCYELGTWFNSGSFNRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQTTIE 222

Query: 243 KDKWYTIHKLMRNEQLLKLNND 264
                 +H + R  + L++ ND
Sbjct: 223 ------VHGMRRYRRDLEILND 238

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 47/105 (44%), Gaps = 6/105 (5%)

Query: 132 VCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNC----SML 187
           VC+ C + K  R  HCS C  CIL  DHHC W   C G  N + F  FL+        +L
Sbjct: 105 VCQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTFYAFLVL 164

Query: 188 SYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFA 232
            Y+   L +   SG +  N+  +   +L      I+I  + + F 
Sbjct: 165 IYSCYELGTWFHSGSF--NQELIDFHLLGVALLAIAIFISVLAFT 207

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 12/139 (8%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLG----NYQYFYLFLLSNCSMLS 188
           C  C   K  R+ HC  C +C+LV DHHC W  NC+GL      +  F   + +   +L 
Sbjct: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLH 139

Query: 189 YATIRL-----SSVAPSGLWRSNK-SFLSLMILVCCFAVISISFTYMQFA--LVRDGMTT 240
           Y   R+     +  A + L    +  FL+++  +  F +++IS  +++     + +G T 
Sbjct: 140 YFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNGRTQ 199

Query: 241 NEKDKWYTIHKLMRNEQLL 259
            E  +   I  L  +++LL
Sbjct: 200 IEAWEMDRIENLFYHQRLL 218

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 143 RSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL----LSNCSMLS 188
           R+ HC  C  C+++ DHHC W  NC+G  NY +F  FL    +S  ++LS
Sbjct: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLS 149

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 59/150 (39%), Gaps = 15/150 (10%)

Query: 61  GIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEI 120
           G + YC  + Y  VY +       +   C   VL   +++ +  IV+        V P +
Sbjct: 29  GTWAYCHKLCYERVYRDFGHKATAIGLICTCCVLDALIIAIWVLIVSCGPGHQPGVAPHL 88

Query: 121 PFDGIIFHDNIV---------------CRSCRLKKAARSKHCSICGRCILVADHHCVWLN 165
             D     +  V               C +C+  K  R+KH S  G C+   DH+CVWL 
Sbjct: 89  LVDSADLENTTVAPNCYQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLG 148

Query: 166 NCIGLGNYQYFYLFLLSNCSMLSYATIRLS 195
             IG  NY+ F  F+     +L    I +S
Sbjct: 149 AVIGFKNYRLFVQFVFYFAVLLMIVWITIS 178

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           C +C   K+ RS H S+   CI   DH+C+WL   IG  NY+ F +FL 
Sbjct: 119 CSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFVIFLF 167

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 13/113 (11%)

Query: 131 IVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL-SNCSMLSY 189
           I C +C+  K  R+ H    G CI   DHHC+W+   IG  NY  F  F+   +C +L +
Sbjct: 122 IWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYFSCLLLIF 181

Query: 190 ATIRLSSVA-----PSGLWRSNKSFLSLMILVCCFAVISIS-------FTYMQ 230
               +S +      P   ++ + + + ++IL   F+++++S       FT+M 
Sbjct: 182 WISIVSYIKRIVDYPHTGYKLDPNLIVILILSVPFSIMTLSLFLSHVYFTFMN 234

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%), Gaps = 12/127 (9%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATI 192
           C  C+  K+ R+ H    G C+   DH+C WL   IG GNY  F  FL+    +L    I
Sbjct: 126 CAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLVYMDCLLLIMWI 185

Query: 193 RLSSVAPSGLWRSNKSFLSLMILV--CCFAV----------ISISFTYMQFALVRDGMTT 240
            +S       +R + + +++ IL   C   V          IS++ T ++  +++     
Sbjct: 186 SMSPFIRVYTFRRDGNLIAIYILSVWCSLFVTGLLTAHIYMISLNLTSLEGIILKKTPKK 245

Query: 241 NEKDKWY 247
           N + K Y
Sbjct: 246 NAEPKPY 252

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 54/102 (52%), Gaps = 9/102 (8%)

Query: 131 IVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQ-------YFYLFLLSN 183
           I C +C+  K+ R+ H S  G CI   DH+CVW+   +G  NY+       YF+LF +  
Sbjct: 123 IWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFTIYM 182

