Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_42558.324ON93793746670.0
SAKL0H15532g8.324ON94194134360.0
AGL196C8.324ON93593634170.0
Suva_10.2228.324ON94394333820.0
Skud_12.1988.324ON94394333620.0
YLR129W (DIP2)8.324ON94394233510.0
NCAS0C032608.324ON98395533450.0
Smik_12.1928.324ON94394233350.0
TDEL0F045008.324ON93893833030.0
NDAI0G025808.324ON95895932850.0
Kpol_1036.698.324ON93693932810.0
TPHA0C008108.324ON93793832640.0
ZYRO0F10406g8.324ON93893832240.0
CAGL0M04279g8.324ON94094032240.0
Kwal_56.239208.324ON93793832180.0
KLTH0G12276g8.324ON93793832140.0
KAFR0H022608.324ON93894231910.0
TBLA0A039508.324ON93693231660.0
KNAG0G024508.324ON94294231560.0
KLLA0D16390g8.324ON93694128560.0
TDEL0B020108.435ON8056493471e-32
Smik_12.2798.435ON8176793372e-31
YLR222C (UTP13)8.435ON8176773301e-30
NCAS0C027108.435ON8156253183e-29
AGR180W8.435ON8066522997e-27
Ecym_41348.435ON8102332872e-25
KNAG0A025108.435ON8492362854e-25
NDAI0E034408.435ON8572082792e-24
TBLA0I025708.435ON8482172782e-24
Kwal_27.115858.435ON8232182773e-24
KLTH0E10120g8.435ON8262232747e-24
Skud_12.2858.435ON8171992712e-23
KLLA0F13244g8.435ON8142322702e-23
KAFR0H017508.435ON7832252683e-23
TPHA0L010808.435ON8352342684e-23
CAGL0C00737g8.435ON8162222631e-22
Kpol_1031.498.435ON7602132612e-22
ZYRO0A09636g8.435ON8083612561e-21
Suva_10.3168.435ON8182002532e-21
KNAG0A037008.544ON8173122523e-21
SAKL0H12760g8.435ON8411552524e-21
KAFR0E031808.544ON8143152443e-20
NDAI0C054908.544ON8593082372e-19
AEL246C8.544ON8152162363e-19
TBLA0H036208.544ON8123182353e-19
TPHA0I018808.544ON10342092336e-19
Ecym_70388.544ON8003122319e-19
AFR199C2.431ON3342452211e-18
TPHA0L016908.544ON8322222292e-18
KLTH0D04466g2.431ON3192492174e-18
CAGL0M05335g8.544ON8062952239e-18
CAGL0C03608g6.363ON6432232211e-17
Smik_2.3388.544ON8002162221e-17
SAKL0A00660g6.363ON6602382211e-17
NCAS0F018502.431ON3182472131e-17
TBLA0F042406.363ON7273132202e-17
YBR198C (TAF5)8.544ON7982162202e-17
KNAG0D002506.363ON6552422192e-17
NDAI0K023506.363ON7932402193e-17
Skud_2.3248.544ON8022162193e-17
CAGL0E00561g6.363ON8362432193e-17
Kwal_27.120538.544ON7552162183e-17
KAFR0A005102.431ON3192302103e-17
NCAS0D047806.363ON6212272164e-17
SAKL0H09988g8.544ON7492502174e-17
TDEL0B030208.544ON8312162174e-17
KLLA0E23453g8.544ON8262102165e-17
Suva_13.2952.431ON3192302085e-17
Skud_13.2752.431ON3192302085e-17
Smik_13.3052.431ON3192302085e-17
YMR116C (ASC1)2.431ON3192302085e-17
NCAS0A042702.431ON3182472086e-17
NCAS0A151707.534ON4742932136e-17
ZYRO0A12980g8.544ON8242162166e-17
KLTH0E12606g8.544ON7552162157e-17
Suva_4.4528.544ON8002162167e-17
TPHA0M020006.363ON6992452149e-17
NCAS0B022008.544ON8222162141e-16
Kpol_1048.598.544ON8502172141e-16
Skud_3.1566.363ON7132432122e-16
KLLA0F10263g6.363ON6823322112e-16
Ecym_60982.431ON3182282042e-16
Kwal_23.53517.534ON4742212082e-16
NDAI0H027102.431ON3182472032e-16
Kpol_1024.428.544ON8432192113e-16
YCR084C (TUP1)6.363ON7132432093e-16
Smik_3.1836.363ON7092432076e-16
Ecym_25236.363ON6462422067e-16
TBLA0B091002.431ON3172471981e-15
Kpol_1013.377.534ON4682332031e-15
NCAS0A055206.363ON6712652051e-15
AGL234W6.363ON6291602041e-15
TDEL0A077806.363ON6573242032e-15
Kpol_1028.236.363ON7443222032e-15
AEL269C7.534ON4552192002e-15
SAKL0E03960g2.431ON3202371953e-15
TPHA0I032407.534ON4772171994e-15
Kwal_23.64296.363ON7502352014e-15
KAFR0C047406.363ON6651592004e-15
Ecym_28087.534ON4653131984e-15
KLTH0A07282g6.363ON7251592005e-15
KNAG0E023102.431ON3192301935e-15
TPHA0G023802.431ON3182301935e-15
Suva_3.1216.363ON7001591996e-15
ZYRO0D01122g7.534ON4663151976e-15
KLTH0A00880g7.534ON4712321967e-15
SAKL0F15972g7.534ON4702451959e-15
KAFR0B003707.534ON4612381959e-15
Kpol_297.72.431ON3182341882e-14
TPHA0G016108.672ON4141441912e-14
KNAG0F038707.534ON4652171904e-14
TBLA0F005206.363ON6633361914e-14
CAGL0G09845g7.534ON5002161896e-14
TDEL0H003707.534ON4652181871e-13
ZYRO0F07282g8.672ON4271601861e-13
NCAS0B078401.247ON5892191881e-13
YDL145C (COP1)7.322ON12011761891e-13
KLLA0E12277g2.431ON3262541821e-13
ZYRO0D17292g6.363ON7183411872e-13
NCAS0A139407.322ON12051591872e-13
Skud_4.1097.322ON12011761863e-13
Smik_4.907.322ON12011761863e-13
Suva_4.997.322ON12011761844e-13
Ecym_80727.322ON12011881845e-13
Suva_16.5107.534ON4653221806e-13
KAFR0L013907.322ON12061701836e-13
KAFR0F043506.340ON5151641808e-13
ZYRO0G20152g2.431ON3192301759e-13
TPHA0D045007.322ON12081461819e-13
TBLA0F022307.322ON12161581819e-13
TBLA0E007607.534ON3842341771e-12
Kpol_1028.416.340ON5121671791e-12
KNAG0C014101.247ON6531941791e-12
SAKL0F10648g7.322ON12031581801e-12
NDAI0A020907.322ON12001701801e-12
Ecym_24986.340ON5421421782e-12
KAFR0I018807.231ON5913251782e-12
Ecym_24018.672ON4261561762e-12
KLLA0F04884g7.322ON12121741782e-12
Kpol_1070.117.231ON6661821773e-12
NDAI0G038303.25ON5102971753e-12
Kpol_2001.657.322ON12061461773e-12
ADR077C7.322ON12041581773e-12
Smik_9.1447.231ON6301821763e-12
TDEL0C022407.322ON12011761773e-12
Smik_3.1726.340ON5151641744e-12
AER263C6.340ON5131671744e-12
Skud_3.1456.340ON5151641744e-12
CAGL0I03718g7.322ON12011421764e-12
Suva_9.1547.231ON6381821754e-12
KNAG0B027207.322ON12041411764e-12
TDEL0A075506.340ON5151671744e-12
SAKL0F08404g7.231ON6431821745e-12
TBLA0F041306.340ON5141641735e-12
YIL046W (MET30)7.231ON6401821745e-12
KLTH0H01892g7.322ON12091591755e-12
KAFR0I010504.106ON8422491746e-12
YCR072C (RSA4)6.340ON5151641736e-12
Kwal_56.245267.322ON12101591746e-12
Skud_9.1237.231ON6391821736e-12
KNAG0J016808.672ON3981531708e-12
TPHA0B011201.247ON7191231728e-12
TBLA0D041307.231ON5741261729e-12
ZYRO0F11110g7.322ON12011591739e-12
TDEL0A061808.672ON4341561709e-12
Suva_3.1096.340ON5151641711e-11
Kpol_1031.361.247ON7061901721e-11
TPHA0M018306.340ON5151671701e-11
NCAS0G036001.399ON3272021671e-11
Kpol_487.71.399ON3032751661e-11
SAKL0A01276g6.340ON5151671692e-11
Kpol_1032.614.106ON8222341702e-11
ADL082C7.231ON5692011682e-11
TDEL0H021307.231ON5841901683e-11
KNAG0I028406.340ON5191701673e-11
NCAS0A134307.231ON6082611683e-11
CAGL0J03476g6.340ON5171671673e-11
KNAG0C028904.106ON8302531683e-11
TPHA0P014903.25ON4592741663e-11
ZYRO0D16742g7.231ON6081171673e-11
Suva_14.223.25ON4692811664e-11
SAKL0H06666g8.672ON4412191654e-11
NDAI0A026107.231ON7671161674e-11
TBLA0C041104.106ON8492231674e-11
Kwal_23.57697.231ON6272461664e-11
NDAI0J003307.534ON4722141655e-11
KLTH0A04114g7.231ON6582361665e-11
ZYRO0E04620g1.399ON3032801615e-11
Kwal_26.75702.431ON2181881576e-11
Skud_14.223.25ON4672811646e-11
NDAI0I003506.340ON5153131646e-11
NCAS0C044503.25ON4611211637e-11
ZYRO0D08206g6.340ON5153671638e-11
Ecym_43437.231ON5832331648e-11
KLLA0F27511g7.231ON6231581648e-11
KLTH0A06754g6.340ON5141671639e-11
TBLA0B043908.585ON3361801609e-11
KLLA0C08547g6.340ON5153741621e-10
Kwal_55.220673.25ON4511811621e-10
TBLA0C018408.672ON4231531611e-10
Kwal_27.122398.585ON3162001591e-10
TDEL0F002701.534ON7051411631e-10
KAFR0H024508.672ON4171441611e-10
CAGL0L00781g7.231ON6731821621e-10
ZYRO0G03586g6.177ON9711831631e-10
KLTH0D11132g8.672ON4371531601e-10
TDEL0B059701.399ON3032791571e-10
Kwal_26.87768.672ON4331441601e-10
SAKL0D08756g1.399ON3032671571e-10
AFL118W6.239ON8323031621e-10
NCAS0C016808.672ON4311541601e-10
SAKL0D04796g1.247ON7691581622e-10
KLTH0H12122g1.399ON3032651572e-10
YNL317W (PFS2)3.25ON4652811602e-10
Smik_16.4427.534ON4701551592e-10
Kwal_0.2121.399ON3032011562e-10
NCAS0D046106.340ON5151711592e-10
Kpol_1014.193.25ON4522591593e-10
TBLA0I022806.325ON9271601603e-10
KLTH0F19294g3.25ON4511851583e-10
AEL314W1.247ON7151711603e-10
Kpol_1072.178.672ON4331451583e-10
Ecym_80901.247ON7161161603e-10
Suva_14.3421.399ON3032801553e-10
NDAI0G053401.247ON7181291603e-10
NDAI0A033104.106ON8172201603e-10
SAKL0A03872g6.239ON8783051593e-10
Skud_14.3211.399ON3032801544e-10
Smik_14.143.25ON4662811574e-10
Smik_10.1261.247ON7121811594e-10
KLLA0A04928g4.106ON8612391594e-10
Suva_6.1871.247ON7141541584e-10
SAKL0C13266g3.25ON4591211574e-10
Smik_14.3221.399ON3032751535e-10
YNL006W (LST8)1.399ON3032751535e-10
KLLA0F11231g8.672ON4341541565e-10
Skud_2.1034.106ON8402561585e-10
NDAI0C026001.399ON3032021535e-10
ACR137W8.672ON4252031565e-10
KNAG0H016901.399ON3032761535e-10
TPHA0C011507.231ON6871901585e-10
NCAS0A034704.106ON8162381585e-10
Smik_6.3488.672ON4511341565e-10
KLLA0F21406g1.247ON7051201576e-10
TPHA0O007101.399ON3042021536e-10
CAGL0H03729g1.399ON3032751536e-10
CAGL0E02805g4.106ON8402311576e-10
YPR178W (PRP4)7.534ON4652191566e-10
KLLA0E07085g3.25ON4521241556e-10
KNAG0D016907.231ON6541751567e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4255
         (937 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...  1802   0.0  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...  1328   0.0  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...  1320   0.0  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...  1307   0.0  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...  1299   0.0  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...  1295   0.0  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...  1293   0.0  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...  1289   0.0  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...  1276   0.0  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...  1269   0.0  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...  1268   0.0  
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...  1261   0.0  
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...  1246   0.0  
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...  1246   0.0  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...  1244   0.0  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...  1242   0.0  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...  1233   0.0  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...  1224   0.0  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...  1220   0.0  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...  1104   0.0  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...   138   1e-32
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...   134   2e-31
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...   131   1e-30
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...   127   3e-29
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...   119   7e-27
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...   115   2e-25
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...   114   4e-25
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...   112   2e-24
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...   111   2e-24
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...   111   3e-24
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...   110   7e-24
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...   108   2e-23
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...   108   2e-23
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...   107   3e-23
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....   107   4e-23
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...   105   1e-22
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...   105   2e-22
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...   103   1e-21
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...   102   2e-21
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...   101   3e-21
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...   101   4e-21
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    99   3e-20
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             96   2e-19
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    96   3e-19
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    95   3e-19
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    94   6e-19
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    94   9e-19
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    90   1e-18
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    93   2e-18
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    88   4e-18
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    91   9e-18
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    90   1e-17
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    90   1e-17
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    90   1e-17
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    87   1e-17
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    89   2e-17
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    89   2e-17
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    89   2e-17
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    89   3e-17
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    89   3e-17
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    89   3e-17
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    89   3e-17
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    86   3e-17
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     88   4e-17
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    88   4e-17
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    88   4e-17
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    88   5e-17
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    85   5e-17
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    85   5e-17
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    85   5e-17
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    85   5e-17
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    85   6e-17
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    87   6e-17
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    88   6e-17
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    87   7e-17
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    88   7e-17
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    87   9e-17
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    87   1e-16
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    87   1e-16
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    86   2e-16
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    86   2e-16
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    83   2e-16
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    85   2e-16
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    83   2e-16
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    86   3e-16
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    85   3e-16
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    84   6e-16
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    84   7e-16
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    81   1e-15
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    83   1e-15
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    84   1e-15
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    83   1e-15
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    83   2e-15
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    83   2e-15
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    82   2e-15
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    80   3e-15
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    81   4e-15
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    82   4e-15
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    82   4e-15
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    81   4e-15
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    82   5e-15
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    79   5e-15
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    79   5e-15
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    81   6e-15
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    80   6e-15
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    80   7e-15
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    80   9e-15
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    80   9e-15
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    77   2e-14
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    78   2e-14
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    78   4e-14
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    78   4e-14
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    77   6e-14
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    77   1e-13
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    76   1e-13
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    77   1e-13
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    77   1e-13
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    75   1e-13
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    77   2e-13
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    77   2e-13
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    76   3e-13
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    76   3e-13
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    75   4e-13
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    75   5e-13
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    74   6e-13
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    75   6e-13
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    74   8e-13
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    72   9e-13
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    74   9e-13
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    74   9e-13
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               73   1e-12
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    74   1e-12
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    74   1e-12
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    74   1e-12
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    74   1e-12
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    73   2e-12
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    73   2e-12
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    72   2e-12
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    73   2e-12
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    73   3e-12
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      72   3e-12
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    73   3e-12
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    73   3e-12
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    72   3e-12
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    73   3e-12
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    72   4e-12
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    72   4e-12
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    72   4e-12
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    72   4e-12
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    72   4e-12
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    72   4e-12
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    72   4e-12
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    72   5e-12
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    71   5e-12
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    72   5e-12
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    72   5e-12
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    72   6e-12
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    71   6e-12
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    72   6e-12
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    71   6e-12
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    70   8e-12
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    71   8e-12
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    71   9e-12
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    71   9e-12
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    70   9e-12
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    70   1e-11
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    71   1e-11
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    70   1e-11
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    69   1e-11
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    69   1e-11
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    70   2e-11
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    70   2e-11
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    69   2e-11
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    69   3e-11
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    69   3e-11
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    69   3e-11
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    69   3e-11
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    69   3e-11
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    69   3e-11
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    69   3e-11
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    69   4e-11
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    68   4e-11
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     69   4e-11
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    69   4e-11
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    69   4e-11
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      68   5e-11
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    69   5e-11
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    67   5e-11
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    65   6e-11
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    68   6e-11
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       68   6e-11
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      67   7e-11
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    67   8e-11
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    68   8e-11
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    68   8e-11
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    67   9e-11
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    66   9e-11
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    67   1e-10
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    67   1e-10
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    67   1e-10
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    66   1e-10
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    67   1e-10
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    67   1e-10
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    67   1e-10
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    67   1e-10
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    66   1e-10
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    65   1e-10
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    66   1e-10
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    65   1e-10
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    67   1e-10
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     66   1e-10
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    67   2e-10
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    65   2e-10
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    66   2e-10
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    66   2e-10
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    65   2e-10
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     66   2e-10
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    66   3e-10
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    66   3e-10
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    65   3e-10
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    66   3e-10
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    65   3e-10
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    66   3e-10
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    64   3e-10
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    66   3e-10
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     66   3e-10
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    66   3e-10
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    64   4e-10
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    65   4e-10
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    66   4e-10
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    66   4e-10
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    65   4e-10
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    65   4e-10
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    64   5e-10
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    64   5e-10
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    65   5e-10
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    65   5e-10
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      64   5e-10
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    65   5e-10
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    64   5e-10
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    65   5e-10
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     65   5e-10
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    65   5e-10
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    65   6e-10
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    64   6e-10
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    64   6e-10
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    65   6e-10
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    65   6e-10
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    64   6e-10
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    65   7e-10
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    65   7e-10
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    65   7e-10
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    65   7e-10
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    65   7e-10
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    65   8e-10
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    65   8e-10
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    64   8e-10
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    61   8e-10
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    64   9e-10
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    64   9e-10
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     64   9e-10
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    65   9e-10
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    63   9e-10
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    65   9e-10
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    64   1e-09
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    64   1e-09
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    64   1e-09
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    64   1e-09
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       64   1e-09
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    63   1e-09
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    64   1e-09
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    62   1e-09
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    64   1e-09
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    64   1e-09
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    62   1e-09
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    63   2e-09
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    63   2e-09
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    63   2e-09
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    64   2e-09
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    62   2e-09
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    63   2e-09
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    63   2e-09
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    63   3e-09
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    63   3e-09
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    63   3e-09
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    63   3e-09
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    62   3e-09
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    62   4e-09
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    62   4e-09
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    62   4e-09
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    62   4e-09
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    62   4e-09
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    62   4e-09
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    62   5e-09
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    62   5e-09
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    61   5e-09
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    62   5e-09
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    62   5e-09
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    62   5e-09
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    61   6e-09
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    61   6e-09
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    62   6e-09
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    62   6e-09
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    62   6e-09
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    60   6e-09
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    62   6e-09
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    60   7e-09
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    60   7e-09
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    62   7e-09
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    60   8e-09
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    62   8e-09
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    61   8e-09
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    61   9e-09
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    61   9e-09
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    61   1e-08
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    61   1e-08
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    61   1e-08
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    61   1e-08
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    61   1e-08
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    61   1e-08
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    61   1e-08
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    59   1e-08
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    60   1e-08
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    60   1e-08
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    60   2e-08
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    60   2e-08
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    60   2e-08
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    60   2e-08
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    60   2e-08
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    60   2e-08
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    60   2e-08
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    59   2e-08
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      59   2e-08
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    60   2e-08
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    60   2e-08
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    60   2e-08
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    59   2e-08
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    60   3e-08
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    60   3e-08
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    60   3e-08
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    59   3e-08
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    59   3e-08
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    60   3e-08
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    60   3e-08
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    59   3e-08
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    58   3e-08
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    59   3e-08
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    59   3e-08
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    59   4e-08
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    58   4e-08
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    59   4e-08
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    59   4e-08
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    59   4e-08
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    59   5e-08
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    59   5e-08
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    59   6e-08
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    59   6e-08
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    57   6e-08
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    59   6e-08
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    58   6e-08
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    58   7e-08
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    58   8e-08
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    58   8e-08
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    57   8e-08
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    57   9e-08
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    58   9e-08
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    58   9e-08
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    58   9e-08
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    58   1e-07
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    58   1e-07
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    58   1e-07
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    57   1e-07
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    58   1e-07
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    57   1e-07
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    58   1e-07
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    57   1e-07
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    57   1e-07
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    57   1e-07
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    57   2e-07
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    56   2e-07
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    57   2e-07
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    57   2e-07
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    57   2e-07
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    57   2e-07
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              57   2e-07
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    56   2e-07
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    57   2e-07
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    56   2e-07
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    57   2e-07
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    56   2e-07
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    57   2e-07
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    56   2e-07
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    56   2e-07
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    56   2e-07
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    57   2e-07
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    57   3e-07
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    56   3e-07
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    57   3e-07
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    56   3e-07
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    56   3e-07
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    56   3e-07
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    56   3e-07
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    55   3e-07
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    55   4e-07
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    56   4e-07
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    56   4e-07
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    56   4e-07
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    55   4e-07
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    55   4e-07
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    55   4e-07
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    56   4e-07
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    55   5e-07
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    56   5e-07
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    56   5e-07
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    56   5e-07
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    55   5e-07
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    55   6e-07
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    55   6e-07
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    55   6e-07
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    54   6e-07
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    55   6e-07
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    55   6e-07
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    55   7e-07
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    55   7e-07
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    55   7e-07
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    55   7e-07
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    55   7e-07
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    55   7e-07
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    55   7e-07
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    55   7e-07
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    55   8e-07
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    55   8e-07
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    54   8e-07
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    55   9e-07
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    54   9e-07
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    55   9e-07
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    54   9e-07
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    55   1e-06
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    54   1e-06
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      55   1e-06
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    55   1e-06
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    54   1e-06
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    54   1e-06
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    54   1e-06
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    54   1e-06
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    55   1e-06
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    54   1e-06
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    54   1e-06
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     54   1e-06
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    54   1e-06
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    54   1e-06
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    54   1e-06
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    53   1e-06
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    54   1e-06
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    54   1e-06
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    54   2e-06
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    54   2e-06
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    54   2e-06
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    54   2e-06
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    54   2e-06
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    54   2e-06
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    53   2e-06
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    53   2e-06
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    53   2e-06
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    53   2e-06
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    54   2e-06
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    53   3e-06
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    53   3e-06
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    52   3e-06
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    53   3e-06
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    52   3e-06
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    53   3e-06
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    52   3e-06
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    53   3e-06
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    52   3e-06
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    53   3e-06
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    53   4e-06
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    52   4e-06
TBLA0J01290 Chr10 (294789..296456) [1668 bp, 555 aa] {ON} Anc_7....    52   4e-06
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    52   4e-06
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    52   4e-06
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    52   4e-06
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    52   5e-06
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    52   5e-06
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    52   5e-06
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    52   5e-06
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    52   5e-06
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    51   6e-06
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    52   6e-06
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    52   6e-06
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    52   6e-06
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    51   7e-06
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    52   7e-06
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    51   7e-06
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    51   8e-06
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    51   8e-06
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       51   8e-06
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    51   8e-06
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    52   8e-06
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    50   9e-06
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    51   9e-06
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    52   9e-06
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    51   9e-06
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    50   9e-06
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    51   1e-05
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    51   1e-05
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    50   1e-05
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    51   1e-05
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    51   1e-05
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    51   1e-05
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    51   1e-05
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    51   1e-05
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    50   1e-05
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    51   1e-05
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    50   1e-05
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    51   1e-05
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    50   1e-05
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    51   1e-05
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    51   1e-05
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    50   1e-05
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    50   2e-05
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    51   2e-05
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    50   2e-05
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    51   2e-05
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    50   2e-05
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    50   2e-05
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    50   2e-05
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    50   2e-05
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    50   2e-05
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    50   2e-05
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    50   2e-05
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    50   2e-05
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    50   2e-05
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    50   2e-05
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    50   2e-05
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    50   2e-05
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    50   2e-05
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    50   2e-05
KLLA0F13750g Chr6 complement(1274110..1275972) [1863 bp, 620 aa]...    50   2e-05
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    50   3e-05
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    50   3e-05
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    50   3e-05
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    49   3e-05
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    49   3e-05
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    50   3e-05
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    49   3e-05
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    50   3e-05
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    50   3e-05
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    49   3e-05
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    50   3e-05
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    49   3e-05
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    50   3e-05
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    49   3e-05
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    49   4e-05
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    49   4e-05
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    49   4e-05
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    49   5e-05
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    49   5e-05
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    49   5e-05
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    49   5e-05
Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa] ...    49   6e-05
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    48   6e-05
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    49   6e-05
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    49   6e-05
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    49   6e-05
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    49   6e-05
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    48   7e-05
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    49   7e-05
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    49   7e-05
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    49   7e-05