Query: 184 CSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISIS 225
            + ++ + +R    + S + R N + L ++ L CC A++ + 
Sbjct: 183 IASIA-SFLRRIIKSRSQIPRVNPNILVVLAL-CCMAMLMVG 222

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 94  LALPLLSGYYTIVTSPHDTITY--VGPEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICG 151
           L LP+ S   T  TS + ++ Y  V P   +        I C  C+  K  R+ H S  G
Sbjct: 90  LILPIASEEKTSNTSQNTSVEYDAVVPPKCYQSDPHGYPIWCSECQSLKMERTHHSSELG 149

Query: 152 RCILVADHHCVWLNNCIGLGNYQYFYLF 179
            CI   DH+C+W+   IG  NY+ F  F
Sbjct: 150 HCIPRFDHYCMWIGTVIGRDNYRLFVQF 177

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 7/101 (6%)

Query: 131 IVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYA 190
           I C +C+  KA R+ H S  G CI   DH+CVW+   +G  NY+ F  F     +   + 
Sbjct: 130 IWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFAIFV 189

Query: 191 TIRLSSVAPS------GLWRSNKSFLSLMILVCCFAVISIS 225
            +  +S  P        + R N + L +M+ +C  A + + 
Sbjct: 190 IVSTASFLPKIIRSQPHVPRVNPNIL-IMMGLCGMATLMVG 229

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 43/95 (45%), Gaps = 7/95 (7%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQ-------YFYLFLLSNCS 185
           C +C+  K  RS H  +   C+   DH+CVWL   IG  NY+       YF ++L++   
Sbjct: 127 CSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTASL 186

Query: 186 MLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFA 220
            ++    R+           N + + L ILV  FA
Sbjct: 187 TIALFMKRIVDYNKEHDLTLNLNIIVLFILVLAFA 221

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 44/105 (41%), Gaps = 16/105 (15%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLS---- 188
           C  C+  K  R+ H S  G C+   DH+CVW+   IG  NY  F  F+      LS    
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIWV 182

Query: 189 ------YATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFT 227
                 +  IR     P   + +N      +I++  FA++   FT
Sbjct: 183 SIVSYIHMIIRKRPNQPHHHFNTN------LIIILVFAILGWLFT 221

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 26/49 (53%)

Query: 131 IVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLF 179
           I C  C+  K  RS H S  G CI   DH+CVW+   IG  NY+ F  F
Sbjct: 129 IWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQF 177

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 2/94 (2%)

Query: 90  LPVVLALPLLSGYYTI--VTSPHDTITYVGPEIPFDGIIFHDNIVCRSCRLKKAARSKHC 147
           LP V    +L   ++I  +  P +T   + P + +      + I C +C   K  R+ H 
Sbjct: 82  LPKVPPYMILPEDFSIDRIGDPAETAHSLVPPVCYQSCPRGNPIWCSACDSVKTERAHHS 141

Query: 148 SICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           S    C+   DH C WL   IG  NY++F  F++
Sbjct: 142 SDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVM 175

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYF 176
           C  C+  K +RS H    GRCIL  DH+C W+   I   NY+ F
Sbjct: 118 CTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (51%), Gaps = 10/93 (10%)

Query: 131 IVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQY-----FYLFLLSNCS 185
           I C +C+  K +R+ H +  G C+   DH+CVW+   +G  NY+      FYL L+    
Sbjct: 126 IWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVVLIL 185

Query: 186 MLSYATIRLSSVAPSGLWRSNKSFLSLMILVCC 218
           M+S AT ++  +  S    +N +  ++  L CC
Sbjct: 186 MISIAT-QMRQMKGS----ANGNVYAVFALACC 213

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%)

Query: 131 IVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL 180
           I C  C+  K  R+ H S  G C+   DH+C+W    IG  NY+ F  F+
Sbjct: 130 IWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFV 179

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 131 IVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL 180
           I C  C+  K  R+ H S  G C+   DH+C+W+   IG  NY+ F  F+
Sbjct: 135 IWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFV 184

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           C  C+  K  R+ H    G C+   DH+CVWL   IG  NY+ F  FL+
Sbjct: 122 CSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLM 170

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLF 179
           C  C+  K  R+ H +  G C+   DH+CVW+   +G  NY+ F  F
Sbjct: 127 CSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 68/155 (43%), Gaps = 20/155 (12%)