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    49   7e-05
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    49   7e-05
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    49   7e-05
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    49   7e-05
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    48   8e-05
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    48   8e-05
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    48   8e-05
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    48   8e-05
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    48   8e-05
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    48   8e-05
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    48   9e-05
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    49   9e-05
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    48   9e-05
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    48   9e-05
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    48   9e-05
Kwal_YGOB_27.12717 s27 (1347453..1348746,1348819..1349414) [1890...    48   1e-04
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    48   1e-04
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    48   1e-04
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    47   1e-04
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    48   1e-04
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    48   1e-04
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    48   1e-04
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    48   1e-04
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    48   1e-04
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    48   1e-04
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    47   1e-04
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    47   1e-04
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    48   1e-04
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    47   1e-04
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    48   1e-04
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    48   1e-04
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    48   1e-04
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    48   1e-04
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    48   1e-04
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    48   1e-04
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    47   1e-04
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    48   1e-04
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    47   2e-04
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    47   2e-04
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    47   2e-04
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    47   2e-04
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    47   2e-04
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    47   2e-04
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    47   2e-04
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    47   2e-04
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    47   2e-04
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    47   2e-04
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    47   2e-04
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    47   2e-04
TDEL0B00800 Chr2 (152025..153452) [1428 bp, 475 aa] {ON} Anc_8.8...    47   2e-04
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    47   2e-04
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    47   2e-04
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    46   2e-04
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    46   3e-04
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    47   3e-04
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    46   3e-04
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    46   3e-04
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    47   3e-04
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    46   3e-04
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    46   3e-04
TBLA0A03210 Chr1 complement(762289..764535) [2247 bp, 748 aa] {O...    47   3e-04
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    46   3e-04
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    46   3e-04
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    46   3e-04
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    46   3e-04
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    46   4e-04
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    45   4e-04
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    46   4e-04
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    46   4e-04
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    46   4e-04
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               46   4e-04
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    45   4e-04
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    45   5e-04
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    45   5e-04
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    45   5e-04
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    46   5e-04
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    45   5e-04
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    45   5e-04
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    45   5e-04
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    45   5e-04
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    45   6e-04
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    45   6e-04
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    45   6e-04
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    45   6e-04
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    45   6e-04
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    45   6e-04
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    45   6e-04
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    45   6e-04
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    45   7e-04
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    45   7e-04
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    45   7e-04
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    45   7e-04
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    45   7e-04
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    45   7e-04
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    45   7e-04
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    45   8e-04
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    43   8e-04
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    45   8e-04
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    45   8e-04
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    45   8e-04
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    45   8e-04
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    45   8e-04
KLTH0A05082g Chr1 complement(424327..425985) [1659 bp, 552 aa] {...    45   8e-04
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    45   8e-04
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    45   9e-04
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    45   9e-04
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    45   0.001
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    45   0.001
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    45   0.001
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    45   0.001
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    45   0.001
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    44   0.001
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    45   0.001
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    45   0.001
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    44   0.001
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    45   0.001
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    44   0.001
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    44   0.001
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    44   0.001
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    45   0.001
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    45   0.001
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    44   0.001
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    44   0.001
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    45   0.001
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    44   0.001
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    44   0.001
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    44   0.001
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    44   0.001
Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121...    45   0.001
KNAG0A06340 Chr1 (967160..970114) [2955 bp, 984 aa] {ON} Anc_2.4...    45   0.001
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    44   0.001
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    44   0.001
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    44   0.001
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    44   0.002
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    44   0.002
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    44   0.002
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    44   0.002
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    44   0.002
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    44   0.002
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    44   0.002
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    44   0.002
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    44   0.002
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    44   0.002
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    44   0.002
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    44   0.002
SAKL0F09504g Chr6 complement(728890..730611) [1722 bp, 573 aa] {...    44   0.002
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    44   0.002
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    44   0.002
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    44   0.002
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    44   0.002
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    44   0.002
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    44   0.002
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    44   0.002
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    44   0.002
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    44   0.002
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    44   0.002
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    44   0.002
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    44   0.002
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    44   0.002
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    44   0.002
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    44   0.002
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    43   0.002
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    43   0.002
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    44   0.002
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    44   0.002
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    44   0.003
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    44   0.003
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    43   0.003
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    43   0.003
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    44   0.003
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    43   0.003
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    43   0.003
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    44   0.003
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    43   0.003
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    43   0.003
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    44   0.003
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    43   0.003
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    43   0.003
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    43   0.003
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    43   0.003
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    44   0.003
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    43   0.003
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    44   0.003
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    43   0.004
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    43   0.004
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    43   0.004
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    42   0.004
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    43   0.004
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    43   0.004
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    42   0.004
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    42   0.004
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    43   0.004
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    43   0.004
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    43   0.004
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    43   0.004
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    43   0.004
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    42   0.004
NCAS0E03500 Chr5 complement(694491..696143) [1653 bp, 550 aa] {O...    43   0.004
Kpol_1055.2 s1055 complement(663..2915) [2253 bp, 750 aa] {ON} c...    43   0.004
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    42   0.004
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    43   0.004
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    42   0.004
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    43   0.004
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    42   0.005
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    42   0.005
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    43   0.005
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    42   0.005
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    42   0.005
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    43   0.005
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    43   0.005
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    42   0.005
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    43   0.005
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    42   0.005
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    42   0.005
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    42   0.005
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    42   0.005
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    42   0.005
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    42   0.005
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    42   0.005
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    42   0.006
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    42   0.006
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     42   0.006
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    42   0.006
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    42   0.006
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    42   0.006
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    42   0.006
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    42   0.006
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    42   0.007
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    42   0.007
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    42   0.007
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    42   0.007
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    42   0.007
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    42   0.007
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    42   0.007
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    42   0.007
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    42   0.007
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    42   0.007
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    42   0.007
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    42   0.007
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    42   0.007
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    42   0.007
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    42   0.007
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    42   0.007
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    42   0.008
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    42   0.008
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    42   0.008
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    42   0.008
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    42   0.008
YGL213C Chr7 complement(90054..91247) [1194 bp, 397 aa] {ON}  SK...    42   0.008
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    42   0.008
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    42   0.008
Skud_7.55 Chr7 complement(95372..96565) [1194 bp, 397 aa] {ON} Y...    42   0.008
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    42   0.008
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    42   0.008
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    42   0.008
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    42   0.008
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    42   0.008
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    42   0.008
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    42   0.009
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    42   0.009
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    42   0.009
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    42   0.009
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    41   0.009
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    41   0.009
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    42   0.010
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    42   0.010
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    41   0.011
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    41   0.011
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    42   0.011
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    42   0.011
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    42   0.012
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    41   0.012
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    42   0.012
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    41   0.012
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    41   0.012
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    41   0.012
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    41   0.012
KLLA0F16038g Chr6 complement(1487475..1490063) [2589 bp, 862 aa]...    41   0.012
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    41   0.012
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    41   0.012
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    41   0.013
Smik_4.585 Chr4 complement(1040861..1043125) [2265 bp, 754 aa] {...    41   0.013
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    41   0.014
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    41   0.014
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    41   0.014
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    41   0.014
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    41   0.014
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    41   0.014
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    41   0.014
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    41   0.014
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             41   0.015
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    41   0.015
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    41   0.017
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    41   0.018
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    40   0.019
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    40   0.019
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    40   0.019
TDEL0G00730 Chr7 (147888..152492) [4605 bp, 1534 aa] {ON} Anc_5....    41   0.019
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    40   0.020
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    40   0.020
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    40   0.020
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    40   0.022
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    40   0.022
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    40   0.022
Suva_7.48 Chr7 complement(86451..87644) [1194 bp, 397 aa] {ON} Y...    40   0.023
Smik_7.50 Chr7 complement(84865..86058) [1194 bp, 397 aa] {ON} Y...    40   0.023
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    40   0.023
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    40   0.025
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    40   0.025
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    40   0.025
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    40   0.026
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    40   0.027
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    40   0.028
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    40   0.029
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    40   0.029
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    40   0.032
ACL034W Chr3 (302396..304048) [1653 bp, 550 aa] {ON} Syntenic ho...    40   0.033
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    40   0.034
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    40   0.036
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    40   0.036
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    40   0.036
CAGL0M01430g Chr13 (164428..166683) [2256 bp, 751 aa] {ON} highl...    40   0.037
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    40   0.037
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    40   0.037
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    40   0.038
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    40   0.039
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    39   0.039
Skud_4.592 Chr4 complement(1050634..1052892) [2259 bp, 752 aa] {...    40   0.041
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    39   0.041
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    39   0.042
Suva_2.495 Chr2 complement(871929..874187) [2259 bp, 752 aa] {ON...    40   0.042
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    39   0.047
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    39   0.048
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    39   0.049
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    39   0.049
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    39   0.050
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    40   0.050
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      39   0.050
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    39   0.051
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    39   0.051
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    39   0.052
KNAG0F02280 Chr6 complement(432897..433967) [1071 bp, 356 aa] {O...    39   0.053
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    39   0.053
NCAS0B05410 Chr2 (1008672..1012064) [3393 bp, 1130 aa] {ON} Anc_...    39   0.053
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    39   0.056
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    39   0.059
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    39   0.061
YER082C Chr5 complement(324272..325936) [1665 bp, 554 aa] {ON}  ...    39   0.061
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    39   0.062
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    39   0.064
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    39   0.065
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    39   0.066
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    39   0.066
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    39   0.067
Smik_14.82 Chr14 (149174..150442) [1269 bp, 422 aa] {ON} YNL253W...    39   0.072
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    39   0.073
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    39   0.073
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    39   0.073
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    39   0.074
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    39   0.079
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    39   0.080
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    38   0.080
NDAI0C04390 Chr3 complement(993861..996212) [2352 bp, 783 aa] {O...    39   0.085
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    39   0.085
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    39   0.086
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    38   0.087
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    38   0.088
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    38   0.089
CAGL0J11286g Chr10 (1097912..1099498) [1587 bp, 528 aa] {ON} sim...    39   0.089
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    39   0.091
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    38   0.091
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    38   0.098
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    39   0.099
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    38   0.099
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    39   0.099
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    38   0.10 
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    38   0.10 
TPHA0N01070 Chr14 complement(224464..225525) [1062 bp, 353 aa] {...    38   0.10 
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     38   0.11 
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    38   0.11 
TDEL0F03590 Chr6 (659038..660756) [1719 bp, 572 aa] {ON} Anc_3.4...    38   0.12 
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    38   0.12 
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    38   0.12 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    38   0.12 
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    38   0.13 
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    38   0.13 
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    38   0.13 
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    38   0.13 
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    37   0.14 
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    38   0.14 
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    38   0.15 
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    38   0.15 
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    37   0.15 
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    38   0.15 
Suva_7.166 Chr7 (307962..309014) [1053 bp, 350 aa] {ON} YGL100W ...    37   0.15 
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    37   0.16 
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    38   0.16 
Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W...    37   0.17 
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    38   0.17 
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    37   0.17 
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    38   0.17 
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    37   0.17 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    38   0.18 
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    37   0.18 
KLLA0F09053g Chr6 (842591..843949) [1359 bp, 452 aa] {ON} simila...    37   0.18 
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    37   0.18 
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    37   0.18 
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    37   0.19 
NDAI0I01360 Chr9 complement(331085..332122) [1038 bp, 345 aa] {O...    37   0.19 
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    37   0.19 
NDAI0I02940 Chr9 (693605..694816) [1212 bp, 403 aa] {ON} Anc_3.5...    37   0.19 
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    38   0.19 
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    37   0.19 
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    37   0.19 
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    37   0.19 
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    37   0.20 
CAGL0J10340g Chr10 complement(1010761..1011777) [1017 bp, 338 aa...    37   0.20 
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    37   0.20 
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    37   0.21 
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    37   0.22 
KAFR0B01580 Chr2 (298942..303528) [4587 bp, 1528 aa] {ON} Anc_5....    37   0.23 
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    37   0.23 
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    37   0.23 
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    37   0.24 
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    37   0.24 
KLTH0D10054g Chr4 complement(835206..837818) [2613 bp, 870 aa] {...    37   0.25 
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    37   0.25 
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    37   0.26 
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    37   0.27 
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    37   0.28 
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    37   0.28 
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    37   0.28 
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    37   0.31 
Kpol_534.25 s534 complement(58326..59444) [1119 bp, 372 aa] {ON}...    37   0.31 
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    37   0.31 
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    37   0.31 
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    36   0.33 
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    37   0.33 
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    37   0.33 
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    36   0.33 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    37   0.34 
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    37   0.34 
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    37   0.35 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    37   0.35 
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    36   0.36 
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    37   0.36 
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    37   0.36 
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    36   0.38 
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    36   0.41 
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    36   0.42 
YNL253W Chr14 (170018..171286) [1269 bp, 422 aa] {ON}  TEX1Prote...    36   0.43 
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    36   0.43 
Smik_15.69 Chr15 complement(118407..121760) [3354 bp, 1117 aa] {...    36   0.46 
CAGL0L09647g Chr12 (1034737..1036026) [1290 bp, 429 aa] {ON} hig...    36   0.48 
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    35   0.48 
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    36   0.49 
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    36   0.49 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    36   0.50 
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    36   0.51 
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    36   0.51 
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    36   0.53 
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    36   0.57 
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    36   0.57 
KAFR0A04420 Chr1 complement(881701..882768) [1068 bp, 355 aa] {O...    35   0.58 
KNAG0B05540 Chr2 (1079174..1080511) [1338 bp, 445 aa] {ON} Anc_4...    36   0.58 
Kwal_55.20233 s55 (311887..314130) [2244 bp, 747 aa] {ON} YDR324...    36   0.59 
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    35   0.59 
Kpol_1072.46 s1072 (103226..105850) [2625 bp, 874 aa] {ON} (1032...    36   0.60 
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    35   0.61 
KLLA0F06754g Chr6 complement(650475..651509) [1035 bp, 344 aa] {...    35   0.67 
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    36   0.67 
Skud_16.142 Chr16 complement(261333..262718) [1386 bp, 461 aa] {...    35   0.68 
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    35   0.70 
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    35   0.74 
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    35   0.75 
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    35   0.75 
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    35   0.77 
TBLA0E03460 Chr5 (859536..863192) [3657 bp, 1218 aa] {ON} Anc_3....    35   0.78 
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    35   0.79 
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    35   0.82 
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    35   0.83 
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    35   0.84 
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    35   0.84 
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    35   0.85 
TBLA0B02480 Chr2 complement(569751..571400) [1650 bp, 549 aa] {O...    35   0.86 
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    35   0.88 
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    35   0.89 
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    35   0.89 
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    35   0.93 
SAKL0H01628g Chr8 (168606..173270) [4665 bp, 1554 aa] {ON} simil...    35   0.93 
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    35   0.94 
Kwal_23.4327 s23 (670568..675208) [4641 bp, 1546 aa] {ON} YHR186...    35   0.94 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    35   0.95 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    35   0.95 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    35   0.97 
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    35   0.98 
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    35   1.0  
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    35   1.1  
YGL100W Chr7 (313234..314283) [1050 bp, 349 aa] {ON}  SEH1Compon...    35   1.1  
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    35   1.1  
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    35   1.1  
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    35   1.1  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    35   1.1  
AFR153W Chr6 (711168..712898) [1731 bp, 576 aa] {ON} Syntenic ho...    35   1.2  
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    35   1.2  
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    35   1.2  
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    35   1.2  
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    35   1.2  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    35   1.2  
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    35   1.2  
SAKL0A05962g Chr1 complement(543144..544184) [1041 bp, 346 aa] {...    34   1.3  
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    35   1.4  
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    35   1.4  
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    35   1.4  
TBLA0G03390 Chr7 complement(900177..902099) [1923 bp, 640 aa] {O...    35   1.4  
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    35   1.4  
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    35   1.4  
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    35   1.4  
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    35   1.5  
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    35   1.5  
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    35   1.5  
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    34   1.5  
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    35   1.5  
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    35   1.6  
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    35   1.6  
NDAI0B01910 Chr2 complement(463465..464985) [1521 bp, 506 aa] {O...    34   1.6  
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    34   1.6  
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    34   1.6  
ZYRO0D10516g Chr4 (883922..886171) [2250 bp, 749 aa] {ON} simila...    34   1.7  
KAFR0C04445 Chr3 (882595..884274) [1680 bp, 559 aa] {ON}               34   1.7  
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    34   1.7  
KLTH0E03872g Chr5 (353271..355511) [2241 bp, 746 aa] {ON} simila...    34   1.7  
TDEL0B03950 Chr2 complement(709272..710306) [1035 bp, 344 aa] {O...    34   1.8  
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    34   1.8  
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    34   1.9  
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    34   1.9  
Skud_15.66 Chr15 complement(114566..117898) [3333 bp, 1110 aa] {...    34   1.9  
KNAG0H00450 Chr8 (70320..72755) [2436 bp, 811 aa] {ON} Anc_2.613...    34   1.9  
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    34   1.9  
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    34   1.9  
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    34   1.9  
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    34   1.9  
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    34   1.9  
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    34   2.0  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    33   2.0  
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    34   2.0  
NCAS0D03490 Chr4 (650325..651362) [1038 bp, 345 aa] {ON} Anc_6.159     34   2.0  
Skud_4.99 Chr4 (170540..172108) [1569 bp, 522 aa] {ON} YDL156W (...    34   2.0  
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    34   2.1  
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    34   2.2  
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    34   2.2  
ACR085C Chr3 complement(508364..511228) [2865 bp, 954 aa] {ON} N...    34   2.2  
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    34   2.2  
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    34   2.2  
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    33   2.3  
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    34   2.3  
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    34   2.3  
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    33   2.3  
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    34   2.4  
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    33   2.5  
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    34   2.5  
AER439W Chr5 (1476148..1476150,1476201..1477442) [1245 bp, 414 a...    33   2.6  
TDEL0D05080 Chr4 (924017..927007) [2991 bp, 996 aa] {ON} Anc_3.1...    34   2.6  
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    33   2.6  
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    34   2.7  
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    33   2.7  
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    34   2.7  
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    33   2.7  
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    33   2.7  
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    33   2.7  
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    34   2.8  
ADL316C Chr4 complement(141605..145861) [4257 bp, 1418 aa] {ON} ...    34   2.8  
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    33   2.8  
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    33   2.8  
NDAI0B02440 Chr2 complement(611035..612675) [1641 bp, 546 aa] {O...    33   2.8  
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    33   2.9  
KLTH0G01650g Chr7 complement(121279..122466,122554..122556) [119...    33   2.9  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    33   3.0  
KLLA0A11594g Chr1 complement(998888..1003480) [4593 bp, 1530 aa]...    33   3.0  
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    33   3.0  
SAKL0G07040g Chr7 (577213..578250) [1038 bp, 345 aa] {ON} simila...    33   3.3  
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    33   3.3  
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    33   3.3  
NCAS0C01450 Chr3 complement(267976..270597) [2622 bp, 873 aa] {O...    33   3.4  
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    33   3.4  
Suva_4.89 Chr4 (162699..164267) [1569 bp, 522 aa] {ON} YDL156W (...    33   3.4  
Kpol_1050.56 s1050 (126134..127528,127531..127563,127565..128245...    33   3.5  
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    33   3.5  
ZYRO0G21736g Chr7 (1788792..1789856) [1065 bp, 354 aa] {ON} high...    33   3.5  
Skud_7.174 Chr7 (317467..318516) [1050 bp, 349 aa] {ON} YGL100W ...    33   3.6  
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    33   3.6  
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    33   3.6  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    33   3.7  
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    33   3.8  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   3.9  
NDAI0G04860 Chr7 (1169649..1173797) [4149 bp, 1382 aa] {ON} Anc_...    33   3.9  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    33   3.9  
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    33   4.0  
Kwal_47.19083 s47 (1089260..1090234) [975 bp, 324 aa] {ON} YGL21...    33   4.0  
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    33   4.1  
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    33   4.1  
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    33   4.1  
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    33   4.2  
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    33   4.2  
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    33   4.2  
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    33   4.3  
NDAI0B02760 Chr2 complement(694100..697327) [3228 bp, 1075 aa] {...    33   4.4  
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    33   4.4  
ACL099W Chr3 (165316..166389) [1074 bp, 357 aa] {ON} Syntenic ho...    33   4.5  
Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON...    33   4.5  
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    33   4.6  
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    33   4.8  
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    33   4.8  
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    33   4.8  
Suva_10.139 Chr10 complement(252982..254748) [1767 bp, 588 aa] {...    33   4.8  
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    33   4.8  
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    33   4.9  
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    33   4.9  
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    33   5.0  
Kpol_1008.20 s1008 (39393..41141) [1749 bp, 582 aa] {ON} (39393....    33   5.0  
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    33   5.0  
SAKL0B01540g Chr2 (150043..151752) [1710 bp, 569 aa] {ON} simila...    33   5.0  
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    33   5.2  
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    32   5.2  
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    33   5.4  
Kpol_1027.5 s1027 complement(11866..14520) [2655 bp, 884 aa] {ON...    33   5.4  
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    33   5.4  
TPHA0I01180 Chr9 (274330..276999) [2670 bp, 889 aa] {ON} Anc_1.3...    33   5.6  
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    32   5.6  
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    32   5.7  
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    33   5.7  
TBLA0B04120 Chr2 (941318..943987) [2670 bp, 889 aa] {ON} Anc_8.6...    33   5.7  
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    32   5.7  
Smik_4.81 Chr4 (151682..153250) [1569 bp, 522 aa] {ON} YDL156W (...    32   5.8  
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    32   5.8  
Kpol_530.43 s530 (97335..98945) [1611 bp, 536 aa] {ON} (97335..9...    32   5.8  
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    32   5.8  
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    32   6.2  
Kwal_26.8604 s26 complement(859891..862494) [2604 bp, 867 aa] {O...    33   6.2  
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    32   6.2  
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    32   6.3  
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    32   6.3  
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    32   6.6  
TPHA0E03510 Chr5 (741718..748116) [6399 bp, 2132 aa] {ON} Anc_1....    33   6.6  
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    32   6.6  
KNAG0I02870 Chr9 (558973..562131) [3159 bp, 1052 aa] {ON} Anc_6....    32   6.8  
NDAI0E02190 Chr5 complement(450769..453492) [2724 bp, 907 aa] {O...    32   6.9  
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    32   7.0  
Smik_2.423 Chr2 complement(750642..753278) [2637 bp, 878 aa] {ON...    32   7.0  
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    32   7.0  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    32   7.1  
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    32   7.2  
Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}...    32   7.4  
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    32   7.4  
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    32   7.5  
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    32   7.7  
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    32   7.7  
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    32   7.8  
TPHA0M00700 Chr13 complement(132140..135313) [3174 bp, 1057 aa] ...    32   8.1  
Skud_7.83 Chr7 complement(151496..153076) [1581 bp, 526 aa] {ON}...    32   8.3  
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    32   8.4  
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    32   8.4  
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    32   8.5  
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    32   8.6  
KNAG0K00850 Chr11 complement(159329..162832) [3504 bp, 1167 aa] ...    32   8.6  
KAFR0C02950 Chr3 complement(589512..590963) [1452 bp, 483 aa] {O...    32   8.6  
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    32   8.6  
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    32   8.8  
Skud_12.121 Chr12 complement(236234..238000) [1767 bp, 588 aa] {...    32   8.9  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    32   9.1  
YGL190C Chr7 complement(145809..147389) [1581 bp, 526 aa] {ON}  ...    32   9.3  
AFL038C Chr6 complement(367581..368573) [993 bp, 330 aa] {ON} Sy...    32   9.4  
Smik_7.83 Chr7 complement(140174..141754) [1581 bp, 526 aa] {ON}...    32   9.7  
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    32   9.8  
ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} simil...    32   10.0 

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 1802 bits (4667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 895/937 (95%), Positives = 895/937 (95%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL 60
           MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL
Sbjct: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL 60

Query: 61  SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120
           SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA
Sbjct: 61  SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120

Query: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKD 180
           ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKD
Sbjct: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKD 180

Query: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKE 240
           GLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKE
Sbjct: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKE 240

Query: 241 KGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXXX 300
           KGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRT                 
Sbjct: 241 KGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTSSELSKALKKREKRLKE 300

Query: 301 XGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYY 360
            GISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYY
Sbjct: 301 KGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYY 360

Query: 361 SIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCI 420
           SIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCI
Sbjct: 361 SIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCI 420

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
           RTFDCGYALCCKFLP            ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG
Sbjct: 421 RTFDCGYALCCKFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
           RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF
Sbjct: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
           LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG
Sbjct: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL 660
           DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL
Sbjct: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL 660

Query: 661 SSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFARN 720
           SSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFARN
Sbjct: 661 SSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFARN 720

Query: 721 SXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQP 780
           S            HKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQP
Sbjct: 721 SEEDTDVTEVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQP 780

Query: 781 MKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQL 840
           MKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQL
Sbjct: 781 MKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQL 840

Query: 841 VNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEGL 900
           VNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEGL
Sbjct: 841 VNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEGL 900

Query: 901 KFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           KFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV
Sbjct: 901 KFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 1328 bits (3436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/941 (67%), Positives = 773/941 (82%), Gaps = 5/941 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL 60
           MV SYQRFEQ S FGVI+SN+NCVWI +  +R S GQI+T +LEN+NCWDIKTG L K L
Sbjct: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASR-NRGSAGQILTGALENVNCWDIKTGELSKIL 59

Query: 61  SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120
           +D +PPG++DAK  K AE  YL+YH ETNLLA GYADGVIKIWD+ ++TVLI FN H +A
Sbjct: 60  TDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSA 119

Query: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKD 180
           IT L+FDP+GTRLISGS+DS+IIIWDLVGEVGL KLRSHKDSITGIW EN+DWLISTSKD
Sbjct: 120 ITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKD 179

Query: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKE 240
           GLIK+WD+K+QQCVETHMAHT+ECW LAI +DLV+T + +S++KIW LDL+++ GSKL E
Sbjct: 180 GLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLIE 239

Query: 241 KGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXXX 300
           KGIYEKQS+QR V V+ +T  D V FFY+QNADKT E+FR+RT                 
Sbjct: 240 KGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLRD 299

Query: 301 XGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYY 360
            G+++++IQ+ IK S+V+ I+ PFQ +RS FK K+A W   + SKLE+V TTSNNT+EYY
Sbjct: 300 KGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEYY 359

Query: 361 SIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCI 420
           SIPY+ ++PT+ A +KLYTIELQGHRTDVRSIDIS+DNKLLA ASNG LKIWNI T +CI
Sbjct: 360 SIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHACI 419

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
           RTF+CGYAL CKFLP            +LQLFDLASS +LENKE AH AAIWSLDLTSDG
Sbjct: 420 RTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSDG 479

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
           +RL+TGSADKTVKFW+F+V++ELI  + DK+  +L++ HDTTLEL +DIL+VKIS +++F
Sbjct: 480 KRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNKF 539

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
           LAVSLLDNTVKVFFL+SMKFFLSLYGHKLPVLSIDIS+DSKL+ITSSADKNIKIWGLDFG
Sbjct: 540 LAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG 599

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL 660
           DCH+SLFAHQD+IM+VKFVP+SHNFFSC KDG++KYWDG KF+C+QKL AH+SEVWALA+
Sbjct: 600 DCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALAI 659

Query: 661 SSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFARN 720
           S+D +F VS SHD SIRVWEETED+VFLEEEREKEMDEQYE  LL +LE  + D+ F R+
Sbjct: 660 SNDARFVVSTSHDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDDNFQRD 719

Query: 721 ----SXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKS 776
                            HKQTIESLKAGER++EALDLGI+ +E  E Y +NL  W K KS
Sbjct: 720 IEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKKS 779

Query: 777 GDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIE 836
           G+ P KPQ N+IL+A+ K PE+YIM+TLV+I+P+QLEDALLVLPFSYVL FLKFID  I+
Sbjct: 780 GEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVIK 839

Query: 837 KKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFN 896
            K++ NNHL LIC+ L +++K N++EL+AQKNEELKLQIN+VK +LR ALKGN DDLGFN
Sbjct: 840 DKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGFN 899

Query: 897 IEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           ++GLKFI+QQWN++HN EFVD+YDQR  E K+ KKR+F T+
Sbjct: 900 VQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETL 940

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 1320 bits (3417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/936 (66%), Positives = 763/936 (81%), Gaps = 2/936 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL 60
           MV SYQRFEQ   FGV+ +NSNCVW+P++ ++ SPGQ+IT +LE + CW+IKTG LLKT+
Sbjct: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQ-AKNSPGQVITGALEEVKCWEIKTGELLKTM 59

Query: 61  SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120
            D +PPG+ID K EKPAE  YL+YH ET +LA GYADG IKIWDMQTQTVLI+F+SH++A
Sbjct: 60  RDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSA 119

Query: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKD 180
           IT L+FD +GTRLISGSRD+ II+WDLV E GLCKLRSHKD+ITGIW ENDDWLIS SKD
Sbjct: 120 ITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSKD 179

Query: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKE 240
           GLIK+WD+K  QCVETHMAHT ECWSLA+ D++V+TANA+SE+K+WELDLER NGS L E
Sbjct: 180 GLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLLE 239

Query: 241 KGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXXX 300
           KG YEKQS+QR  ++   T  D   FFY  N+DKT E+FRIR+                 
Sbjct: 240 KGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFKE 299

Query: 301 XGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYY 360
            G+S++EIQE  ++S+ N ++ PFQ+VRS FK K+++WT C+ SKLELV TT+NNTIEYY
Sbjct: 300 KGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEYY 359

Query: 361 SIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCI 420
           SIPYK ++P Q  A KL++IE  GHRTD+R+ DIS D+KLLA ASNG LK+WNI T++CI
Sbjct: 360 SIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTCI 419

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
           R  DCGYALCCKFLP            +LQLFDLASS +LEN E AH AAIWSLDLTSDG
Sbjct: 420 RNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDG 479

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
           +RL+T SADKTVKFW+F+VE+EL++ + DK+  +++++HDTTL+LGED+  VKISPEDRF
Sbjct: 480 KRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDRF 539

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
           LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS+DSKLIITSSADKNIKIWGLDFG
Sbjct: 540 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFG 599

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL 660
           DCH+SLFAHQD+IMNVKF+P+SHNFFSC KDG +KYWDG  FDCIQKL  H+ EVWALA+
Sbjct: 600 DCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAV 659

Query: 661 SSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFARN 720
           SSDGQ  VSVSHDRSIRVWEETEDQVFLEEEREKE++EQYE+ LL++LE  + D+ F  N
Sbjct: 660 SSDGQAVVSVSHDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDDAFISN 719

Query: 721 SXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQP 780
           +            HKQTIESLKAGERLMEALDLGI+E++A E+Y + + LWNK K GDQP
Sbjct: 720 NGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNK-KLGDQP 778

Query: 781 MKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQL 840
            KPQ+N+IL A++K PE Y+M+TL +IKP+QLEDALLVLPFSYVLKFLKFID +I+   +
Sbjct: 779 TKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIKNDVI 838

Query: 841 VNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEGL 900
           ++  LPL+C+ L++VV+ NHKEL++QKNEELK+QIN+VKD+LRAAL+ ++DDLGFNI+GL
Sbjct: 839 LHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFNIQGL 898

Query: 901 KFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTT 936
           KF++  WNV HN++F DEYDQ   E   SKKR+F T
Sbjct: 899 KFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPT 934

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1307 bits (3382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/943 (66%), Positives = 764/943 (81%), Gaps = 7/943 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTS----PGQIITSSLENINCWDIKTGNL 56
           MV SYQRFEQ + FGVIASN+NCVWIP   SRT+    PGQ+ITS+LEN+N WDIKTG+L
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPA-SSRTNNGSGPGQLITSALENVNIWDIKTGDL 59

Query: 57  LKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNS 116
           + TLSD +PPG+ DAK  KPAE  YLE H +TNLLA GYADGVIK+WD+ ++TVL+ FN 
Sbjct: 60  VTTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNG 119

Query: 117 HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLIS 176
           H AAIT ++FD +GTRLISGS+DSNII+WDLVGEVGL KLRSHKD+ITG W + +DWL+S
Sbjct: 120 HKAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVS 179

Query: 177 TSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLEREN-G 235
           TSKDGLIK+WD+K+QQC+ETH+AHT ECW LA+ DDL++T + DS++KIW+L++E E  G
Sbjct: 180 TSKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMG 239

Query: 236 SKLKEKGIYEKQSRQRSVDVKIVTNP-DEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXX 294
            KL E GI+EKQS+QR + ++ +TN  D V FFY+QNADKT E +RIR            
Sbjct: 240 EKLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKR 299

Query: 295 XXXXXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSN 354
                  G++++EI + IK S+ + I+ PFQ VRS +K KSA+WT  + SKLELV TTSN
Sbjct: 300 EKRLREKGLTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSN 359

Query: 355 NTIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNI 414
           NTIEYYSIPY+ + PT  A  K +TIELQG RTDVRSID+S+DNKLLA ASNG LKIWN+
Sbjct: 360 NTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNV 419

Query: 415 TTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSL 474
            T  CIRTF+CGYAL CKFLP            ELQLFDLASS +L+  E AHDAAIWSL
Sbjct: 420 KTHKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSL 479

Query: 475 DLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKI 534
           DLTSDG+RL+TGSADKTVKFW+FQVEK L+  + DK+   L++ HDTTLEL +DILSV+I
Sbjct: 480 DLTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRI 539

Query: 535 SPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKI 594
           SP+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDIS+DSK+IITSSADKNIKI
Sbjct: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599

Query: 595 WGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSE 654
           WGLDFGDCH+SLFAHQD+IM+VKF+P+SHNFFSC KD V+KYWDG KF+CIQKL AH+SE
Sbjct: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659

Query: 655 VWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASD 714
           VWALA+S+DG F VS SHD SIR+WEETEDQVFLEEE+EKE++EQYE+ LL++LE    D
Sbjct: 660 VWALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGD 719

Query: 715 EKFARNSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKN 774
           + F  ++            HKQT+ESLKAGE+LMEALDLGI+E+E  E Y++++ LW + 
Sbjct: 720 DAFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRK 779

Query: 775 KSGDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDAS 834
           K G+ PMKPQ NS+LIAV K PE+YIMDTL RI+ +QLEDAL+V+PFSYVLKFLKF DA 
Sbjct: 780 KLGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAV 839

Query: 835 IEKKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLG 894
           ++ K L++NHLPLIC+NL +++K NHKELI+QKNEELKLQIN+VK +LR ALK   DDLG
Sbjct: 840 MQNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLG 899

Query: 895 FNIEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           FN++GLKFI+QQWN+KHN+EFVDEYDQ++ E  S++KRVF  V
Sbjct: 900 FNVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERV 942

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1299 bits (3362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/943 (65%), Positives = 764/943 (81%), Gaps = 7/943 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTS----PGQIITSSLENINCWDIKTGNL 56
           MV SYQRFEQ + FGVIASN+NCVW+P   SRT+    PGQ+ITS+LEN+N WDIKTG+L
Sbjct: 1   MVKSYQRFEQSAIFGVIASNANCVWLPP-SSRTNKGSGPGQLITSALENVNIWDIKTGDL 59

Query: 57  LKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNS 116
           L TLSD +PPG+ DA+  KPAE  YLE H +T+LLA GYADGVIK+WD+ ++TVL+ FN 
Sbjct: 60  LATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNG 119

Query: 117 HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLIS 176
           H AAIT L+FD +GTRLISGSRDSNII+WDLVGEVGL KLRSHKD ITGIW + +DWLIS
Sbjct: 120 HKAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIS 179

Query: 177 TSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLEREN-G 235
           TSKDG+IK+WD+K+QQC+ETH+AHT ECWSL++ DDL++T   DS++KIW+L++E +  G
Sbjct: 180 TSKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMG 239

Query: 236 SKLKEKGIYEKQSRQRSVDVKIVTNP-DEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXX 294
            KL E G++EKQS+QR + V+ +TN  D V FFY+QNADKT E FRIR            
Sbjct: 240 EKLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKR 299

Query: 295 XXXXXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSN 354
                  G++++EI   IK S+ + ++ PFQ +RS +K KSA+WT  + SKLELV TTSN
Sbjct: 300 EKRLREKGLTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSN 359

Query: 355 NTIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNI 414
           NTIEYYSIPY+ ++ T  A  K +TIELQG RTDVRSIDIS+DNKLLA ASNG LKIWN+
Sbjct: 360 NTIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNV 419

Query: 415 TTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSL 474
            T  CIRTF+CGYAL CKFLP            ELQLFDLASS +L+  E AHDAAIWSL
Sbjct: 420 KTHKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSL 479

Query: 475 DLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKI 534
           DLTSDG+RL+TGSADKTVKFW+FQVE  L+  + DK    L++ HDTTLEL +DILSV+I
Sbjct: 480 DLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRI 539

Query: 535 SPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKI 594
           SP+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDIS+DSK+IITSSADKNIKI
Sbjct: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599

Query: 595 WGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSE 654
           WGLDFGDCH+SLFAHQD+IM+VKF+P+SHNFFSC KD V+KYWDG KF+CIQKL AH+SE
Sbjct: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659

Query: 655 VWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASD 714
           VWALA++S+G F VS SHD SIR+WEETEDQVFLEEE+EKE++EQYE+ LL++LE   +D
Sbjct: 660 VWALAIASNGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNAD 719

Query: 715 EKFARNSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKN 774
           + F  ++            HKQT+ESLKAGERLMEALD+GI+++E  E Y++++ LW + 
Sbjct: 720 DAFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRK 779

Query: 775 KSGDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDAS 834
           K G+ PMKPQ NS+LIAVNK PE+YI+DTL RI+ +QLEDAL+V+PFSYVLKFLKFID  
Sbjct: 780 KLGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTV 839

Query: 835 IEKKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLG 894
           ++ K L+++HLPL+CRNL +++K NHKEL++QKNEELKLQIN+VK +LR ALK   DDLG
Sbjct: 840 MQNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLG 899

Query: 895 FNIEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           FN++GLKFIKQQWN++HN+EFVDEYDQ++ E  S++KRVF TV
Sbjct: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETV 942

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 1295 bits (3351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/942 (65%), Positives = 761/942 (80%), Gaps = 5/942 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRT---SPGQIITSSLENINCWDIKTGNLL 57
           MV SYQRFEQ + FGVIASN+NCVWIP     +    PGQ+ITS+LE++N WDIKTG+L+
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV 60

Query: 58  KTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSH 117
             LSD +PPG+ DA+  KPAE  YLE H +T+LLA GYADGVIK+WD+ ++TVL+ FN H
Sbjct: 61  SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLIST 177
            AAIT L+FD +GTRLISGS+DSNII+WDLVGEVGL KLRSHKDSITG W + +DWLIST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLEREN-GS 236
           SKDG+IK+WD+K+ QC+ETH+AHT ECW LA+ DDL++T   DS++KIW+LD+E +  G 
Sbjct: 181 SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG 240

Query: 237 KLKEKGIYEKQSRQRSVDVKIVTNP-DEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXX 295
           KL E GI+EKQS+QR + ++ +TN  D+  FFY+QNADKT E FRIR             
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 296 XXXXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNN 355
                 G++E+EI + IK S+ + I+ PFQ +RS +K KSA+WT  S SKLELV TTS+N
Sbjct: 301 KRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSN 360

Query: 356 TIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNIT 415
           TIEYYSIPY+ + PT  A  K +TIELQG RTDVRSIDIS+DNKLLA ASNG LKIWNI 
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIK 420

Query: 416 TQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLD 475
           T  CIRTF+CGYAL CKFLP            ELQLFDLASS +L+  E AHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 476 LTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKIS 535
           LTSDG+RL+TGSADKTVKFW+F+VE  L+  + +K+   L++ HDTTLEL +DIL V++S
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVS 540

Query: 536 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIW 595
           P+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDIS+DSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 596 GLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEV 655
           GLDFGDCH+SLFAHQD+IMNVKF+PQSHNFFSC KD V+KYWDG KF+CIQKL AH+SEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 656 WALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDE 715
           WALA+++DG F VS SHD SIR+WEETEDQVFLEEE+EKE++EQYE+ LL++LE    D+
Sbjct: 661 WALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 716 KFARNSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNK 775
            F  ++            HKQT+ESLKAGERLMEALDLGI+E+E  E Y+R++ LW + K
Sbjct: 721 AFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK 780

Query: 776 SGDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASI 835
            G+ P+KPQ N++LIAVNK PE+YIMDTL+RI+ +QLEDAL+V+PFSYVLKFLKFID  +
Sbjct: 781 LGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 836 EKKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGF 895
           + K L+++HLPLIC+NL +++K NHKEL++QKNEELKLQIN+VK +LR+ALK   DDLGF
Sbjct: 841 QNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGF 900

Query: 896 NIEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           N++GLKF+KQQWN++HN+EFVDEYDQ++ E+ S++KRVF TV
Sbjct: 901 NVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTV 942

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 1293 bits (3345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/955 (65%), Positives = 768/955 (80%), Gaps = 18/955 (1%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTS-PGQIITSSLENINCWDIKTGNLLKT 59
           MV SYQRFEQ S FGVI+SNSNCVW+P+  S+ S PGQIIT +LEN+N WD+KTG L   
Sbjct: 28  MVKSYQRFEQASVFGVISSNSNCVWLPSTSSKKSHPGQIITGALENVNIWDLKTGELASF 87

Query: 60  LSDSI--PPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSH 117
           L+D +  PPGS+DAK  KPAE  +L++H ETNLLA GY DGV+K+WD+ ++TVL   N H
Sbjct: 88  LNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYSKTVLCNLNGH 147

Query: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWF--------- 168
           ++AIT LKFD SGTRLISGSRDSNII+WDLV EVGL KLRSHKD+ITGIW          
Sbjct: 148 SSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQE 207

Query: 169 END-DWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWE 227
           EN+ DWLISTSKDGLIK+WD+K QQCVETH+AHT ECWSLA+ +DLV+T ++DS++K W+
Sbjct: 208 ENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKFWQ 267

Query: 228 LDLERE---NGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTX 284
           L L+ +   NGSKL EKGIYEKQS+QR ++V+ + + D V FF +QNAD+T E+FR+R  
Sbjct: 268 LSLQDDTVPNGSKLIEKGIYEKQSKQRGLNVEFIDSIDGVGFFLIQNADRTVEIFRLRKE 327

Query: 285 XXXXXXXXXXXXXXXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLS 344
                            G++ DEI++ ++ SFV+ ++ PFQ++RS +K K+A WT  + +
Sbjct: 328 EEISKALKKREKRLTEKGMTPDEIKKSLEDSFVSMMMHPFQIIRSIYKVKAATWTIATST 387

Query: 345 KLELVFTTSNNTIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAA 404
           KLEL  TT+NNTIEYYSIPY+ ++PTQ  A+KLY +ELQG RTD+RSIDIS+DNKLLA A
Sbjct: 388 KLELTVTTANNTIEYYSIPYEKREPTQPIANKLYNVELQGQRTDIRSIDISDDNKLLATA 447

Query: 405 SNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKE 464
           SNG LKIWN+ T+ CIRTF+CGYAL CKFLP            ELQLFDLASS  + N E
Sbjct: 448 SNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGELQLFDLASSTQIANIE 507

Query: 465 AAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLE 524
            AHDAAIWSLDLTSDG+RLITGSADK+VKFWNFQ+E+EL+  ++DK+  +L + HDTTLE
Sbjct: 508 EAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLE 567

Query: 525 LGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLII 584
           L +DILSV++SPED+FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDIS+DSK+II
Sbjct: 568 LSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMII 627

Query: 585 TSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDC 644
           TSSADKNIKIWGLDFGDCH+SLFAHQD+IMNVKFVP+SHNFFSC KDG+IKYWDG KF+C
Sbjct: 628 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFEC 687