Query: 51  KYWLVPAFYTGIYIYCSFVFYVHVYGEIRSGLYTLEARCLPVVLALPLLSGYYT----IV 106
           K   V   + G  +  + V++ H+        +T+E     V++A+ L + +Y     ++
Sbjct: 387 KSPFVSGIFFGSVVLLTVVWFFHILP------WTIEEGESHVLMAIILFAVFYIFSKLLI 440

Query: 107 TSP--------HDTITYVGPEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVAD 158
           + P        HD I  +  E+  D   F     C     +K  RSK+  +    +   D
Sbjct: 441 SDPGCIPPETNHDNIRNIIKEL-LDVGKFDSKNFCLESWTRKPLRSKYSHLNNALVARFD 499

Query: 159 HHCVWLNNCIGLGNYQYFYLF-LLSNCSMLSYATI 192
           H C W+ N +GL N++ F  F LL    ++++A++
Sbjct: 500 HFCPWIYNDVGLKNHKNFIGFILLVEAGIITFASL 534

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%)

Query: 127 FHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           F  N  C    ++K  RS++  +    +   DH C W+ N IGL N++ F LF++
Sbjct: 473 FDTNNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFII 527

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 63/149 (42%), Gaps = 23/149 (15%)

Query: 111 DTITYVGPEIPFDGIIFHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGL 170
           +TI+ +  E  FD   F     C    ++K  RSK+  +    IL  DH+C W+ N +GL
Sbjct: 439 ETISNLLKEGKFDTRSF-----CLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGL 493

Query: 171 GNYQYFYLFLLS-NCSMLSYATIRLSSVAP----------------SGLWRSNKSFLSLM 213
            N++ F  F+L+    + S+  + L                     SGL     +FL +M
Sbjct: 494 KNHKLFIFFILALELGIFSFVKVCLKYFDELDMDGDCFILGDDDLCSGLIGDRFTFL-IM 552

Query: 214 ILVCCFAVISISFTYMQFALVRDGMTTNE 242
              C  AV   S   +Q   +  G+T +E
Sbjct: 553 TWACIQAVWIFSLVIVQLFQITKGLTNSE 581

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 131 IVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYF 176
           I C  C+  K  R  H    G CI   DH+C W+   IG  NY+ F
Sbjct: 115 IWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLF 160

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%)

Query: 131 IVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYF 176
           I C +C+  K  R+ H    G C+   DH C +L + IG  NY+ F
Sbjct: 125 IWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLF 170

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL-LSNCSMLSY 189
           C     +K  RS+  S+    +   DH+C W+ N +GL N++ F  F+ L  C +L++
Sbjct: 471 CIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFITLMECGILTF 528

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           C     +K  RSK+ S+    +   DH+C W+ N +GL N++ F  F+ S
Sbjct: 472 CIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITS 521

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL 180
           C    ++K  RS+  S+ G  I   DH+C W+ N +GL N++ F  F+
Sbjct: 462 CIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFV 509

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           C    ++K  RSK  +     +   DH+C W+ N IGL N++ F  F++S
Sbjct: 463 CIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIIS 512

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           C S  ++K  RSK  +     +   DH C W+ N IGL N++ F  F+L
Sbjct: 452 CISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFIL 500

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           C     +K  RSK     G  +   DH C W+ N IGL N++ F  F L+
Sbjct: 445 CVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALT 494

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           C     +K  RSK+    G  +   DH+C W+ N +GL N++ F  F ++
Sbjct: 448 CVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVT 497

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 130 NIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           N  C     +K  RSK+    G  +   +H+C W+ N IGL N++ F  F  S
Sbjct: 428 NNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFS 480

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLS 188
           C     +K  RSK        I+  DH C W+ N +GL N++ F  FLLS  S +S
Sbjct: 454 CVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVS 509

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL 180
           C     +K  RSK  S+    +   DH+C W+ N +GL N++ F  F+
Sbjct: 472 CIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 127 FHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           F     C     +K+ RSK+    G  +   DH+C W+ N IGL N++    F ++
Sbjct: 436 FDKENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKNHKLSLFFAMT 491

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 127 FHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           F     C    +KK  RS+  S+    +   DH+C W+ N IGL N++ F + +L
Sbjct: 458 FDSKNFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCIL 512

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           C     +K  RS++  +    +   DH+C W+ N +GL N++ F  F+LS
Sbjct: 464 CIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILS 513