Query: 645 IQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKL 704
           IQKL AH+SEVWALA+++D  F VS SHD SIR+WEETED+VFLEEER+KEM+EQYE+ L
Sbjct: 688 IQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWEETEDEVFLEEERDKEMEEQYEDTL 747

Query: 705 LSTLENDASDEKFARNSXXXXXXX--XXXXXHKQTIESLKAGERLMEALDLGISELEAQE 762
           L++LE    D+ F  ++              HKQT+ESLKAGERLMEA DLG++E+E+ E
Sbjct: 748 LASLEEGNGDDAFKGDTKGATNVEFDEATDVHKQTMESLKAGERLMEAFDLGMAEIESFE 807

Query: 763 EYHRNLLLWNKNKSGDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFS 822
           EY +NL LW + K+G+ P+KPQ N+ILIA+ K PEEYIMDTL+RIKP+QLEDALLVLPFS
Sbjct: 808 EYDKNLKLWQRKKTGEPPIKPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVLPFS 867

Query: 823 YVLKFLKFIDASIEKKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKL 882
           YVLKFLKFI+  I  K+++NNHL LIC+NL ++VK NHKEL++QKNE LKLQI KVK++L
Sbjct: 868 YVLKFLKFINIVIGNKKMLNNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVKNEL 927

Query: 883 RAALKGNIDDLGFNIEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           R ALK N DDLGFNI+G+KFIKQQWN++HN EFVDEYDQ+  E K +KKR F T+
Sbjct: 928 RNALKANEDDLGFNIQGMKFIKQQWNLRHNLEFVDEYDQKSHEDKMAKKRTFGTL 982

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1289 bits (3335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/942 (64%), Positives = 761/942 (80%), Gaps = 5/942 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEG---SRTSPGQIITSSLENINCWDIKTGNLL 57
           MV SYQRFEQ + FGVIASN+NCVW+P      S + PGQ+ITS+LEN+N WDIKTG+L+
Sbjct: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60

Query: 58  KTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSH 117
            TLSD +PPG+ DA+  KPAE  YLE H +T+LLA GYADGVIK+WD+ ++TVL+ FN H
Sbjct: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLIST 177
            AAIT L+FD +GTRLISGS+DSNII+WDLVGEVGL KLRSHKDSITG W + +DWLIST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLEREN-GS 236
           SKDG+IK+WD+K+QQC+ETH+AHT ECW L++ DDL++T   DS++K+W+L++E +  G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240

Query: 237 KLKEKGIYEKQSRQRSVDVKIVTN-PDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXX 295
           KL E G +EKQS+QR + ++ +TN  D   FFY+QNADKT E+FRIR             
Sbjct: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKRE 300

Query: 296 XXXXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNN 355
                 G++++EI + IK S+ + I+ PFQ VRS +K KSA+WT  + SKLELV TTSNN
Sbjct: 301 KRLREKGLTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360

Query: 356 TIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNIT 415
           TIEYYSIPY+ ++PT  A  K +TIELQG RTD+RSIDIS+DN+LLA ASNG LKIWN+ 
Sbjct: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420

Query: 416 TQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLD 475
           T  CIRTF+CGYAL CKFLP            ELQLFDLASS +L+  E AHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 476 LTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKIS 535
           LTSDG+RL+TGSADKTVKFW+FQVE  L+  + DK+   L++ HDTTLEL +DILS++IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540

Query: 536 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIW 595
           P+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDIS+DSK+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 596 GLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEV 655
           GLDFGDCH+SLFAHQD+IM+VKF+P+SHNFFSC KD V+KYWDG KF+CIQKL AH+SEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 656 WALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDE 715
           WALA+S+DG F VS SHD SIR+WEETEDQVFLEEE+EKE++EQYE+ LL++LE    D+
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 716 KFARNSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNK 775
            F  ++            HKQT+ESLKAGERLMEALDLGI+E+E  E Y R++ LW + K
Sbjct: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780

Query: 776 SGDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASI 835
            G+ P+KPQ NS+LIAVNK PE+YIMDTL+RI+ +QLEDAL+V+PFSYVLKFLKFID+ +
Sbjct: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840

Query: 836 EKKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGF 895
           + K L+++HLPLIC+NL +++K NHKEL++QKNEELK Q+++VK +LR ALK   DDLGF
Sbjct: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900

Query: 896 NIEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           N++GLKFIKQQWN++HN+EFVDEYDQ++ E+  ++KR F TV
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETV 942

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 1276 bits (3303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/938 (63%), Positives = 760/938 (81%), Gaps = 2/938 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL 60
           MV SYQRFEQ + FGVI+SNSNCV+IP   +R   GQ++T  LE +N WD+KTG+L+  L
Sbjct: 1   MVKSYQRFEQSASFGVISSNSNCVYIPP-ANRKGLGQVLTGGLEKVNLWDLKTGDLVSCL 59

Query: 61  SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120
           SD +PPGSIDAK  KPAE  YLEYH ETNLLA GYA+GVIK+WD+ ++TVL+  N H +A
Sbjct: 60  SDGLPPGSIDAKSTKPAETTYLEYHAETNLLAVGYAEGVIKVWDLMSKTVLLTLNGHKSA 119

Query: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKD 180
           +T LKFD +GTRLISGS+DSNII+WDL+GEVGL KLRSHK +I+G+W E D+WLISTS+D
Sbjct: 120 VTILKFDITGTRLISGSQDSNIIMWDLIGEVGLYKLRSHKGAISGLWLEKDEWLISTSRD 179

Query: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKE 240
           GLIKVWD+K+QQCVETH+AHT ECWSL + +DL +TA+ADS++KIW L+ E E GSKL E
Sbjct: 180 GLIKVWDLKTQQCVETHIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESEAGSKLIE 239

Query: 241 KGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXXX 300
           KGIYEKQS QR   ++ VT  DE  FFY+QNADK+ E+FRIR                  
Sbjct: 240 KGIYEKQSNQRGSSIEFVTTTDETTFFYIQNADKSIEIFRIRKEEEILKATRKREKRLKE 299

Query: 301 XGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYY 360
            G+S++EI++ I+  +++ I+ PFQ++RS+FK K+AAW + + SKL+LV TT++NT+EYY
Sbjct: 300 KGLSDEEIKQNIQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASNTVEYY 359

Query: 361 SIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCI 420
           +IPY+ ++P   A ++L+++ELQGHRTDVR++DIS D+ LLA ASNG LK+WN+ T+ C+
Sbjct: 360 TIPYEKREPKLPAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLKTRMCL 419

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
           RTFDCGYALCC+FLP            +LQLFDLASS +L+NKE AHDAAIWSLD+TSDG
Sbjct: 420 RTFDCGYALCCRFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLDITSDG 479

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
           ++L+TGSADK+VKFW FQVEK+LI+ + DK+   +++ HDTTLEL +D+LSV+ISPED++
Sbjct: 480 KKLVTGSADKSVKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRISPEDKY 539

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
            A+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDIS+DSK+IITSSADKNIKIWGLDFG
Sbjct: 540 FAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIWGLDFG 599

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL 660
           DCH+SLFAHQD+IM+VKF+P+SHNFFSC KDG++KYWDG KF+CIQKL  H+SEVWALA+
Sbjct: 600 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEVWALAI 659

Query: 661 SSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFARN 720
           S++G++ VS SHDRSIR+WEETEDQVFLEEEREKE++EQ E  LLS+LE  + D  F ++
Sbjct: 660 SNNGKYVVSASHDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDAAFRKD 719

Query: 721 -SXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQ 779
                          KQTIESLKAGERLMEALDLGI E+E +E Y + L  WNK+K   +
Sbjct: 720 VGGDEADQDEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKHKGDAK 779

Query: 780 PMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQ 839
           P+KP  N+IL A++K PEEYI++TL RIKP+QLEDALLVLPFSYVLKF +FIDA++   +
Sbjct: 780 PVKPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAALLDNR 839

Query: 840 LVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEG 899
           ++ ++LPLIC+NL ++VK NH+EL++QKNEELKL+I KVKD LR ALK N DDLGFNIEG
Sbjct: 840 ILQHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLGFNIEG 899

Query: 900 LKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           LKFI++QW+++H  EFVD+Y QR+ E K++KKRVF T+
Sbjct: 900 LKFIRRQWDLRHKLEFVDDYSQREQEDKTAKKRVFETI 937

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 1269 bits (3285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/959 (65%), Positives = 762/959 (79%), Gaps = 24/959 (2%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGS-RTSPGQIITSSLENINCWDIKTGNLLKT 59
           MV SYQRFEQ S FGVI SNSNC+W+P++ +  TSPGQIITS+LENIN WDIKTG L   
Sbjct: 1   MVKSYQRFEQESVFGVINSNSNCIWLPSDSNPSTSPGQIITSALENINIWDIKTGELSSH 60

Query: 60  LSDSI--PPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSH 117
           L DS+  PPGSIDAK  KPAE  YL++H +TNLLA GY DGVIK+WD+ ++TVL   N H
Sbjct: 61  LIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGVIKVWDLYSKTVLCNLNGH 120

Query: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWF--------- 168
           ++AIT LKFD +GTRLISGSRDSNII+WDLV EVGL KLRSHKD+ITGIW          
Sbjct: 121 SSAITVLKFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEMQNNGED 180

Query: 169 -END-DWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIW 226
            EN+ DWLISTSKDGLIK+WD+K QQC+ETH+AHT ECWS+A+ +DL++T ++DS++KIW
Sbjct: 181 DENELDWLISTSKDGLIKIWDLKIQQCIETHIAHTGECWSVAVRNDLLITTSSDSQIKIW 240

Query: 227 ELDLEREN---GSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRT 283
           EL+L+ ++     KL EKGIYEKQS+QR + ++ +   DE  FFY+QNADKT E+FR+R 
Sbjct: 241 ELNLDNDDDGKNKKLIEKGIYEKQSKQRGLSIEFIDTADETGFFYIQNADKTVEIFRLRK 300

Query: 284 XXXXXXXXXXXXXXXXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSL 343
                             G++ ++I++ IK S+++ I+ PFQ+VRS +K K+  WT  + 
Sbjct: 301 QDEINKAIKKRTKRLTEKGMTPEDIEQNIKDSYISLIMHPFQIVRSIYKIKAVTWTIATP 360

Query: 344 SKLELVFTTSNNTIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAA 403
           SKLEL  TTSNNTIEYYS PY+ ++PTQ   +KL+TIELQG RTD+RSIDIS+DNKLLA 
Sbjct: 361 SKLELCLTTSNNTIEYYSTPYEKREPTQPTPNKLHTIELQGQRTDIRSIDISDDNKLLAT 420

Query: 404 ASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENK 463
           ASNG+LKIWNI T+SCIRTF+CGY+L CKFLP            ELQLFDLASS +LE  
Sbjct: 421 ASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTLVIVGTRGGELQLFDLASSTLLETI 480

Query: 464 EAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTL 523
           E AHDAAIWSLDLTSDG+RL+TGSADK+VKFW+FQ+E+EL++ + DKY  +L++ HDTTL
Sbjct: 481 EDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDFQLEQELVAGTVDKYLPKLKLFHDTTL 540

Query: 524 ELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLI 583
           EL +DILSVKISPED+FLAVSLLDNTVKVFF+D+MKFFLSLYGHKLPVLSIDIS+DSKLI
Sbjct: 541 ELNDDILSVKISPEDKFLAVSLLDNTVKVFFMDTMKFFLSLYGHKLPVLSIDISFDSKLI 600

Query: 584 ITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFD 643
           ITSSADKNIKIWGLDFGDCH+SLFAHQD+IMNVKFVP+SHNFFSC KDG+IKYWDG KF+
Sbjct: 601 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGLIKYWDGDKFE 660

Query: 644 CIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEK 703
           CIQKL  H+SEVW++A+++D  F VS SHD SIR+WEETED+VFLEEEREKE++E YE+ 
Sbjct: 661 CIQKLAGHQSEVWSIAIANDASFIVSSSHDHSIRIWEETEDEVFLEEEREKELEELYEDT 720

Query: 704 LLSTLENDASDEKFARNSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEE 763
           LL++LE D  D+ F ++             HKQT+ESLKA ERLMEA DLG+ E+EA EE
Sbjct: 721 LLTSLEEDNGDDAFKKDG--GEDKDEATDVHKQTMESLKASERLMEAFDLGMKEIEAMEE 778

Query: 764 YHRNLLLWNKNKSGDQ-----PMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLV 818
           Y R L  W +  S ++     P+KPQ N+IL+A+ K PEEYIMDTLVRIKP+QLEDALLV
Sbjct: 779 YERELKNWQRKDSNNKATQTVPIKPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDALLV 838

Query: 819 LPFSYVLKFLKFIDASIEKKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKV 878
           LPFSY++KFLKFID  I  K+++NNHLPLICR L ++VK NHKEL++QKNEELK QI +V
Sbjct: 839 LPFSYIIKFLKFIDIVINSKKILNNHLPLICRILFFIVKSNHKELVSQKNEELKSQITRV 898

Query: 879 KDKLRAALKGNIDDLGFNIEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           KD LR ALK N DDLGFNI+GLKFIKQQW +KHN+E+VD+ DQ+  E K +KKR F T+
Sbjct: 899 KDNLRNALKNNEDDLGFNIQGLKFIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTFGTI 957

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 1268 bits (3281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/939 (63%), Positives = 758/939 (80%), Gaps = 6/939 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRT-SPGQIITSSLENINCWDIKTGNLLKT 59
           MV SYQRFEQ S FGVI++N+NCVW+  E  ++ SPG +ITS+LENIN WDIKTG L+  
Sbjct: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60

Query: 60  LSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTA 119
           LSD +P GSID K  KPAEV+YL YH ETNLLAAGY DG IK+WD+ +++VL+ FN H +
Sbjct: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120

Query: 120 AITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSK 179
           AIT +KFD +GTRLISGSRDSNII+WDLV EVGL KLRSHKD+I+GIW E +DWL+STSK
Sbjct: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180

Query: 180 DGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLK 239
           DGLIK+WD+K QQC+ETH+AHT ECW++ + +DL++T+ AD++LK+W LD  +E GSKL 
Sbjct: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240

Query: 240 EKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXX 299
           EKG+Y+KQS+QR +D+K    P+   FFY+QNADKTTEVFRIR                 
Sbjct: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKREKRLK 300

Query: 300 XXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEY 359
             G++++EIQ+ IK S+ + I+ PFQV++S +K KS ++T  S +KLE V TTS+N+IEY
Sbjct: 301 EKGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360

Query: 360 YSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSC 419
           YSIPY+ + PT  A ++LYTIEL GHRTD+RS+DIS+D+KLLA ASNG+LK+WN+ T++C
Sbjct: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420

Query: 420 IRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSD 479
           IR FDCGYAL CKFLP             LQLFDLASS +LENKE AH+ AIWSLD+TSD
Sbjct: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480

Query: 480 GRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDR 539
           GRRL+TGSADKT+KFWNFQVE++L+  + DKY   ++++HDTT+E+ ED+LSV+ISPED+
Sbjct: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540

Query: 540 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDF 599
           FLA+SLLDNTVKVF+LDSMKFFLSLYGHKLPVLSIDIS+DSKLIITSSADKNIKIWGLDF
Sbjct: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 600 GDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA 659
           GDCH+SLFAHQD+IMNVKF+P+SHNFFS  KDG++KYWDG KF+CIQKL AH+SEVW++A
Sbjct: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660

Query: 660 LSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFAR 719
           ++SDG   +S SHD S+RVWEET+DQVFLEEEREKE++EQYE+ LL++LE  + D+ F  
Sbjct: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDDAFKG 720

Query: 720 NSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNK-SGD 778
           ++              QT+ESLKAGERLMEALDLG+SE+EA E+Y  ++  W K K SG+
Sbjct: 721 DA--EKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGE 778

Query: 779 QPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKK 838
            P+KPQ N+ILIA+ K P EYIM+TLV+IKP+QLEDALLVLPFSYVLK LKFID  ++ K
Sbjct: 779 PPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDK 838

Query: 839 QLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIE 898
           ++  N+L LIC+NL +V++ NHKELI+Q+NE LK QI  VK+ LR +L+ N+DDLGFNI+
Sbjct: 839 KMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQ 898

Query: 899 GLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           GLKFIKQQWN+KHNF+F D++D++  E  S KKR+F T+
Sbjct: 899 GLKFIKQQWNLKHNFDFTDDFDKK--EESSGKKRIFGTL 935

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 1261 bits (3264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/938 (63%), Positives = 755/938 (80%), Gaps = 3/938 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSP-GQIITSSLENINCWDIKTGNLLKT 59
           MV SYQRFEQ S FGVI +N+NCVW+P+  SR S  GQ++T +LENIN WDIKTG LL  
Sbjct: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60

Query: 60  LSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTA 119
           LSD +PPGSID K  KPAEV YLEYH ETNLLAAGYADGVIKIWD+ ++TVL+ F+ H +
Sbjct: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120

Query: 120 AITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSK 179
            +T LKFD +GTRL+SGSRDS+IIIWDLV EVG+ KLRSHKD+ITGIW E +DWL+ST+K
Sbjct: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180

Query: 180 DGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLK 239
           DGLIK+WD+K+QQCVETH+A T ECW+L +  DLVVT   DS++KIW LD  +ENGSK+ 
Sbjct: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240

Query: 240 EKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXX 299
           EKG YEKQS+QR + V   T  DE  F Y+QN+DKT E+FRIR                 
Sbjct: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300

Query: 300 XXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEY 359
             G ++++IQ+    ++V+ ++QPFQ+++S++K K+ +WT  + SK+ELV TTS+NTIEY
Sbjct: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360

Query: 360 YSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSC 419
           YSIPY+ + P   + SKLYTIE +GHRTD+RSIDIS+DNKLLA+ASNG+LKIWN+ T+SC
Sbjct: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNLKTKSC 420

Query: 420 IRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSD 479
           IRTFDCGYAL CKFLP            ++QLFDL +S ++E+ + AH+AAIWSLD+T D
Sbjct: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480

Query: 480 GRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDR 539
           G+RL+TGSADK++KFWNF +E++L+  +TDK+   ++++HDTTLEL +DILSVKISPED+
Sbjct: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540

Query: 540 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDF 599
           +LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDIS+DSKLIITSSADKNIKIWGLDF
Sbjct: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 600 GDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA 659
           GDCH+SLFAHQD+IMNV F+P+SHNFFS  KDG++KYWDG KF+C+QKL AH+SEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660

Query: 660 LSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFAR 719
           ++SDG   VS SHD S+RVW+ET+DQVFLEEEREKE++EQYE+ LL++LE  + D  F  
Sbjct: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGDSAF-- 718

Query: 720 NSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQ 779
            +              QT+ESLK+GERLMEAL+LG SE+EA E+Y+++   W K K+G+ 
Sbjct: 719 KADIEDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGEP 778

Query: 780 PMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQ 839
           P+KPQ N+IL+A+N+ P++YIMDTL++IKP+QLEDALLVLPFSYVL+FLKFID  ++  +
Sbjct: 779 PVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPE 838

Query: 840 LVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEG 899
           ++ N L LIC+NL  +VK NHKELI+Q+N+ LK QI  VK+KLR +L+ N+DDLGFNI+G
Sbjct: 839 ILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQG 898

Query: 900 LKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           LKFIKQQWN+KHN+EF+DE DQ+  E K+SKKR+F T+
Sbjct: 899 LKFIKQQWNLKHNYEFIDEEDQKKQEEKNSKKRIFGTL 936

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 1246 bits (3224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/938 (64%), Positives = 747/938 (79%), Gaps = 2/938 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTS-PGQIITSSLENINCWDIKTGNLLKT 59
           MV SYQRFEQ S FGV++S  N +WIP E  RT+ PGQIIT +LEN+N WDIKTG L+  
Sbjct: 1   MVKSYQRFEQSSVFGVVSSGDNSIWIPAENKRTNGPGQIITGALENVNIWDIKTGELVSH 60

Query: 60  LSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTA 119
           LSD +PPG+IDA+  KPAEV Y++Y+ +T+LLA GYADGVIKIWDM ++TVL+ FN H +
Sbjct: 61  LSDGLPPGAIDARTTKPAEVTYMQYYSDTSLLAVGYADGVIKIWDMFSKTVLLSFNGHRS 120

Query: 120 AITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSK 179
           A+T L FD +GTRLISGSRDSNII+WDLV EVGL KLRSHKDSITG+   +++WL+S SK
Sbjct: 121 AVTQLLFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDSITGLSLPDENWLMSVSK 180

Query: 180 DGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLK 239
           DGLIK+WD+K QQCVETH+AH  ECW+L + +D+VVT ++DS++KIW LDL+ + G K+ 
Sbjct: 181 DGLIKLWDLKIQQCVETHIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDADAGVKVT 240

Query: 240 EKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXX 299
           EKGI+EKQS+QR V V  +T  D  KFFYVQNADKT E+ R+R                 
Sbjct: 241 EKGIFEKQSKQRGVAVSFITVSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKREKRFK 300

Query: 300 XXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEY 359
             G++++EIQ+  K S+++ I+  FQV+RS+FK ++A+W   + SKLEL  TTS NTIEY
Sbjct: 301 EKGMTDEEIQQNFKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSGNTIEY 360

Query: 360 YSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSC 419
           YSIPY+ ++P      ++++IELQGHRTDVR+IDIS+D KLLA ASNG+LKIWNI T++C
Sbjct: 361 YSIPYEKREPKHPTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNIRTKTC 420

Query: 420 IRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSD 479
           +RTF+CGYAL CKFLP            +LQLFDLASS +LEN E AHDAAIWSLD+TSD
Sbjct: 421 LRTFECGYALTCKFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLDITSD 480

Query: 480 GRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDR 539
           GRRL+TGSADKTVKFWNF VE++ +  +TDK    + + HDTTLE+ +DILSVKISPE++
Sbjct: 481 GRRLVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKISPENK 540

Query: 540 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDF 599
            LAVSLLDNTVKVF+L++MKFFLSLYGHKLPVLSIDIS+DSKLIITSSADKNIKIWGLDF
Sbjct: 541 LLAVSLLDNTVKVFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 600 GDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA 659
           GDCH+SLFAHQD+IMNVKF+P+SHNFFSC KD  +KYWDG KF+ IQKL  H+SEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEVWALA 660

Query: 660 LSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFAR 719
           ++  G   +SVSHD SIRVWEET+DQVFLEEERE+E++EQ EE LL++LE  + D  F +
Sbjct: 661 VARSGTCVISVSHDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGDSAF-K 719

Query: 720 NSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQ 779
                         HKQT+ESLKAGERLMEA+DLGI E+EA E Y + L LW K K G +
Sbjct: 720 QDEKDDDHDDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKKQGVE 779

Query: 780 PMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQ 839
           P +PQ N+IL+A+NK PEEYIMDTLVRIKP+QLEDALL LPFSYVLKFLKF+D  ++ K+
Sbjct: 780 PERPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVLQDKK 839