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL 180
           C    ++K  RSK   +    +   DH+C W+ N +GL N++ F  F+
Sbjct: 472 CIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>NDAI0C06030 Chr3 complement(1385827..1387548) [1722 bp, 573 aa]
           {ON} Anc_8.218
          Length = 573

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 176 FYLFLLSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVR 235
           F L ++  C+M SY  I  S + PSGL +SNK    L I +  FA+ +  F +M    +R
Sbjct: 191 FVLLIIVACAMGSYIDIDRSKIGPSGLLKSNKLGWQL-IYILVFAIFTNDF-FMSGFWLR 248

Query: 236 DGMTTNEKD 244
              + ++KD
Sbjct: 249 TFASRSDKD 257

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 139 KKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLS 182
           +K  R K  S   R +L  DH+C W+ N +GL N++ F  +++S
Sbjct: 466 RKPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMS 509

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           C    ++K  RS   ++    +   DH C W+ N IGL N++ F  F+L
Sbjct: 457 CLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL 505

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 143 RSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           RSK+       I   DH C W+ N IGL N++ FY+F++
Sbjct: 478 RSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVV 516

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL 180
           C    ++K  RSK   +    +   DH+C W+ N IGL N++ F +F+
Sbjct: 468 CLETWVRKPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFI 515

>SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {ON}
           similar to uniprot|Q75BN0 Ashbya gossypii ACR241C
           ACR241Cp and weakly similar to YKR064W uniprot|P36023
           Saccharomyces cerevisiae YKR064W Hypothetical ORF
          Length = 875

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 131 IVCRSCRLKKAARSKHCSICGRCILVADHH-CVWLNNCIGLG 171
           +VC +C+ +K+   K    C  C+ + D   C +LN  +G G
Sbjct: 11  VVCSNCKRRKSKCDKQKPACSNCVRLGDEATCTYLNEPVGKG 52

>NCAS0A03750 Chr1 (756284..758023) [1740 bp, 579 aa] {ON} Anc_8.218
          Length = 579

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 176 FYLFLLSNCSMLSYATIRLSSVAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVR 235
           F L ++  C+M SY  I  S + PSGL + NK    L + +  FA+ +  F +M    +R
Sbjct: 191 FVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQL-VYILTFAIFTNDF-FMSGFWLR 248

Query: 236 DGMTTNEKD 244
              + ++KD
Sbjct: 249 TFASRSDKD 257

>TPHA0B03510 Chr2 (816477..818174) [1698 bp, 565 aa] {ON} Anc_8.218
          Length = 565

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 176 FYLFLLSNCSMLSYATIRLSSVAPSGLWRSNK 207
           F L ++ +C+M SY +I  S + PSGL ++N+
Sbjct: 191 FILLIIVSCAMGSYISIDKSKIEPSGLLKANR 222

>Kpol_1055.41 s1055 complement(106667..108388) [1722 bp, 573 aa]
           {ON} complement(106667..108388) [1722 nt, 574 aa]
          Length = 573

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 176 FYLFLLSNCSMLSYATIRLSSVAPSGLWRSNK 207
           F L ++  C+M SY  I  S + PSGL ++NK
Sbjct: 191 FILLIIVACAMGSYVDIDKSLIGPSGLLKANK 222

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 28/55 (50%)

Query: 127 FHDNIVCRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLL 181
           F+ +  C    ++K  R     +  + +   DH+C W+ N +GL N++ +  FL+
Sbjct: 399 FNCHTFCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLI 453

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 4/41 (9%)

Query: 143 RSKHCSICGRCILVA--DHHCVWLNNCIGLGNYQYFYLFLL 181
           RSK+ +   R +L+A  DH+C W+ N IG  N++ F  F++
Sbjct: 466 RSKYKT--ARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIM 504

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 15/23 (65%)

Query: 132 VCRSCRLKKAARSKHCSICGRCI 154
            C +CRLKK   SKH   CG+C+
Sbjct: 10  ACDNCRLKKLKCSKHFPKCGQCL 32

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.141    0.475 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,034,708
Number of extensions: 1476478
Number of successful extensions: 5219
Number of sequences better than 10.0: 131
Number of HSP's gapped: 5209
Number of HSP's successfully gapped: 132
Length of query: 340
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 230
Effective length of database: 40,868,139
Effective search space: 9399671970
Effective search space used: 9399671970
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)