Query: 840 LVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEG 899
           L++NHL LIC+NL ++V+ NH+EL++QKNEELK +I +VK++LR ALK N DDLGFNIEG
Sbjct: 840 LLHNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGFNIEG 899

Query: 900 LKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           LKFIKQQWN+KHN+EFVDE+DQR    K++KKRVF T+
Sbjct: 900 LKFIKQQWNLKHNYEFVDEFDQRKQAEKTAKKRVFETL 937

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 1246 bits (3224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/940 (63%), Positives = 740/940 (78%), Gaps = 4/940 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPG---QIITSSLENINCWDIKTGNLL 57
           MV SYQRFEQ + FGVI+SNSN VWI  E S+   G   Q+I   LENI  WDIKTG  +
Sbjct: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60

Query: 58  KTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSH 117
             L+D +PPG+ DAK  KPAE  +L+YH ETNLLAAGYADGVIKIWD+ ++TVLI FN H
Sbjct: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120

Query: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLIST 177
            +AIT L FD +GTRLIS S+DS+II+WDLVGE GL KLRSHKD+ITG+W E+++WLIST
Sbjct: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180

Query: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSK 237
           SKDGL+K+WD+KSQQCVETH+AHT ECWSL I +D+ VT +ADS++K+W+LDL+ ENGSK
Sbjct: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240

Query: 238 LKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXX 297
           L EKGI EKQS+QR V++     PD VKFFY+QNADKT E++R+R               
Sbjct: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300

Query: 298 XXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTI 357
               G+SE+EI+E + S  V+ +   FQVVRS +K KSA WT CS SKLELV TTSNN+I
Sbjct: 301 LQDKGMSEEEIKEAMGSP-VSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359

Query: 358 EYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQ 417
           EYYSIPY  ++PTQ A  KL+TI+L G RTD+RS  IS+DNKLLA ASNG LKIWNI T+
Sbjct: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419

Query: 418 SCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLT 477
            CIR+F+CGYAL CKFLP            ELQLFD+ASS +L+NKE AHDAAIWSLDLT
Sbjct: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479

Query: 478 SDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPE 537
           SDGR+L+TGSADKTV+FW F+V +  +S  ++K    LQ+ HDTTLEL +DILSV ISP+
Sbjct: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539

Query: 538 DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL 597
           D+F+AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DISYDSKLI+T SADKNIKIWGL
Sbjct: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599

Query: 598 DFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWA 657
           DFGDCH+SLFAHQD+IMNVKF+P+S+NFFSC KD  +KYWDG KF+CIQKL AH+SEVW+
Sbjct: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659

Query: 658 LALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKF 717
           +++S+DG F +S  HD SIRVWEETEDQVFLEEEREKEMDEQYE+ LL++LE  A DE  
Sbjct: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719

Query: 718 ARNSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSG 777
           +               HKQT+ESLKAGERLMEAL++G++++ A EE++  L  W K+K G
Sbjct: 720 SVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKKG 779

Query: 778 DQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEK 837
            QP++PQ N++L+A+ K PEEYI++TLV+IKP+Q+EDAL+V+PFSY+LKFLKFID    K
Sbjct: 780 IQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTTK 839

Query: 838 KQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNI 897
             L+  H+ L+C+ L +V++ N+KEL+AQKN  LKLQI +VKD LR +LK N+D+LGFNI
Sbjct: 840 AALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFNI 899

Query: 898 EGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           EG+KFIKQQW + H+ EF DEY++++ E K SKKRVF T+
Sbjct: 900 EGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTL 939

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 1244 bits (3218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/938 (62%), Positives = 731/938 (77%), Gaps = 3/938 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL 60
           MV SYQRFEQ S FGVI+SNSNC+W+P E +R S GQ++T +LEN+NCW +K+G L+ TL
Sbjct: 1   MVKSYQRFEQESVFGVISSNSNCLWLPAE-NRNSTGQVLTGALENVNCWSMKSGELIGTL 59

Query: 61  SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120
           +D +PPG++DAK  KPAE +YL+YH ET LLA GY DG IKIWD+ +++VLI FN H +A
Sbjct: 60  TDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKSA 119

Query: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKD 180
           IT L FD +GTRLISGSRDS+II+WDLVGEVGL KLRSHKDSITG+W E ++WLISTSKD
Sbjct: 120 ITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLISTSKD 179

Query: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKE 240
           GLIKVWD+K QQCVETH+AH  ECWS+ + +DLV+TA AD+++K+W L+ E   GS L E
Sbjct: 180 GLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFEESAGSMLIE 239

Query: 241 KGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXXX 300
           KG +EKQSRQR V ++  T  DE  FF++QNAD++ E FR+R                  
Sbjct: 240 KGTHEKQSRQRGVAIQFTTVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKREKRLTE 299

Query: 301 XGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYY 360
            G+SEDEIQ+ +K SF + I+ PFQ+VRS +K +S  W   + SKL+LV TT+NNT++YY
Sbjct: 300 KGLSEDEIQQNLKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANNTVDYY 359

Query: 361 SIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCI 420
           SI Y+ ++PT  +  KL++I+++GHR+DVR+IDIS DNKLLA ASNG LKIWNI T SCI
Sbjct: 360 SIKYQKREPTMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCI 419

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
           RTF+CGYAL CKFLP            +L L+DLASS +L   E AH  AIWSLD+T+DG
Sbjct: 420 RTFECGYALACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDG 479

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
           +RL+TGSADKTV FW+FQVE+E +  +TDK+N +L+M HDTTLEL +D+L+VKISP++R 
Sbjct: 480 KRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRL 539

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
           LAVSLLDNTVKVFF+DSMKFFLSLYGHKLPVLSIDIS+DSKL+ITSSADKNIKIWGLDFG
Sbjct: 540 LAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFG 599

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL 660
           DCHRSLFAH D+IM V FVP+SHNFFSC KD ++KYWDG KF+CIQKL AH+ EVW LA+
Sbjct: 600 DCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLAI 659

Query: 661 SSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFARN 720
           SSDG+F VS SHD+SIRVW ET+DQVFLEEERE+E DEQYE+ LL++LEN A D+ F ++
Sbjct: 660 SSDGRFVVSASHDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDDMFEKD 719

Query: 721 SXX-XXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQ 779
                         HKQT ESLKA E+LMEALDLG+SE+    EY + L  W K +SG  
Sbjct: 720 GNGDGEITDQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKKRSGPH 779

Query: 780 PMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQ 839
           P KP  NSIL+A+NK P EYIMD LV+IKP+QLEDALLVLPF+YVL FL FID  +++K+
Sbjct: 780 PGKPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLVLKEKE 839

Query: 840 LVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEG 899
           L    LPLICRNL +++K NH+EL +QKNEELK+Q+N++KD LR ++K   DDLGFNI+G
Sbjct: 840 LARRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLGFNIQG 899

Query: 900 LKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           L FIKQQWN+KHNFEF D+        K +KKRVF T+
Sbjct: 900 LTFIKQQWNMKHNFEFSDDITVNKTNEK-AKKRVFETL 936

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 1242 bits (3214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/938 (63%), Positives = 737/938 (78%), Gaps = 3/938 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL 60
           MV SYQRFEQ S  GVI+SNSNC+WIP E +R + GQ++T +LEN+NCW +K+G+LL TL
Sbjct: 1   MVKSYQRFEQASVLGVISSNSNCIWIPAE-TRNASGQVLTGALENVNCWSMKSGDLLSTL 59

Query: 61  SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120
           SD +PPG++DAK  KPAE  +L+YH ET LLAAGY DGV+KIWD+ +++VLI FN H +A
Sbjct: 60  SDGLPPGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGHKSA 119

Query: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKD 180
           IT LKFD +GTRLISGS+DS+II+WDLVGEVGL KLRSHKDSITG+W E +DWL+STSKD
Sbjct: 120 ITVLKFDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGEDWLVSTSKD 179

Query: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKE 240
           GLIKVWD+K+QQCVETH+AH  ECWS+ + +DLVVT   D+++K+W +D E+  GS L E
Sbjct: 180 GLIKVWDLKTQQCVETHVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYEKPVGSMLTE 239

Query: 241 KGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXXX 300
           +G +EKQS+QR V V+  T  D V FF+VQNAD+T E FR+RT                 
Sbjct: 240 RGTHEKQSKQRGVSVEFTTISDGVTFFFVQNADRTVETFRLRTEDEISKALKKREKRLSD 299

Query: 301 XGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYY 360
            G++ +EIQ  +K S+ + I+ PFQ++RS +K KSA W   + SKLE+V +TSNNT++YY
Sbjct: 300 KGLTGEEIQANLKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNNTVDYY 359

Query: 361 SIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCI 420
           SIPY  ++P   +  K+Y+I+++GHRTDVR+IDIS+DNKLLA ASNG LKIWNI T+SCI
Sbjct: 360 SIPYNKKEPKLPSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIKTKSCI 419

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
           RTF+CGYAL CKFLP            +L LFDLASS +L + EAAH  AIWSLDLT+DG
Sbjct: 420 RTFECGYALACKFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTADG 479

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
           +RL+TGSADK+V+FW+FQVE+EL+  +TDK+  +L+M HDTTLEL +D+L+VKISP++R 
Sbjct: 480 KRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKISPDNRL 539

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
           LA+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDIS+DSKL+ITSSADKNIK+WGLDFG
Sbjct: 540 LAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDFG 599

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL 660
           DCH+SLFAH D+IM V F+P+SHNFFSCGKDG++KYWDG KF+CIQKL AH+ EVW +A+
Sbjct: 600 DCHKSLFAHSDSIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEVWTIAI 659

Query: 661 SSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKF-AR 719
           S DG F VS SHD+SIRVW ET+DQVFLEEEREKEMDEQYE+ LL++LE+ A D  F   
Sbjct: 660 SHDGTFVVSASHDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDAMFHGD 719

Query: 720 NSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQ 779
            +            HKQT ESLKA ERLMEA+D+G++E+    EY + L  W K KSG  
Sbjct: 720 GNGGAEIGDEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKKKSGPH 779

Query: 780 PMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQ 839
           P +PQ NSILIA+NK P EYIMD L RIKP+QLEDALLVLPFSYVL+FL FI+  IE K 
Sbjct: 780 PGRPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELVIEDKS 839

Query: 840 LVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEG 899
           LV  HLPL+C+NL +++K NH+EL +QKNE+LK+QI+++K  LR ++K   DDLGFNI+G
Sbjct: 840 LVRRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLGFNIQG 899

Query: 900 LKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           LKFIKQQWN+KHNFEF D+      + K  KKRVF TV
Sbjct: 900 LKFIKQQWNLKHNFEFSDDV-IISKQDKKVKKRVFETV 936

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 1233 bits (3191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/942 (64%), Positives = 745/942 (79%), Gaps = 10/942 (1%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL 60
           MV SYQRFEQ S FGVI+SNSN VWIP   +   PG IITS+LENIN WDIKTG L+  L
Sbjct: 1   MVKSYQRFEQTSVFGVISSNSNSVWIP---NGNGPGNIITSALENINIWDIKTGELVNQL 57

Query: 61  SDSIPP-GSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTA 119
           +D +PP GSID+K  KPA V Y +YH +TNLLAAGY+DGVIK+WD+ ++T+L+ FN H +
Sbjct: 58  TDGLPPPGSIDSKLSKPASVTYFKYHEDTNLLAAGYSDGVIKVWDLISKTILLTFNGHKS 117

Query: 120 AITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLISTS 178
           AIT L FD +GTRLISGS DS+II+WDLV EVGL KLRSHKD+ITGIW  +D+ WLISTS
Sbjct: 118 AITILTFDSTGTRLISGSNDSDIIVWDLVSEVGLYKLRSHKDNITGIWCSDDENWLISTS 177

Query: 179 KDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERE-NGSK 237
           KDGLIKVWD+K QQCVETH+AHT ECWSL I +DLVVT +A+S++K W+LDLE + NGSK
Sbjct: 178 KDGLIKVWDLKIQQCVETHIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPNGSK 237

Query: 238 LKEKGIYEKQSRQRSVDVKIVTNP-DEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXX 296
           L EKGI+EKQS+QR + V+ +T+  D+V FF++QNADKT E+FRIR              
Sbjct: 238 LVEKGIFEKQSKQRGLSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKKREK 297

Query: 297 XXXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNT 356
                G+++DEI + +  +FV+ ++ PFQ VRS++K KS  WT  + SKLELV TTS+NT
Sbjct: 298 RLKEKGMTDDEIAQNVDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTSSNT 357

Query: 357 IEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITT 416
           IEYYS+ Y  + P     SK++TIEL G RTD+RSI IS+DNKLLA ASNG+LKIWN+ T
Sbjct: 358 IEYYSVTYAKRIPQ--PPSKIHTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWNLKT 415

Query: 417 QSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDL 476
             CIRTF+CGYALCCKFLP            ELQLFDLASS  LEN E AHDAAIWSLD+
Sbjct: 416 HKCIRTFECGYALCCKFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWSLDI 475

Query: 477 TSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISP 536
           TSDG+RLITGSADKTVKFW+F+++++ +  + D Y   L++ HDTTLE+GEDIL V++SP
Sbjct: 476 TSDGKRLITGSADKTVKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVRLSP 535

Query: 537 EDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWG 596
           +D+FLAVSLLD TVK+FFLDSMKFFLSLYGHKLPVLSIDIS+DSKLIITSSADKNIKIWG
Sbjct: 536 DDKFLAVSLLDYTVKIFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWG 595

Query: 597 LDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVW 656
           LDFGDCH+SLFAH D+IMNVKF+  SHNFFSC KDG IKYWDG KF+CIQKL+AH++EVW
Sbjct: 596 LDFGDCHKSLFAHADSIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQNEVW 655

Query: 657 ALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEK 716
           ++A++ D  F VS SHD S+R+WEETEDQVFLEEERE+EM+EQYE  LL++LE    D  
Sbjct: 656 SIAIADDSSFVVSSSHDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTGDSA 715

Query: 717 FARNSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNK- 775
           F  ++            HKQT ESLKAGERLMEALDLGI E+E  E Y ++L LW K K 
Sbjct: 716 FKSDTKGSEDEDEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKKKKI 775

Query: 776 SGDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASI 835
            GD P+KPQ N+IL A+NK PE+YI++TL++IKP+QLEDA+LV PFSYVLKFLKFID  +
Sbjct: 776 GGDAPIKPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFIDIVL 835

Query: 836 EKKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGF 895
              +++NNHL LIC+NL +V+K NHKELI+QKNE+LKLQ+++VKD+LR AL+ N DDLG+
Sbjct: 836 NDPKVLNNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDDLGY 895

Query: 896 NIEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           NI+GLKFIKQQWN+ HNFEF DE DQ   E+KS KKRVF T+
Sbjct: 896 NIQGLKFIKQQWNLTHNFEFNDELDQNVQESKSGKKRVFGTI 937

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 1224 bits (3166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/932 (63%), Positives = 740/932 (79%), Gaps = 2/932 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSP-GQIITSSLENINCWDIKTGNLLKT 59
           MV SYQRFEQ S FGVI+SNSNCVW+P    ++   G++IT +LENI+ WD+KT  L   
Sbjct: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPSSKKSKSLGKVITGALENISVWDLKTSELEYV 60

Query: 60  LSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTA 119
           LSD +PPGS+D K  KPAEV+YL++H ET L+AAGYADGVIK+WD+ ++TVL+ FN H +
Sbjct: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120

Query: 120 AITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSK 179
            IT LKFD +GT+LISGS DSNII+WDLV EVGL KLRSHK +ITG+W ++D+WLISTSK
Sbjct: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180

Query: 180 DGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLK 239
           DGLIKVWD+K+QQC+ETH+AHT ECW+L I  D VVT++ADS+LKIW++DLE E GSKL 
Sbjct: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240

Query: 240 EKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXX 299
           EKG +EKQS+QR + ++  T  D V FFYVQNADKT E+FR+R                 
Sbjct: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300

Query: 300 XXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEY 359
             G++E++I+  I  S+V+ ++ PFQVVRS +K KS AWT    +KLE+V TT++NTIEY
Sbjct: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360

Query: 360 YSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSC 419
           YS+PY+ + PT     K +TIELQG RTDVRSIDIS+DN LLA ASNG LKIWN+ T+SC
Sbjct: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420

Query: 420 IRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSD 479
           IRTF+CGYAL CKFLP             LQLFDLASS++L   EAAH+ AIWSLD+T+D
Sbjct: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480

Query: 480 GRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDR 539
           G+RL+TGSADK++KFW+FQV++ELI+ ++DKY  ++ +VHD+TLELG+DILS+KIS +D+
Sbjct: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540

Query: 540 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDF 599
           FLA+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS D+K+IITSSADKNIKIWGLDF
Sbjct: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600

Query: 600 GDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA 659
           GDCH+SLFAHQD+IM VKF+P SHNFFS  KDG +KYWDG KF+CIQKL AH+SEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660

Query: 660 LSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFAR 719
           +S +G+  VSVSHD SIR+WEET+DQVFLEEEREKE++EQYE+ LL++LE   +D+ F +
Sbjct: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADDTF-K 719

Query: 720 NSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQ 779
                          KQTIESLKAGERLM+ALDLGI E+E  E Y   ++ + K +  D 
Sbjct: 720 GDVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKYKKKQRIDA 779

Query: 780 PMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQ 839
           P+KP  N+IL+AV K P EYIMDTL+ IKP+QLED+LLVLPFSYVLKFLKF D  ++   
Sbjct: 780 PVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPN 839

Query: 840 LVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEG 899
           ++NN L LIC+NL +++K N KEL++QKNEELKLQI++VK +LR+AL+ N DDLGFNI+G
Sbjct: 840 ILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQG 899

Query: 900 LKFIKQQWNVKHNFEFVDEYDQRDAETKSSKK 931
           LKFIKQQWN+KHNFEFVD+YDQ+    KS+KK
Sbjct: 900 LKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 1220 bits (3156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/942 (63%), Positives = 744/942 (78%), Gaps = 6/942 (0%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTS--PGQIITSSLENINCWDIKTGNLLK 58
           MV SYQRFEQ + FGVI+S +N VW+P    R+S  PGQIITS+LEN+N WDIKTG L+ 
Sbjct: 1   MVKSYQRFEQSAVFGVISSEANNVWLPPLKGRSSGSPGQIITSALENVNIWDIKTGELIA 60

Query: 59  TLSDSIPPGSIDAKYE-KPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSH 117
            L D I PGS D+K   KPAEV +L+YH +++LLA GY DG IK+WD+ ++TVLI  N H
Sbjct: 61  QLQDGITPGSADSKVNTKPAEVTFLQYHPDSSLLAVGYRDGNIKVWDLVSKTVLINLNGH 120

Query: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEND-DWLIS 176
            ++IT LKFD + TRL+SGS DSNIIIWDLV EVG+CKLRSHKD I+ ++ ++D +WL+S
Sbjct: 121 KSSITVLKFDVNCTRLVSGSSDSNIIIWDLVSEVGICKLRSHKDRISDLYVDDDFNWLLS 180

Query: 177 TSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGS 236
            SKDGLIKVWD+K+ QCVETH+AHT ECWSL I DD+V+T +  S++K+W LDL+ E GS
Sbjct: 181 VSKDGLIKVWDLKTNQCVETHIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGEVGS 240

Query: 237 KLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXX 296
           KL EKG+YEKQS+QR   VK + N   V FF + NADKT E+FRIR              
Sbjct: 241 KLIEKGVYEKQSKQRGTSVKFIENSSGVAFFAIGNADKTIEIFRIRPQEEITRALKKREK 300

Query: 297 XXXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNT 356
                G+ +++IQ+ IK SFV+ ++  FQ VRS+FK KS +WT  + SKLELV TTS+NT
Sbjct: 301 RLKEKGMEDEDIQQNIKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTSSNT 360

Query: 357 IEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITT 416
           IEYY+I Y+ ++PTQ A ++LYTIELQG RTD+R+ DIS+DN LLA ASNG+LKIWN+ T
Sbjct: 361 IEYYTIAYEKREPTQPAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWNLRT 420

Query: 417 QSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDL 476
           + CIRTFDCGYAL CKFLP            ELQLFDLASS  +EN E AHDAAIWSLDL
Sbjct: 421 KQCIRTFDCGYALTCKFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWSLDL 480

Query: 477 TSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISP 536
           TS+G+RL+TGSADKTVKFW+FQ+E+  I  ++ K  S+L + HDTTLEL +D+L VKISP
Sbjct: 481 TSNGKRLVTGSADKTVKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVKISP 540

Query: 537 EDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWG 596
           ED+ LAVSLLDNTVK+FFLD+MKFFLSLYGHKLPVLSIDIS+DSK++ITSSADKNIKIWG
Sbjct: 541 EDKHLAVSLLDNTVKIFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIKIWG 600

Query: 597 LDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVW 656
           LDFGDCH+SLFAHQD+IMNVKF+P+SHNFFSC KDG +KYWDG KF+C+QKL++H+SEVW
Sbjct: 601 LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQSEVW 660

Query: 657 ALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEK 716
            LA+  DG F VS SHD SIR+W+ETEDQVFLEEEREKEM+EQYEE LL++LE    D+ 
Sbjct: 661 CLAMGLDGSFVVSTSHDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTGDDA 720

Query: 717 FARNSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKS 776
           F ++S            HKQTIESLKA E+LM+ALDLG++E+EA E Y+ ++ LW K K 
Sbjct: 721 FKKDS-VDGEGDEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALWKKKKI 779

Query: 777 GDQ-PMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASI 835
           G + P+KP  N++L+AV K PE+YIM+TL RIKP+QLEDALL+LPFSYVLKFLKFID  +
Sbjct: 780 GSEMPVKPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKFIDIVL 839

Query: 836 EKKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGF 895
           + K++++N+L LIC+NL ++V+ NHKELI+QKNEELKLQI +VK +LR  LK N D LGF
Sbjct: 840 KNKKMLHNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNEDALGF 899

Query: 896 NIEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           NI+GLKFIKQQW++KHNFEFVDEYDQR  E K +KKR+F T+
Sbjct: 900 NIQGLKFIKQQWDLKHNFEFVDEYDQRIQEEKKAKKRIFETL 941

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 1104 bits (2856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/941 (58%), Positives = 711/941 (75%), Gaps = 10/941 (1%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTL 60
           MV SYQRFEQ   FG+I++++  +++P   + ++ G++IT +LENI  W +KT N ++ L
Sbjct: 1   MVKSYQRFEQSGLFGLISTSNQSIYLP--ATNSTSGKLITGALENIQIWTLKT-NEVEVL 57

Query: 61  SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120
           +D +P G+++    KP+ V  + +H ET LL  GY DGVIK+WD+ +++VL+ FN H + 
Sbjct: 58  TDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGHKSG 117

Query: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSK 179
           +T L+ D  GTRL+SGS+DS++IIWDLVGEVGL KLRSHKD+ITGIW + N DWLIS +K
Sbjct: 118 VTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLISVAK 177

Query: 180 DGLIKVWDIKSQ-QCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKL 238
           DGLIKVWD+K+  QCVETHMAHT +CWS+AI +++++T + DS+ KIWELDLE+ NG K+
Sbjct: 178 DGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSNGEKI 237

Query: 239 KEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXX 298
            E+G +E +S+QR V  + +T P+  +FFY+QN DKT E+FRIR                
Sbjct: 238 SERGTFETESKQRGVSTEFITAPNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNRREKRL 297

Query: 299 XXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIE 358
              G SE+EIQE +  + ++ +   F  VRSS+K KS+ W + S SKLE+V TTSNNTIE
Sbjct: 298 RDKGASEEEIQEAVNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTSNNTIE 357

Query: 359 YYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQS 418
            Y IPY  +        + Y +ELQGHRTD+RS+DIS+D KLL+ ASNG LK+WN+TT+ 
Sbjct: 358 SYQIPYSKRDAE--PPVRRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKK 415

Query: 419 CIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTS 478
           CIRTF CGYALC + LP            ELQLFDLASS +L   EA H AAIWSLDLTS
Sbjct: 416 CIRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASSTLLSTTEA-HTAAIWSLDLTS 474

Query: 479 DGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPED 538
           +G+RL+TGSADK+ KFW+F+V ++L+  + DKY  +L++VHDTTLEL +DIL+VKIS ED
Sbjct: 475 NGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSED 534

Query: 539 RFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLD 598
           R+LAVSLLDNTVKVFF DS+KF+LSLYGHKLPVLSID S DSK++ITSSADKNIKIWG+D
Sbjct: 535 RYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVD 594

Query: 599 FGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWAL 658
           FGDCH+S+FAHQD+IM+V+F   +HNFFSCGKDG +K WDG KFDCIQKL  H+SEVW +
Sbjct: 595 FGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCI 654

Query: 659 ALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFA 718
           A+S DG+  VS SHD SIRVW+ET+DQVFLEEE+E+EM+E+YEE LL +LE  + D++F 
Sbjct: 655 AVSPDGRTVVSTSHDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSGDDQFL 714

Query: 719 R--NSXXXXXXXXXXXXHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKS 776
           R  NS            +KQT+ESLKAGE+LMEALDLG++E+E+ E Y ++L  W K KS
Sbjct: 715 RDKNSGDDGVIDEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKSWKKKKS 774

Query: 777 GDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIE 836
           G+ PMKPQSN+ILIA+   PE+YIMDTL +IKP+QLED+LLVLPFSYV+KF KF D  ++
Sbjct: 775 GEPPMKPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFFDVIMK 834

Query: 837 KKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFN 896
           +K LV  HL LIC+ L ++V+ N+KEL+AQKNEELK +I +VK  +R  L+ N DDLGFN
Sbjct: 835 QKDLVLLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNADDLGFN 894

Query: 897 IEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937
           I GL FIKQQWN++HN EF D+Y Q + E K +KKRVF TV
Sbjct: 895 IAGLNFIKQQWNLRHNLEFTDDYSQLEHEKKVAKKRVFETV 935

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 157/649 (24%), Positives = 272/649 (41%), Gaps = 120/649 (18%)

Query: 72  KYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF--DPS 129
           K   P+ V  ++    + L+A G  DG I + D++   +   F  H   I+ LKF  + +
Sbjct: 99  KISSPSYV--MDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELN 156

Query: 130 GTRLISGSRDSNII--IWDLVGEVGLCKLRSHKDSITGIWF---ENDDW--LISTSKDGL 182
           G + +  S D+N +  +WDLV    L  ++ H  +I G+ F   E +D   L+S  +D +
Sbjct: 157 GDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDI 216

Query: 183 IKVWDI---KSQQCVETHMAHT-TECWSLAISDDLVVTANADSELKIWELDLERENGSKL 238
           + +W+    K  + ++T   H   E        DLV TA  ++ L++  + LE +   K 
Sbjct: 217 VNLWEFNMKKHSKLLKTVPVHQQVESCGFVRESDLVYTAGGEAVLQL--ISLESQKVIKK 274

Query: 239 KEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXX 298
            +K I E       V V  + +  E   FY+  +D+T ++  +                 
Sbjct: 275 TQKPIEE----LFIVGVLPILSGRE---FYLVLSDQTLQLINM----------------- 310

Query: 299 XXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKL-ELVFTTSNNTI 357
                      E+  S+F +++I     +  +    + A  R     L ++   T++  +
Sbjct: 311 -----------EEAISNFDDELINVASSIAGNHG--TIADIRVVGPGLNKIALATNSPAL 357

Query: 358 EYYSIPY--KNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKI-WNI 414
               IP   +N  P  V   ++Y    +GH   + S+D +ED   LA  S     I W  
Sbjct: 358 RIIPIPQTSENSLPLDV---EVY----EGHEDLLNSLDATEDGLWLATCSKDSSAILWRF 410

Query: 415 TTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSL 474
             ++             KF P                           K   H A++ ++
Sbjct: 411 NVETA------------KFFPYA-------------------------KFTGHSASVTAV 433

Query: 475 DLTSDGRR-----LITGSADKTVKFWNFQ--VEKELISSSTDKYNSRLQMVHDTTLELGE 527
            L +   R     LIT S D TVK W       +++    T K +     VH       +
Sbjct: 434 ALPNVMLRGWPEFLITASNDLTVKRWKVPKPANEDISDLLTIKQSEYTFHVH------AK 487

Query: 528 DILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSS 587
           DI ++ ++P D   A +  D T K++ +++ +   +L GHK  +  +      KL+ TSS
Sbjct: 488 DINALSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSS 547

Query: 588 ADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQK 647
            DK IKIW LD   C ++L  H +A+    F+ +     S G DG+IK WD +  DC++ 
Sbjct: 548 GDKTIKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKT 607

Query: 648 LIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEM 696
           L  H + +WA+ + +DG   +S   D   + W +       EE+RE+++
Sbjct: 608 LDGHGNRIWAMNVCNDGDLIISADADGVFQFWRDCT-----EEQREQDL 651

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 66/149 (44%), Gaps = 19/149 (12%)

Query: 49  WDIKTGNLLKTLSDSIPPGSIDAKYEKPA-EVAYLEYHHETNLLAAGYADGVIKIWDMQT 107
           WD++TG    TL          A +++   +V++ +Y     LLA    D  IKIW++ T
Sbjct: 513 WDVETGESKATL----------AGHKRGLWDVSFCQYD---KLLATSSGDKTIKIWNLDT 559

Query: 108 QTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIW 167
            + +     HT A+    F     +L+S   D  I IWD +    L  L  H + I  + 
Sbjct: 560 FSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAMN 619

Query: 168 FEND-DWLISTSKDGLIKVWDIKSQQCVE 195
             ND D +IS   DG+ + W    + C E
Sbjct: 620 VCNDGDLIISADADGVFQFW----RDCTE 644

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 70/162 (43%), Gaps = 9/162 (5%)

Query: 527 EDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITS 586
           ++I +++++P+ R+L        +K+F LDSMK   S+     P   +D    S LI   
Sbjct: 61  QEITALRLTPDGRYLCYVSQAQQLKIFSLDSMKITRSMKISS-PSYVMDSDSTSTLIAIG 119

Query: 587 SADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN----FFSCGKDGVIKYWDGVKF 642
             D +I +  ++ G    S   H   I ++KF  + +       S   +GV K WD VK 
Sbjct: 120 GTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELNGDKWLLASGDTNGVAKVWDLVKR 179

Query: 643 DCIQKLIAHKSEVWALAL----SSDGQFFVSVSHDRSIRVWE 680
            C+  +  H S +  L        D    +S   D  + +WE
Sbjct: 180 RCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWE 221

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 163/679 (24%), Positives = 275/679 (40%), Gaps = 132/679 (19%)

Query: 33  TSPGQIIT--SSLENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNL 90
           T  GQ +T  S  + +  + +KTG +++++  S P   +DA                + L
Sbjct: 70  TPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDAD-------------STSTL 116

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF----DPSGTRLISGSRDSNIIIWD 146
           LA G  DG I + D++   +   F  H   I+ LKF    D     L SG  +  + +WD
Sbjct: 117 LAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWD 176

Query: 147 LVGEVGLCKLRSHKDSITG---IWFENDDW----LISTSKDGLIKVWDI---KSQQCVET 196
           LV    L  L+ H  ++ G   +  +N D     L+S  +D +I +WD    K+ + ++T
Sbjct: 177 LVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIWDFNMKKTCKLIKT 236

Query: 197 HMAH--TTECWSLAISDD--LVVTANADSELKIWELDLERENGSKLKEKGIYEKQSRQRS 252
              +     C  L   DD  L+ TA  D+  ++ +L           E GI  K++ +  
Sbjct: 237 LPVNQQVESCGFLRYHDDKHLIYTAGGDAIFQLIDL-----------ESGIMIKKTNKPI 285

Query: 253 VDVKIVTNPDEV---KFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXXXXGISEDEIQ 309
            ++ I+     V   K F V  +D+T ++  +                      SE+EI 
Sbjct: 286 EELFIIGVLPIVSSSKMFLVM-SDQTLQLINVEEVIK-----------------SENEII 327

Query: 310 EKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYYSIPYKNQKP 369
           E      V+  I     + +  +F         L+KL L    + N+     IP  +   
Sbjct: 328 E------VSSTIAGNHGIIADMRFVGP-----ELNKLAL----ATNSPSLRIIPIPDLAG 372

Query: 370 TQVAASKLYTIEL-QGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGY 427
           T   AS    +E+ +GH   + S+D +ED   +A AS +    +W     +  R F+   
Sbjct: 373 T--TASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNENT--RKFE--- 425

Query: 428 ALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRR----- 482
                                           + +K   H +A+ ++ L     +     
Sbjct: 426 --------------------------------VYSKYIGHSSAVTAVGLPKIMPKGYPEF 453

Query: 483 LITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLA 542
           L+T S D T+K W            T K +   +  H+      +DI ++ ISP D   A
Sbjct: 454 LLTASNDLTIKKWKIPKPTFPFDVQTIKVSEYTRHAHE------KDINALSISPNDSIFA 507

Query: 543 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDC 602
            +  D T K++ L++ +   +L  HK  +  +      KL+ T S DK +KIW LD    
Sbjct: 508 TASYDKTCKIWNLENGELEATLSNHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFSV 567

Query: 603 HRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSS 662
            ++L  H +A+    F+ +     SCG DG+IK WD    +C++ L  H + +WAL   +
Sbjct: 568 MKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWALNTMN 627

Query: 663 DGQFFVSVSHDRSIRVWEE 681
           DG   VS   D   + W++
Sbjct: 628 DGDIIVSADADGVFQFWKD 646

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 92/379 (24%), Positives = 159/379 (41%), Gaps = 55/379 (14%)

Query: 382 LQGHRTDVRSIDISEDN-------KLLAAASNGMLKIWNITTQ-SC--IRTFDCGYAL-C 430
           LQ H + VR +DI E         KLL+   + ++ IW+   + +C  I+T      +  
Sbjct: 186 LQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIWDFNMKKTCKLIKTLPVNQQVES 245

Query: 431 CKFLPXXXXXXXXXXXXE---LQLFDLASSIVLE--NKEAAHDAAIWSLDLTSDGRRLIT 485
           C FL                  QL DL S I+++  NK       I  L + S  +  + 
Sbjct: 246 CGFLRYHDDKHLIYTAGGDAIFQLIDLESGIMIKKTNKPIEELFIIGVLPIVSSSKMFLV 305

Query: 486 GSADKTVKFWN----FQVEKELI--SSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDR 539
            S D+T++  N     + E E+I  SS+    +  +  +     EL +  L+   SP  R
Sbjct: 306 MS-DQTLQLINVEEVIKSENEIIEVSSTIAGNHGIIADMRFVGPELNKLALATN-SPSLR 363

Query: 540 FLAVSLLDNTVKVFFLDSMKFFLSLY-GHKLPVLSIDISYDSKLIITSSADKNIKIWGLD 598
            + +  L  T     LD     + +Y GH+  + S+D + D   I T+S D +  +W  +
Sbjct: 364 IIPIPDLAGTTASLPLD-----VEIYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYN 418

Query: 599 FG----DCHRSLFAHQDAIMNV---KFVPQSHNFF--SCGKDGVIKYWDGVK----FDCI 645
                 + +     H  A+  V   K +P+ +  F  +   D  IK W   K    FD +
Sbjct: 419 ENTRKFEVYSKYIGHSSAVTAVGLPKIMPKGYPEFLLTASNDLTIKKWKIPKPTFPFD-V 477

Query: 646 QKLI-------AHKSEVWALALSSDGQFFVSVSHDRSIRVW--EETEDQVFLEEEREKEM 696
           Q +        AH+ ++ AL++S +   F + S+D++ ++W  E  E +  L   +    
Sbjct: 478 QTIKVSEYTRHAHEKDINALSISPNDSIFATASYDKTCKIWNLENGELEATLSNHKRGLW 537

Query: 697 DEQY--EEKLLSTLENDAS 713
           D  +   +KLL+T   D +
Sbjct: 538 DVTFCQYDKLLATCSGDKT 556

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 78/174 (44%), Gaps = 11/174 (6%)

Query: 517 MVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDI 576
           ++H  + E  ++I ++K++P+ ++L        +K+F L + K   S+     P   +D 
Sbjct: 52  IIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISS-PSYILDA 110

Query: 577 SYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN----FFSCGKDG 632
              S L+     D +I +  ++ G    S   H   I ++KF  Q  +      S   +G
Sbjct: 111 DSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNG 170

Query: 633 VIKYWDGVKFDCIQKLIAHKSEVWALAL----SSDGQF--FVSVSHDRSIRVWE 680
           ++K WD VK  C+  L  H S V  L +    +SD  F   +S   D  I +W+
Sbjct: 171 MVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIWD 224

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 164/677 (24%), Positives = 275/677 (40%), Gaps = 128/677 (18%)

Query: 33  TSPGQIIT--SSLENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNL 90
           T  GQ +T  S  + +  + +KTG +++++  S P   +DA                + L
Sbjct: 70  TPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDAD-------------STSTL 116

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF----DPSGTRLISGSRDSNIIIWD 146
           LA G  DG I + D++   +   F  H   I+ LKF    +     L SG  +  + +WD
Sbjct: 117 LAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWD 176

Query: 147 LVGEVGLCKLRSHKDSITGIWF----ENDDW---LISTSKDGLIKVWDIKSQQCVETHMA 199
           LV    L  L+ H  ++ G+      +ND+    L+S  +D +I +WD   ++  +    
Sbjct: 177 LVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFNMKKKCKLLKT 236

Query: 200 -----HTTECWSLAISDD--LVVTANADSELKIWELDLERENGSKLKEKGIYEKQSRQRS 252
                    C  L   D   ++ TA  D+   I++L ++ E+GS LK       +  +  
Sbjct: 237 LPVNQQVESCGFLKDGDGKRIIYTAGGDA---IFQL-IDSESGSVLKRT----NKPIEEL 288

Query: 253 VDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXXXXGISEDEIQEKI 312
             + ++      + F V  +D+T ++  +                       ED IQ   
Sbjct: 289 FIIGVLPILSNSQMFLVL-SDQTLQLINVEEDLKN----------------DEDTIQVTS 331

Query: 313 KSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYYSIPYKNQKPTQV 372
             +  + II   + V               L+KL L    + N+     IP  +    + 
Sbjct: 332 SIAGNHGIIADMRYVGPE------------LNKLAL----ATNSPSLRIIPVPDLSGPE- 374

Query: 373 AASKLYTIEL-QGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYALC 430
            AS    +E+ +GH   + S+D +ED   +A AS +    +W     SC   FD  YA  
Sbjct: 375 -ASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSC--KFDI-YA-- 428

Query: 431 CKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDL---TSDGRR--LIT 485
                                           K   H AA+ ++ L    S G    L+T
Sbjct: 429 --------------------------------KYIGHSAAVTAVGLPNIVSKGYPEFLLT 456

Query: 486 GSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGE-DILSVKISPEDRFLAVS 544
            S D T+K W       +I   T   + ++  V + T    E DI ++ +SP D   A +
Sbjct: 457 ASNDLTIKKW-------IIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATA 509

Query: 545 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHR 604
             D T K++ L++ +   +L  HK  +  +      KL+ TSS DK +KIW LD     +
Sbjct: 510 SYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMK 569

Query: 605 SLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDG 664
           +L  H +A+    F+ +     SCG DG+IK WD    +C++ L  H + +WAL+  +DG
Sbjct: 570 TLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDG 629

Query: 665 QFFVSVSHDRSIRVWEE 681
              VS   D   + W++
Sbjct: 630 DMIVSADADGVFQFWKD 646

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 68/147 (46%), Gaps = 5/147 (3%)

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 575
           +++H  + E  ++I ++K++P+ ++L        +K+F L + K   S+     P   +D
Sbjct: 51  KILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISS-PSYILD 109

Query: 576 ISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN----FFSCGKD 631
               S L+     D +I +  ++ G    S   H   I ++KF  Q ++      S   +
Sbjct: 110 ADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTN 169

Query: 632 GVIKYWDGVKFDCIQKLIAHKSEVWAL 658
           G++K WD VK  C+  L  H S V  L
Sbjct: 170 GMVKVWDLVKRKCLHTLQEHTSAVRGL 196

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 20/182 (10%)

Query: 36  GQII-TSSLENINCWDIKTGN--LLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLA 92
           G+I+ T  L+ IN  D+  G+  +L  +S+           E   E+  L+   +   L 
Sbjct: 29  GKILATPVLDEINIIDLTPGSRKILHKISN-----------EDEQEITALKLTPDGQYLT 77

Query: 93  AGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVG 152
                 ++KI+ ++T  V+      + +   L  D + T L  G  D +II+ D+     
Sbjct: 78  YVSQAQLLKIFHLKTGKVVRSMKISSPSY-ILDADSTSTLLAVGGTDGSIIVVDIENGYI 136

Query: 153 LCKLRSHKDSITGIWF----ENDDWLISTS-KDGLIKVWDIKSQQCVETHMAHTTECWSL 207
               + H  +I+ + F     +  WL+++   +G++KVWD+  ++C+ T   HT+    L
Sbjct: 137 THSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGL 196

Query: 208 AI 209
            I
Sbjct: 197 DI 198

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 85/203 (41%), Gaps = 29/203 (14%)

Query: 535 SPEDRFLAVSLLDNTVKVFFLDSMKFFLSLY-GHKLPVLSIDISYDSKLIITSSADKNIK 593
           SP  R + V  L        LD     + +Y GH+  + S+D + D   I T+S D    
Sbjct: 359 SPSLRIIPVPDLSGPEASLPLD-----VEIYEGHEDLLNSLDATEDGLWIATASKDNTAI 413

Query: 594 IWGLDFGDCHRSLFA----HQDAIMNVKF---VPQSHNFF--SCGKDGVIKYW----DGV 640
           +W  +   C   ++A    H  A+  V     V + +  F  +   D  IK W       
Sbjct: 414 VWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTA 473

Query: 641 KFDC-IQKLI-----AHKSEVWALALSSDGQFFVSVSHDRSIRVW--EETEDQVFLEEER 692
             D  I K+      AH+ ++ AL++S +   F + S+D++ ++W  E  E +  L   +
Sbjct: 474 SMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHK 533

Query: 693 EKEMDEQY--EEKLLSTLENDAS 713
               D  +   +KLL+T   D +
Sbjct: 534 RGLWDVSFCQYDKLLATSSGDKT 556

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 150/625 (24%), Positives = 257/625 (41%), Gaps = 108/625 (17%)

Query: 88  TNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTR----LISGSRDSNII 143
           + L+A G  DG I + D++   +      H A I+ LKF          L SG  +  + 
Sbjct: 118 STLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVK 177

Query: 144 IWDLVGEVGLCKLRSHKDSITGIWFE--NDDW-LISTSKDGLIKVWDIK-SQQC-----V 194
           +WDLV    L  ++ H +++ G+      D+W LIS  +D +  +W+    ++C     +
Sbjct: 178 VWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFNLKKKCTLLKTI 237

Query: 195 ETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKEKGIYEKQSRQRSVD 254
             H    +  +     DDL+ TA  D+ L+   + LE+    K  +K I E       + 
Sbjct: 238 PVHQQVESCGFINHEHDDLIYTAGGDALLQF--ISLEKATMIKKTKKHIEE----LFIIG 291

Query: 255 VKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXXXXGISEDEIQEKIKS 314
           V  +   D++   Y+  +D+T E+  I++                    S D I+ +   
Sbjct: 292 VLPILENDKM---YLVMSDQTLELVDIKSNLLNE---------------SSDIIEIESCI 333

Query: 315 SFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYYSIPYKNQKPTQVAA 374
           +  N  I   + V  +                +L   T++ T+    +P   Q+   +  
Sbjct: 334 AGNNGTIADMKFVGPNHD--------------KLALATNSPTLRIIPVPSSEQEELPINV 379

Query: 375 SKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKI-WNITTQSCIRTFDCGYALCCKF 433
            ++Y    +GH   + S+D ++D   +A AS     I W               ++  KF
Sbjct: 380 -EMY----EGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYN------------SIINKF 422

Query: 434 LPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRR-----LITGSA 488
            P                           K   H A + ++ L +   R     L+T S 
Sbjct: 423 QPYV-------------------------KFIGHSATVTAVGLPNVMLRGYPEFLLTASN 457

Query: 489 DKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGE-DILSVKISPEDRFLAVSLLD 547
           D T+K W  ++ K    S+T + + ++  V + T    E DI ++ ISP D   A +  D
Sbjct: 458 DLTIKKW--KIPK---PSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFATASYD 512

Query: 548 NTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLF 607
            T K++ L++ +   +L  HK  +  +      KLI T S DK IKIW LD     ++L 
Sbjct: 513 KTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTLE 572

Query: 608 AHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFF 667
            H +A+    F+ +     S G DG+IK WD    DC++ L  H + +WAL   +DG   
Sbjct: 573 GHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRIWALTEINDGDMI 632

Query: 668 VSVSHDRSIRVWEETEDQVFLEEER 692
           VS   D   + W++  +   LE+E+
Sbjct: 633 VSADADGVFQFWKDCTE---LEKEQ 654

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 102/520 (19%), Positives = 199/520 (38%), Gaps = 109/520 (20%)

Query: 77  AEVAYLEYHHETN----LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGT- 131
           A ++ L++  + N    LL +G  +G++K+WD+  +  L     H+ A+  L     G  
Sbjct: 149 ATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDE 208

Query: 132 -RLISGSRDSNIIIW--DLVGEVGLCK---LRSHKDSITGIWFENDDWLISTSKDGLIKV 185
            +LISG RD+   +W  +L  +  L K   +    +S   I  E+DD + +   D L++ 
Sbjct: 209 WQLISGGRDNVCTLWNFNLKKKCTLLKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQF 268

Query: 186 WDIKSQQCVETHMAHTTECWSLAI----SDDLVVTANADSELKIWELD------------ 229
             ++    ++    H  E + + +     +D +    +D  L++ ++             
Sbjct: 269 ISLEKATMIKKTKKHIEELFIIGVLPILENDKMYLVMSDQTLELVDIKSNLLNESSDIIE 328

Query: 230 ----LERENGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXX 285
               +   NG+    K +     +     + + TN   ++   V ++++  E   I    
Sbjct: 329 IESCIAGNNGTIADMKFVGPNHDK-----LALATNSPTLRIIPVPSSEQ--EELPINVEM 381

Query: 286 XXXXXXXXXXXXXXXXGI-----SEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTR 340
                           G+     S+D      K + + +  QP+      F   SA  T 
Sbjct: 382 YEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPY----VKFIGHSATVTA 437

Query: 341 CSLSKL------ELVFTTSNN-TIEYYSIPYKN---QKPTQVAASKLYTIELQGHRTDVR 390
             L  +      E + T SN+ TI+ + IP  +   ++  Q+     YT   + H  D+ 
Sbjct: 438 VGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYT--RRAHEKDIN 495

Query: 391 SIDISEDNKLLAAAS-----------NGML------------------------------ 409
           ++ IS ++ + A AS           NG L                              
Sbjct: 496 ALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDK 555

Query: 410 --KIWNITTQSCIRTFDCGYALC---CKFLPXXXXXXXXXXXXELQLFDLASSIVLENKE 464
             KIW++ T S ++T + G+      C F+              ++++D ++   L+  +
Sbjct: 556 TIKIWSLDTFSVMKTLE-GHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLD 614

Query: 465 AAHDAAIWSLDLTSDGRRLITGSADKTVKFWN--FQVEKE 502
             HD  IW+L   +DG  +++  AD   +FW    ++EKE
Sbjct: 615 -GHDNRIWALTEINDGDMIVSADADGVFQFWKDCTELEKE 653

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 90/200 (45%), Gaps = 13/200 (6%)

Query: 483 LITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLA 542
           + T SAD TV       + E+IS +T +     + +H    +  ++I ++K++P+ ++L+
Sbjct: 22  IATVSADGTVLATPILDDIEIISLTTPQ-----RRLHSIANDDEQEITALKLTPDAQYLS 76

Query: 543 VSLLDNTVKVFFLDSMKF----FLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLD 598
               +  +K+F LD  K      +       P   +D    S L+     D +I +  ++
Sbjct: 77  FISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDSTSTLVALGGTDGSITVVDIE 136

Query: 599 FGDCHRSLFAHQDAIMNVKFVPQSHN--FFSCGKD--GVIKYWDGVKFDCIQKLIAHKSE 654
            G    SL  H   I  +KF  Q+++  +  C  D  G++K WD VK  C+  +  H + 
Sbjct: 137 NGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNA 196

Query: 655 VWALALSSDGQFFVSVSHDR 674
           V  L +   G  +  +S  R
Sbjct: 197 VRGLDVREVGDEWQLISGGR 216

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 58/120 (48%), Gaps = 9/120 (7%)

Query: 123 FLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWF----ENDDWLI-ST 177
            +  D + T +  G  D +I + D+        L+ H  +I+ + F     ++ WL+ S 
Sbjct: 111 IMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSG 170

Query: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSL---AISDDL-VVTANADSELKIWELDLERE 233
             +G++KVWD+  ++C+ T   H+     L    + D+  +++   D+   +W  +L+++
Sbjct: 171 DTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFNLKKK 230

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 147/652 (22%), Positives = 257/652 (39%), Gaps = 118/652 (18%)

Query: 72  KYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF----D 127
           K   PA V  L+    + LLA G  DG + ++D+    V      H A I+ +KF    D
Sbjct: 99  KISSPAYV--LDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVD 156

Query: 128 PSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFE----NDDWLISTSKDGLI 183
                L SG  +  + IWDLV    +  ++ H  ++ G+        +  L+S  +D ++
Sbjct: 157 SGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVV 216

Query: 184 KV--WDIKSQ----QCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSK 237
            V  +D+K +    Q +         C  +  +  L+ TA  D+  +I  L         
Sbjct: 217 HVHHFDMKKKCKLLQTIPVKR-QIESCGFIGDNTSLIYTAGGDAVYQIISL--------- 266

Query: 238 LKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXX 297
             E G   KQ+ Q   ++ IV          VQN+ K   V   +T              
Sbjct: 267 --ESGKSIKQTAQPVEELFIV------GVLPVQNSTKCYLVLSDQTLFLIDVEKALSQTE 318

Query: 298 XXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTI 357
                    EI++KI  +  +  I   ++V  S                 L   T++ T+
Sbjct: 319 KMI------EIEKKIAGN--HGTIADMRLVGPSLN--------------RLALATNSPTL 356

Query: 358 EYYSIPYKNQ-KPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNIT 415
                P  ++ K      +++Y    +GH   + S+D + D   LA AS +  + +W   
Sbjct: 357 RIIPTPQASEDKEVMEIETEMY----EGHTDLLNSLDATSDGLWLATASKDHSVILWRYN 412

Query: 416 TQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLD 475
             S        +    KFL                                H   + ++ 
Sbjct: 413 EASS------SFEPFTKFL-------------------------------GHAGPVTAIA 435

Query: 476 LTSDGRR-----LITGSADKTVKFW---NFQVEKELISSSTDKYNSRLQMVHDTTLELGE 527
           L +   R     L+T S D T+K W   N    K +      K +   +  H+      +
Sbjct: 436 LPNVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHE------K 489

Query: 528 DILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSS 587
           DI ++ +SP D   A +  D T K++ +D+ +   +L  HK  +  +       L+ T S
Sbjct: 490 DINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCS 549

Query: 588 ADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQK 647
            D++I +W L+     ++L  H +A+  V F+  +    S G DG++K WD    +C++ 
Sbjct: 550 GDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRT 609

Query: 648 LIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQ 699
           L AH + +WALA+++DGQ  ++   D   + WE+       EEE E+ ++++
Sbjct: 610 LDAHNNRIWALAVANDGQLIITADADGVFQFWEDNS-----EEEHERNIEQE 656

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 118/249 (47%), Gaps = 9/249 (3%)

Query: 8   FEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLE-NINCWDIKTGNLLKTLSDSIPP 66
           FE  + F   A     + +P   +R  P  ++T+S +  I  W +   N  K +   +P 
Sbjct: 418 FEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIE--LPH 475

Query: 67  GSIDAKYEKPA---EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITF 123
               ++Y + A   ++  +      ++ A    D   KIW++ T  V     +H   +  
Sbjct: 476 IVKASEYTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWG 535

Query: 124 LKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGL 182
           + F      L + S D +I +W L     L  L  H +++  + F N +  L+ST  DGL
Sbjct: 536 VAFCEYDWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGL 595

Query: 183 IKVWDIKSQQCVETHMAHTTECWSLAISDD--LVVTANADSELKIWELDLERENGSKLKE 240
           +K+WD  + +CV T  AH    W+LA+++D  L++TA+AD   + WE + E E+   +++
Sbjct: 596 VKIWDCSTGECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFWEDNSEEEHERNIEQ 655

Query: 241 KGIYEKQSR 249
           + +  +Q +
Sbjct: 656 EKLRVEQEQ 664

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 68/146 (46%), Gaps = 5/146 (3%)

Query: 517 MVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDI 576
           ++H    E  +D+ +++++P+ R+L  +  +  ++ + L++ +   S+     P   +D 
Sbjct: 51  IIHKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISS-PAYVLDC 109

Query: 577 SYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN----FFSCGKDG 632
              S L+     D ++ ++ +  G    SL  H   I +VKF  +  +      S   +G
Sbjct: 110 DESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNG 169

Query: 633 VIKYWDGVKFDCIQKLIAHKSEVWAL 658
           ++K WD VK  CI  +  H + V  L
Sbjct: 170 MVKIWDLVKRRCIHTVQEHTAAVRGL 195

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 115/233 (49%), Gaps = 18/233 (7%)

Query: 483 LITGSADKTVKFWNFQ------VEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISP 536
           L++ S D TVK W          E E+    T +Y  R    H+      +DI ++ ISP
Sbjct: 447 LLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRR---AHE------KDINALSISP 497

Query: 537 EDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWG 596
            D   A +  D T K++ L + +   +L  HK  +  +      KLI T S DK IKIW 
Sbjct: 498 NDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWS 557

Query: 597 LDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVW 656
           L+  +   +L  H +A+  + F+ ++    SCG DG++K WD    +C++ L AH + +W
Sbjct: 558 LENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIW 617

Query: 657 ALALSSDGQFFVSVSHDRSIRVWE---ETEDQVFLEEEREKEMDEQYEEKLLS 706
           AL ++ DG  FV+   D   + W+   E E +  LE++R K   EQ  +  LS
Sbjct: 618 ALEVADDGDRFVTADADGLFQFWKDNSEEEHEQDLEKKRLKVEQEQSLQNYLS 670

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 113/249 (45%), Gaps = 9/249 (3%)

Query: 8   FEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLE-NINCWDIKTGNLLKTLSDSIPP 66
           F+Q + F   A +   V +P    +  P  +++SS +  +  W +       T  D IP 
Sbjct: 417 FKQYAKFIGHAGSVTAVALPNIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPT-EDEIPV 475

Query: 67  GSIDAKYEKPA---EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITF 123
               ++Y + A   ++  L      ++ A    D   KIWD+ T  ++    +H   +  
Sbjct: 476 VKT-SEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWD 534

Query: 124 LKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGL 182
           + F      + + S D  I IW L        L  H +++  I F N +  L+S   DGL
Sbjct: 535 VSFCQHDKLIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGL 594

Query: 183 IKVWDIKSQQCVETHMAHTTECWSLAISD--DLVVTANADSELKIWELDLERENGSKLKE 240
           +K+WD  + +C+ T  AH    W+L ++D  D  VTA+AD   + W+ + E E+   L++
Sbjct: 595 VKIWDCSTGECLRTLDAHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEEEHEQDLEK 654

Query: 241 KGIYEKQSR 249
           K +  +Q +
Sbjct: 655 KRLKVEQEQ 663

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 77/177 (43%), Gaps = 16/177 (9%)

Query: 461 ENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHD 520
           E    AH+  I +L ++ +     T S DKT K W+  V  EL+++  +           
Sbjct: 480 EYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDL-VTGELVATLANHKRG------- 531

Query: 521 TTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDS 580
                   +  V     D+ +A    D T+K++ L++     +L GH   V  I     +
Sbjct: 532 --------LWDVSFCQHDKLIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKN 583

Query: 581 KLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW 637
           K +++  AD  +KIW    G+C R+L AH + I  ++       F +   DG+ ++W
Sbjct: 584 KQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALEVADDGDRFVTADADGLFQFW 640

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 74/180 (41%), Gaps = 54/180 (30%)

Query: 325 QVVRSSFKFKSAAWTRCSLSKLELVFTTSNN-TIEYYSIPYKNQKPTQVAASKLYTIELQ 383
           ++V +    K   W        +L+ T S + TI+ +S+   N K T           L+
Sbjct: 520 ELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLENYNIKAT-----------LE 568

Query: 384 GHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXX 442
           GH   V+ I  I+++ +L++  ++G++KIW+ +T  C+RT D                  
Sbjct: 569 GHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLD------------------ 610

Query: 443 XXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKE 502
                                  AHD  IW+L++  DG R +T  AD   +FW    E+E
Sbjct: 611 -----------------------AHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEEE 647

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 70/149 (46%), Gaps = 5/149 (3%)

Query: 514 RLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS 573
           R ++VH    +  ++I ++K++P+  +L     +  ++++ L S K   S+     PV  
Sbjct: 48  RHEIVHKINNDDEQEITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKVSS-PVYV 106

Query: 574 IDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQ--SHNFFSCGKD 631
           +D    S L++    D ++ I+ ++ G    S   H   I +VKF  +    N+     D
Sbjct: 107 MDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLASGD 166

Query: 632 --GVIKYWDGVKFDCIQKLIAHKSEVWAL 658
             GV+K WD VK  C+  +  H + V  L
Sbjct: 167 TNGVVKIWDLVKRRCMHTIQEHTAAVRGL 195

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 7/105 (6%)

Query: 88  TNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF----DPSGTRLISGSRDSNII 143
           + LL  G  DG + I+D++   V   F  H   I+ +KF    D +   L SG  +  + 
Sbjct: 113 STLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLASGDTNGVVK 172

Query: 144 IWDLVGEVGLCKLRSHKDSITGIWF---ENDDWLISTSKDGLIKV 185
           IWDLV    +  ++ H  ++ G+ F   +++  LIS  +D +I +
Sbjct: 173 IWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINL 217

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/124 (20%), Positives = 59/124 (47%), Gaps = 9/124 (7%)

Query: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWF----ENDDW 173
           ++ +  +  D + T L+ G  D ++ I+D+         + H   I+ + F    +  +W
Sbjct: 101 SSPVYVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANW 160

Query: 174 LISTS-KDGLIKVWDIKSQQCVETHMAHTTECWSLAI----SDDLVVTANADSELKIWEL 228
           L+++   +G++K+WD+  ++C+ T   HT     L      S+ L+++   D  + +   
Sbjct: 161 LLASGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINLHHF 220

Query: 229 DLER 232
           D ++
Sbjct: 221 DYKK 224

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 60/141 (42%), Gaps = 25/141 (17%)

Query: 113 IFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVG----LCKLRSHKDSITGIWF 168
           ++  H   +  L     G  + + S+D  +++W    ++G      K   H  S+T +  
Sbjct: 376 MYGGHVDLLNALDASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVAL 435

Query: 169 EN------DDWLISTSKDGLIKVWDI--KSQQCVE-----------THMAHTTECWSLAI 209
            N       ++L+S+S D  +K W +   +Q   E           T  AH  +  +L+I
Sbjct: 436 PNIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSI 495

Query: 210 S--DDLVVTANADSELKIWEL 228
           S  D +  TA+ D   KIW+L
Sbjct: 496 SPNDSIFATASYDKTCKIWDL 516

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score =  114 bits (285), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 116/236 (49%), Gaps = 19/236 (8%)

Query: 483 LITGSADKTVKFWNFQVEKE------LISSSTDKYNSRLQMVHDTTLELGEDILSVKISP 536
           L+T S D T+K WN     +      LI  S  +Y  R    H+      +DI ++ +SP
Sbjct: 488 LLTASNDLTIKKWNIPKPSDKMEGIHLIKGS--EYTRR---AHE------KDINALSVSP 536

Query: 537 EDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWG 596
            D   A +  D T K++ L++ +   +L  HK  +  +      KL+ T S DK IKIW 
Sbjct: 537 NDSVFATASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWS 596

Query: 597 LDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVW 656
           LD     R+L  H +A+    F+ +     S G DG+IK WD    +C++ L  H + +W
Sbjct: 597 LDTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIW 656

Query: 657 ALALSSDGQFFVSVSHDRSIRVWEE-TEDQVFLEEEREKEMDEQYEEKLLSTLEND 711
           AL +  DG+   S   D   + W + +E Q   + EREKE+ EQ E+ L + L N+
Sbjct: 657 ALTIQRDGELIASADADGVFQFWTDCSEQQREQDLEREKELVEQ-EQSLQNYLANE 711

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 107/240 (44%), Gaps = 15/240 (6%)

Query: 7   RFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLE-NINCWDI-KTGNLLKTLSDSI 64
           +F+  + F   +S+   V +P    R  P  ++T+S +  I  W+I K  + ++ +   +
Sbjct: 457 KFKPYAKFIGHSSSVTAVGLPNVMLRHWPEFLLTASNDLTIKKWNIPKPSDKMEGIH--L 514

Query: 65  PPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFL 124
             GS   +     ++  L      ++ A    D   KIWD++T  +     +H   +  +
Sbjct: 515 IKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELTATLANHKRGLWDV 574

Query: 125 KFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGLI 183
            F      L + S D  I IW L     +  L  H +++    F N    L+S+  DGLI
Sbjct: 575 SFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLI 634

Query: 184 KVWDIKSQQCVETHMAHTTECWSLAISDD--LVVTANADSELKIW--------ELDLERE 233
           K+WD  S +CV+T   H    W+L I  D  L+ +A+AD   + W        E DLERE
Sbjct: 635 KIWDCSSGECVKTLDGHANRIWALTIQRDGELIASADADGVFQFWTDCSEQQREQDLERE 694

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 70/177 (39%), Gaps = 16/177 (9%)

Query: 461 ENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHD 520
           E    AH+  I +L ++ +     T S DKT K W+ +  +   + +  K          
Sbjct: 519 EYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELTATLANHK---------- 568

Query: 521 TTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDS 580
                   +  V     D+ LA    D T+K++ LD+     +L GH   V         
Sbjct: 569 ------RGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINKQ 622

Query: 581 KLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW 637
             +++S AD  IKIW    G+C ++L  H + I  +          S   DGV ++W
Sbjct: 623 TQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTIQRDGELIASADADGVFQFW 679

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 51/244 (20%), Positives = 94/244 (38%), Gaps = 67/244 (27%)

Query: 40  TSSLENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGV 99
           TS  + +   ++ TG +++++  S P   +D++               + L+A G  DG 
Sbjct: 108 TSQAQLLKIVEVATGKVMRSMKISSPSYIMDSEAT-------------STLVAVGGTDGS 154

Query: 100 IKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSH 159
           I + D++   V   F  H   I+ LKF         G  +SN+                 
Sbjct: 155 IIVVDIENGYVTHSFKGHGGTISCLKF--------FGEANSNV----------------- 189

Query: 160 KDSITGIWFENDDWLISTS-KDGLIKVWDIKSQQCVETHMAHTTECWSL---AISDDL-- 213
                        WL+++   +G+IKVW++ +++C  T   HT+    +   +ISDD   
Sbjct: 190 -------------WLLASGDTNGMIKVWNLVTRKCTHTVQEHTSAVRGIDIRSISDDTKS 236

Query: 214 ----VVTANADSELKIWELDLERENGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYV 269
               +++   D  +  WELD      +K K K +    + Q+      + +P      Y 
Sbjct: 237 MQLQMISGGRDDVVNYWELD------NKKKCKLLQTIPAHQQVEQCGFIASPGHKNLIYT 290

Query: 270 QNAD 273
              D
Sbjct: 291 SGGD 294

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 86/201 (42%), Gaps = 18/201 (8%)

Query: 319 DIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEYYSIPY-KNQKPTQVAASKL 377
           +I +P   +      K + +TR +  K     + S N   + +  Y K  K   +   +L
Sbjct: 501 NIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGEL 560

Query: 378 YTIELQGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYALC---CKF 433
            T  L  H+  +  +   + +KLLA  S +  +KIW++ T S +RT + G+      C F
Sbjct: 561 -TATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLE-GHTNAVQRCHF 618

Query: 434 LPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVK 493
           +              ++++D +S   ++  +  H   IW+L +  DG  + +  AD   +
Sbjct: 619 INKQTQLVSSGADGLIKIWDCSSGECVKTLD-GHANRIWALTIQRDGELIASADADGVFQ 677

Query: 494 FW----------NFQVEKELI 504
           FW          + + EKEL+
Sbjct: 678 FWTDCSEQQREQDLEREKELV 698

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 62/289 (21%), Positives = 119/289 (41%), Gaps = 33/289 (11%)

Query: 456 SSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRL 515
            SIV ++K+   +  I  +   S G +LI+  +D+++ + + +   +  +     Y S L
Sbjct: 305 GSIVKKSKKPIEELFIIGVLPISQGEKLISVMSDQSLHYLDVESNLKATNEEELTYESAL 364

Query: 516 QMVHDTTLEL---GEDILSVKI---SPEDRFLAVSLLDNTVKVFFLDSMKFFLSLY-GHK 568
              H T  ++   G     + +   SP  R +   L D+TV    L  +   + +Y GH+
Sbjct: 365 AGNHGTIADMVFVGPKFQHLALATNSPTLRIIPTPLDDSTVDTNNL--LPIDVDMYEGHE 422

Query: 569 LPVLSIDISYDSKLIITSSADKNIKIWGLDFGDC----HRSLFAHQDAIM-----NVKFV 619
             + ++D + D   + T+S DK   +W  D        +     H  ++      NV   
Sbjct: 423 DLLNAVDATEDGLWLATASKDKTAIVWRYDDETAKFKPYAKFIGHSSSVTAVGLPNVMLR 482

Query: 620 PQSHNFFSCGKDGVIKYWD----GVKFDCIQKL-------IAHKSEVWALALSSDGQFFV 668
                  +   D  IK W+      K + I  +        AH+ ++ AL++S +   F 
Sbjct: 483 HWPEFLLTASNDLTIKKWNIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFA 542

Query: 669 SVSHDRSIRVW--EETEDQVFLEEEREKEMDEQY--EEKLLSTLENDAS 713
           + S+D++ ++W  E  E    L   +    D  +   +KLL+T   D +
Sbjct: 543 TASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKT 591

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 70/165 (42%), Gaps = 12/165 (7%)

Query: 527 EDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITS 586
           ++I ++K++ + ++L  +     +K+  + + K   S+     P   +D    S L+   
Sbjct: 91  QEITALKLTADGKYLCFTSQAQLLKIVEVATGKVMRSMKISS-PSYIMDSEATSTLVAVG 149

Query: 587 SADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN----FFSCGKDGVIKYWDGVKF 642
             D +I +  ++ G    S   H   I  +KF  ++++      S   +G+IK W+ V  
Sbjct: 150 GTDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASGDTNGMIKVWNLVTR 209

Query: 643 DCIQKLIAHKSEVWAL---ALSSDGQF----FVSVSHDRSIRVWE 680
            C   +  H S V  +   ++S D +      +S   D  +  WE
Sbjct: 210 KCTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWE 254

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 68/165 (41%), Gaps = 23/165 (13%)

Query: 511 YNSRLQMVHDTTLELGEDILSVKISPEDRFL---------AVSLLDNTVKVFFLDSMKFF 561
           + S+ Q++    +  G+ + S+KIS     +         AV   D ++ V  +++    
Sbjct: 107 FTSQAQLLKIVEVATGKVMRSMKISSPSYIMDSEATSTLVAVGGTDGSIIVVDIENGYVT 166

Query: 562 LSLYGH--KLPVLSIDISYDSKLIITSSADKN--IKIWGLDFGDCHRSLFAHQDAIMNVK 617
            S  GH   +  L      +S + + +S D N  IK+W L    C  ++  H  A+  + 
Sbjct: 167 HSFKGHGGTISCLKFFGEANSNVWLLASGDTNGMIKVWNLVTRKCTHTVQEHTSAVRGID 226

Query: 618 FVPQSHN-------FFSCGKDGVIKYWD---GVKFDCIQKLIAHK 652
               S +         S G+D V+ YW+     K   +Q + AH+
Sbjct: 227 IRSISDDTKSMQLQMISGGRDDVVNYWELDNKKKCKLLQTIPAHQ 271

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 99/208 (47%), Gaps = 1/208 (0%)

Query: 483 LITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGE-DILSVKISPEDRFL 541
           LIT S D T+K W      +  S    K  + +  V + T    + DI S+ ISP D  +
Sbjct: 488 LITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDINSISISPNDSLI 547

Query: 542 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGD 601
           A    D + K++ LDS +   +L  HK  +  +      KLI T S DK IK+W LD   
Sbjct: 548 ATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDTFA 607

Query: 602 CHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALS 661
             ++   H +A+    F+ +     S G DG+IK WD    DC++ L  H + +WAL   
Sbjct: 608 VLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALTTW 667

Query: 662 SDGQFFVSVSHDRSIRVWEETEDQVFLE 689
           +DG+  VS   D  ++ W +  +   L+
Sbjct: 668 NDGELIVSADADGVLQFWNDCTELEILQ 695

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/268 (23%), Positives = 117/268 (43%), Gaps = 31/268 (11%)

Query: 459 VLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMV 518
           V E    AHD  I S+ ++ +   + TGS DK+ K WN     EL+++     N+  + +
Sbjct: 523 VSEYTRHAHDKDINSISISPNDSLIATGSYDKSCKLWNLD-SGELVAT----LNNHKRGI 577

Query: 519 HDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISY 578
            D           V     D+ +A    D T+K++ LD+     +  GH   V       
Sbjct: 578 WD-----------VSFCQFDKLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFIN 626

Query: 579 DSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW- 637
             K +++S AD  IKIW    GDC ++L  H + I  +          S   DGV+++W 
Sbjct: 627 KQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGELIVSADADGVLQFWN 686

Query: 638 DGVKFDCIQKL------IAHKSEVWALALSSD--GQFFVSVSHDRSIRVWEETEDQVFLE 689
           D  + + +Q L      + ++  +    L+ D    F ++++ D  +R++   +  +   
Sbjct: 687 DCTELEILQNLENEKEKVENEQSLKNFLLNEDWTNAFLLALTLDHPMRLFNVLKQSLLSL 746

Query: 690 EEREKEMD------EQYEEKLLSTLEND 711
           +E+E+  D       +  +K++  L ND
Sbjct: 747 QEQEEGADGKIIIFNKELDKIIGKLSND 774

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 108/233 (46%), Gaps = 17/233 (7%)

Query: 7   RFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLE-NINCWDIKTGNLLKTLSDS-- 63
           RF   + F   +S+   V +P    R  P  +IT+S +  I  W I T +  ++  +S  
Sbjct: 457 RFFAYAKFIGHSSSVTAVGLPNVLLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKD 516

Query: 64  ---IPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120
              I   S   ++    ++  +      +L+A G  D   K+W++ +  ++   N+H   
Sbjct: 517 KTHIIKVSEYTRHAHDKDINSISISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHKRG 576

Query: 121 I---TFLKFDPSGTRLISG-SRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLI 175
           I   +F +FD    +LI+  S D  I +W L     L     H +++    F N    L+
Sbjct: 577 IWDVSFCQFD----KLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLV 632

Query: 176 STSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDD--LVVTANADSELKIW 226
           S+  DGLIK+WD  +  C++T   H    W+L   +D  L+V+A+AD  L+ W
Sbjct: 633 SSGADGLIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGELIVSADADGVLQFW 685

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 62/140 (44%), Gaps = 13/140 (9%)

Query: 49  WDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQ 108
           W++ +G L+ TL++               +V++ ++     L+A    D  IK+W + T 
Sbjct: 559 WNLDSGELVATLNN---------HKRGIWDVSFCQFDK---LIATCSGDKTIKLWSLDTF 606

Query: 109 TVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWF 168
            VL  F  HT A+    F     +L+S   D  I IWD      L  L  H + I  +  
Sbjct: 607 AVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALTT 666

Query: 169 ENDDWLI-STSKDGLIKVWD 187
            ND  LI S   DG+++ W+
Sbjct: 667 WNDGELIVSADADGVLQFWN 686

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 78/178 (43%), Gaps = 24/178 (13%)

Query: 527 EDILSVKISPEDRFL-AVSLLDNTVKVFFLDSMKFFLSLYGHKL------------PVLS 573
           ++I  +K++P+ +FL +++L    +K++ L +++   ++   +             P   
Sbjct: 64  QEITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTMNTKQQSLQPIKTLKLSSPSYI 123

Query: 574 IDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQ--SHNFFSCGKD 631
           +D    S L+     D +I +  ++ G    S   H   I +VKF     ++ +  C  D
Sbjct: 124 MDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSGD 183

Query: 632 --GVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQ-------FFVSVSHDRSIRVWE 680
             G++K WD VK  CI  L  H S V  L + S  +         +S S D  + +WE
Sbjct: 184 TNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIVNLWE 241

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 51/122 (41%), Gaps = 42/122 (34%)

Query: 384 GHRTDV-RSIDISEDNKLLAAASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXX 442
           GH   V R   I++  +L+++ ++G++KIW+ TT  C++T D                  
Sbjct: 614 GHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLD------------------ 655

Query: 443 XXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKE 502
                                   HD  IW+L   +DG  +++  AD  ++FWN   E E
Sbjct: 656 -----------------------GHDNRIWALTTWNDGELIVSADADGVLQFWNDCTELE 692

Query: 503 LI 504
           ++
Sbjct: 693 IL 694

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 61/128 (47%), Gaps = 14/128 (10%)

Query: 72  KYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF----D 127
           K   P+ +  ++    + L+A G  DG I + D++   +   F  H   I+ +KF    D
Sbjct: 116 KLSSPSYI--MDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNND 173

Query: 128 PSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWF-----ENDD---WLISTSK 179
            +   L SG  +  + IWDLV    +  L+ H  ++ G+       END+    L+S S+
Sbjct: 174 TNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSR 233

Query: 180 DGLIKVWD 187
           D ++ +W+
Sbjct: 234 DNIVNLWE 241

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 62/124 (50%), Gaps = 14/124 (11%)

Query: 123 FLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGI-WFENDD---WLI-ST 177
            +  D + T +  G  D +II+ D+         + H  +I+ + ++ N+D   WL+ S 
Sbjct: 123 IMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSG 182

Query: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSLAI------SDDLV---VTANADSELKIWEL 228
             +G++K+WD+  + C+ T   H +    L +      +D++V   ++ + D+ + +WE 
Sbjct: 183 DTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIVNLWEF 242

Query: 229 DLER 232
           +L +
Sbjct: 243 NLRK 246

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 58/145 (40%), Gaps = 29/145 (20%)

Query: 114 FNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEV----GLCKLRSHKDSITGIWFE 169
           +  HT  +  L     G  L + S+D   I+W    E        K   H  S+T +   
Sbjct: 418 YEGHTDLLNSLAATEDGQWLATASKDHTSILWKYSSETSRFFAYAKFIGHSSSVTAVGLP 477

Query: 170 N------DDWLISTSKDGLIKVWDIKS--------QQCVETHM---------AHTTECWS 206
           N       ++LI+ S D  IK W I +        +   +TH+         AH  +  S
Sbjct: 478 NVLLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDINS 537

Query: 207 LAIS--DDLVVTANADSELKIWELD 229
           ++IS  D L+ T + D   K+W LD
Sbjct: 538 ISISPNDSLIATGSYDKSCKLWNLD 562

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 10/81 (12%)

Query: 85  HHETN--LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF-------DPSGTRLIS 135
           +++TN  LL +G  +G++KIWD+  ++ +     H +A+  L         D    +L+S
Sbjct: 171 NNDTNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLS 230

Query: 136 GSRDSNIIIWDLVGEVGLCKL 156
           GSRD+ + +W+      LCKL
Sbjct: 231 GSRDNIVNLWEF-NLRKLCKL 250

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 48/135 (35%), Gaps = 53/135 (39%)

Query: 379 TIELQGHRTDVRSIDISEDNK-----LLAAASNGMLKIWNITTQSCIRTFDCGYALCCKF 433
           T   +GH   + S+    +N      L +  +NGM+KIW++  +SCI T           
Sbjct: 153 THSFKGHGGTISSVKFYGNNDTNCWLLCSGDTNGMVKIWDLVKRSCIHTLQ--------- 203

Query: 434 LPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGR-------RLITG 486
                                            H++A+  LD+ S  +       +L++G
Sbjct: 204 --------------------------------EHNSAVRGLDVRSVSKENDNVVLQLLSG 231

Query: 487 SADKTVKFWNFQVEK 501
           S D  V  W F + K
Sbjct: 232 SRDNIVNLWEFNLRK 246

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 107/217 (49%), Gaps = 5/217 (2%)

Query: 483 LITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLA 542
           +IT S D T+K W      + + ++       +++   T     +DI ++ ISP D   A
Sbjct: 473 VITASNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIFA 532

Query: 543 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDC 602
            +  D T K++ L+S     +L  HK  +  +      K I+T+S DK IK+W LD    
Sbjct: 533 TASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTV 592

Query: 603 HRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSS 662
            ++   H +A+   +F+ +     SCG DG+IK WD    +CI+ L  H + +WAL++ +
Sbjct: 593 VKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVIN 652

Query: 663 DGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQ 699
           DG   +S   D   + W +        E REK+++++
Sbjct: 653 DGDVIISADADGVFQFWRDCTG-----ENREKDLEKE 684

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 117/251 (46%), Gaps = 16/251 (6%)

Query: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLEN-INCWDIK--TGNLL 57
           ++  YQ + +  F G  AS+   V +P   ++  P  +IT+S ++ I  W +   T NL 
Sbjct: 439 VLEKYQIYAK--FLGH-ASSVTAVGLPNVLTKNYPDYVITASNDSTIKKWKVPKPTKNLD 495

Query: 58  KTLSDSIPPGSID-AKYEKPA---EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLII 113
              +DS  P  +  ++Y + A   ++  L      ++ A    D   KIWD+++  +   
Sbjct: 496 N--NDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKAT 553

Query: 114 FNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD- 172
             +H   +  + F      +++ S D  I +W L     +     H +++    F N   
Sbjct: 554 LVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQK 613

Query: 173 WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI--SDDLVVTANADSELKIWELDL 230
            L+S   DGLIK+WD  S +C++T   H+   W+L++    D++++A+AD   + W  D 
Sbjct: 614 QLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFWR-DC 672

Query: 231 ERENGSKLKEK 241
             EN  K  EK
Sbjct: 673 TGENREKDLEK 683

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 72/177 (40%), Gaps = 16/177 (9%)

Query: 461 ENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHD 520
           E    AHD  I +L ++ +     T S DKT K W+ +        S D        +  
Sbjct: 509 EYTRRAHDKDINALSISPNDSIFATASYDKTCKIWDLE--------SGD--------LKA 552

Query: 521 TTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDS 580
           T +     +  V     D+F+  +  D T+K++ LD+     +  GH   V         
Sbjct: 553 TLVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQ 612

Query: 581 KLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW 637
           K +++  AD  IKIW    G+C ++L  H + I  +  +       S   DGV ++W
Sbjct: 613 KQLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFW 669

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/348 (17%), Positives = 125/348 (35%), Gaps = 116/348 (33%)

Query: 169 ENDDWLISTSKDGLIKVWD----IKSQQCVETHMAHTTECWSLAISD-------DLVVTA 217
           E+  W+ + SKD    +W     ++  Q     + H +   ++ + +       D V+TA
Sbjct: 417 EDSLWIATASKDNSCILWRYNAVLEKYQIYAKFLGHASSVTAVGLPNVLTKNYPDYVITA 476

Query: 218 NADSELKIWEL-----DLERENGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNA 272
           + DS +K W++     +L+  +  K  E  + E   R    D+  ++       F   + 
Sbjct: 477 SNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIFATASY 536

Query: 273 DKTTEVFRIRTXXXXXXXXXXXXXXXXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFK 332
           DKT +++ + +                            +K++ VN              
Sbjct: 537 DKTCKIWDLESG--------------------------DLKATLVN-------------- 556

Query: 333 FKSAAW--TRCSLSKLELVFTTSNNTIEYYSIPYKNQKPTQVAASKLYTI--ELQGHRTD 388
            K   W  + C   K  +V  + + TI+ +S+               +T+    +GH   
Sbjct: 557 HKRGLWDVSFCQYDKF-IVTASGDKTIKMWSL-------------DTFTVVKTFEGHSNA 602

Query: 389 VRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXX 447
           V+    I++  +L++  ++G++KIW+ ++  CI+T D                       
Sbjct: 603 VQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLD----------------------- 639

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFW 495
                              H   IW+L + +DG  +I+  AD   +FW
Sbjct: 640 ------------------GHSNRIWALSVINDGDVIISADADGVFQFW 669

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 58/133 (43%), Gaps = 19/133 (14%)

Query: 72  KYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF----- 126
           K   P+ V  ++    + LLA G  DG + + D++   +   F  H A I+ +KF     
Sbjct: 100 KISSPSYVMSID--QTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDAS 157

Query: 127 --DPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGI-------WFENDD---WL 174
             +  G  L SG     I + D+V    L   + H  +I G+         END+    L
Sbjct: 158 TQNNEGWLLFSGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQL 217

Query: 175 ISTSKDGLIKVWD 187
           +S  +D ++ +W+
Sbjct: 218 LSGGRDDIVNLWE 230

 Score = 39.3 bits (90), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 58/139 (41%), Gaps = 8/139 (5%)

Query: 527 EDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITS 586
           ++I ++++SP+ ++L  +  +  +K++ +   KF  SL     P   + I   S L+   
Sbjct: 62  QEITALQLSPDGKYLCYASTNQLLKIYNIVEKKFVKSLKISS-PSYVMSIDQTSTLLAVG 120

Query: 587 SADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN-------FFSCGKDGVIKYWDG 639
             D ++ +  ++      S   H   I  VKF   +          FS    G+IK  D 
Sbjct: 121 GTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMIKVCDM 180

Query: 640 VKFDCIQKLIAHKSEVWAL 658
           VK  C+     H S +  L
Sbjct: 181 VKRRCLYTFQEHTSAIRGL 199

 Score = 38.9 bits (89), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 58/130 (44%), Gaps = 19/130 (14%)

Query: 124 LKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWF-------ENDDWLI- 175
           +  D + T L  G  D ++ + D+         + H  +I+ + F        N+ WL+ 
Sbjct: 108 MSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLF 167

Query: 176 STSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI--------SDDL---VVTANADSELK 224
           S    G+IKV D+  ++C+ T   HT+    L I        +D+    +++   D  + 
Sbjct: 168 SGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVN 227

Query: 225 IWELDLEREN 234
           +WE +L R++
Sbjct: 228 LWEFNLRRKS 237

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 59/297 (19%), Positives = 113/297 (38%), Gaps = 83/297 (27%)

Query: 318 NDIIQPFQVVRSSFKFKSAAWTRCSLSKL------ELVFTTSNN-TIEYYSIPYKNQ--- 367
           N +++ +Q+  + F   +++ T   L  +      + V T SN+ TI+ + +P   +   
Sbjct: 437 NAVLEKYQIY-AKFLGHASSVTAVGLPNVLTKNYPDYVITASNDSTIKKWKVPKPTKNLD 495

Query: 368 -----KPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIR 421
                KP +V   KL     + H  D+ ++ IS ++ + A AS +   KIW         
Sbjct: 496 NNDSFKPHEV---KLSEYTRRAHDKDINALSISPNDSIFATASYDKTCKIW--------- 543

Query: 422 TFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGR 481
                                     +L+  DL +++V       H   +W +      +
Sbjct: 544 --------------------------DLESGDLKATLV------NHKRGLWDVSFCQYDK 571

Query: 482 RLITGSADKTVKFWN---FQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPED 538
            ++T S DKT+K W+   F V K     S      R Q ++                 + 
Sbjct: 572 FIVTASGDKTIKMWSLDTFTVVKTFEGHSNAV--QRCQFIN-----------------KQ 612

Query: 539 RFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIW 595
           + L     D  +K++   S +   +L GH   + ++ +  D  +II++ AD   + W
Sbjct: 613 KQLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFW 669

 Score = 35.4 bits (80), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 79/200 (39%), Gaps = 35/200 (17%)

Query: 456 SSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRL 515
           +S +L+N     +  I +L L+ DG+ L   S ++ +K +N  VEK+ + S         
Sbjct: 49  NSYLLDNVSNDDEQEITALQLSPDGKYLCYASTNQLLKIYNI-VEKKFVKS--------- 98

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 575
                  L++      + I      LAV   D +V V  +++     S  GH   + ++ 
Sbjct: 99  -------LKISSPSYVMSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVK 151

Query: 576 ISYDSK-------LIITSSADKNIKIWGLDFGDCHRSLFAHQDAI--MNVKFVPQSH--- 623
              D+        L+ +      IK+  +    C  +   H  AI  ++++  P SH   
Sbjct: 152 FYSDASTQNNEGWLLFSGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSP-SHVEN 210

Query: 624 -----NFFSCGKDGVIKYWD 638
                   S G+D ++  W+
Sbjct: 211 DEPLLQLLSGGRDDIVNLWE 230

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 60/145 (41%), Gaps = 28/145 (19%)

Query: 113 IFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVG----LCKLRSHKDSITGIWF 168
           ++  HT  +  L        + + S+D++ I+W     +       K   H  S+T +  
Sbjct: 402 MYEGHTDLLNSLDSTEDSLWIATASKDNSCILWRYNAVLEKYQIYAKFLGHASSVTAVGL 461

Query: 169 EN------DDWLISTSKDGLIKVWDI-KSQQCVE---------------THMAHTTECWS 206
            N       D++I+ S D  IK W + K  + ++               T  AH  +  +
Sbjct: 462 PNVLTKNYPDYVITASNDSTIKKWKVPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINA 521

Query: 207 LAIS--DDLVVTANADSELKIWELD 229
           L+IS  D +  TA+ D   KIW+L+
Sbjct: 522 LSISPNDSIFATASYDKTCKIWDLE 546

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 114/218 (52%), Gaps = 12/218 (5%)

Query: 483 LITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGE-DILSVKISPEDRFL 541
           +IT S D T+K W+     +  S+  D +N +   V D T    E DI ++ ISP D   
Sbjct: 466 IITASNDLTIKKWSV---PKPTSNDVDMHNIK---VSDYTRRAHEKDINALSISPNDSVF 519

Query: 542 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGD 601
           A +  D T K++ +DS +   +L  HK  +  +      KL+ T S DK IK+W L+   
Sbjct: 520 ATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMS 579

Query: 602 CHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALS 661
             ++L  H +A+    F+ ++    S G DG+IK WD    +CI+ L AH + +WAL++ 
Sbjct: 580 VVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVL 639

Query: 662 SDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQ 699
           SDG+ FV+   D   + W++       EEE+++ ++ Q
Sbjct: 640 SDGKEFVTADADGVFQFWKDCS-----EEEQKENLENQ 672

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 116/254 (45%), Gaps = 17/254 (6%)

Query: 6   QRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTLSDSIP 65
           ++F+  + F   A     V +P     T P  IIT+S    N   IK  ++ K  S+ + 
Sbjct: 434 EKFKPYARFTGHAGPVTAVGLPNVMRNTWPEFIITAS----NDLTIKKWSVPKPTSNDVD 489

Query: 66  PGSID-AKYEKPA---EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA- 120
             +I  + Y + A   ++  L      ++ A    D   KIW++ +  +     +H    
Sbjct: 490 MHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGL 549

Query: 121 --ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN-DDWLIST 177
             +TF ++D     L + S D  I +W L     +  L  H +++    F N +  ++ST
Sbjct: 550 WDVTFCQYDK---LLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVST 606

Query: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDL--VVTANADSELKIWELDLERENG 235
             DGLIKVWD+ + +C+ T  AH+   W+L++  D    VTA+AD   + W+   E E  
Sbjct: 607 GADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWKDCSEEEQK 666

Query: 236 SKLKEKGIYEKQSR 249
             L+ + +  +Q +
Sbjct: 667 ENLENQKLMVEQEQ 680

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 74/172 (43%), Gaps = 16/172 (9%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
           AH+  I +L ++ +     T S DKT K WN    +                +  T    
Sbjct: 502 AHEKDINALSISPNDSVFATASYDKTCKIWNVDSGE----------------LEGTLANH 545

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
              +  V     D+ LA    D T+KV+ L+SM    +L GH   V        +K I++
Sbjct: 546 KRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVS 605

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW 637
           + AD  IK+W L  G+C R+L AH + I  +  +     F +   DGV ++W
Sbjct: 606 TGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFW 657

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/348 (18%), Positives = 123/348 (35%), Gaps = 107/348 (30%)

Query: 169 ENDDWLISTSKDGLIKVWDIKSQ----QCVETHMAHTTECWSLAISD-------DLVVTA 217
           EN +WL + SKD  + +W + +     +       H     ++ + +       + ++TA
Sbjct: 410 ENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGLPNVMRNTWPEFIITA 469

Query: 218 NADSELKIWELDLERENGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTE 277
           + D  +K W +     N   +    + +   R    D+  ++       F   + DKT +
Sbjct: 470 SNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCK 529

Query: 278 VFRIRTXXXXXXXXXXXXXXXXXXGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAA 337
           ++ + +                           +++ +  N               K   
Sbjct: 530 IWNVDSG--------------------------ELEGTLAN--------------HKRGL 549

Query: 338 W--TRCSLSKLELVFTTSNNTIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDV-RSIDI 394
           W  T C   KL L   + + TI+ +S+   +   T           L+GH   V R   I
Sbjct: 550 WDVTFCQYDKL-LATCSGDKTIKVWSLESMSVVKT-----------LEGHTNAVQRCSFI 597

Query: 395 SEDNKLLAAASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDL 454
           + + ++++  ++G++K+W+++T  CIRT D                              
Sbjct: 598 NRNKQIVSTGADGLIKVWDLSTGECIRTLD------------------------------ 627

Query: 455 ASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKE 502
                      AH   IW+L + SDG+  +T  AD   +FW    E+E
Sbjct: 628 -----------AHSNRIWALSVLSDGKEFVTADADGVFQFWKDCSEEE 664

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 64/147 (43%), Gaps = 5/147 (3%)

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 575
           +++H    +  ++I ++K++P   +L        ++++ L S K   S+     PV  +D
Sbjct: 50  RLIHTIENDDEQEITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKVSS-PVYVMD 108

Query: 576 ISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN----FFSCGKD 631
               S L+     D ++ +  ++ G    S   H   I +VKF  +         S    
Sbjct: 109 CDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTS 168

Query: 632 GVIKYWDGVKFDCIQKLIAHKSEVWAL 658
           G++K WD V+ +CI  +  H + V  L
Sbjct: 169 GMVKVWDLVRRNCIHTIQEHAAAVRGL 195

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 51/251 (20%), Positives = 94/251 (37%), Gaps = 59/251 (23%)

Query: 347 ELVFTTSNN-TIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAAS 405
           E + T SN+ TI+ +S+P        +   K+     + H  D+ ++ IS ++ + A AS
Sbjct: 464 EFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATAS 523

Query: 406 -NGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKE 464
            +   KIWN+         D G                                 LE   
Sbjct: 524 YDKTCKIWNV---------DSGE--------------------------------LEGTL 542

Query: 465 AAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLE 524
           A H   +W +      + L T S DKT+K W+   E   +  + + + + +Q    + + 
Sbjct: 543 ANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSL--ESMSVVKTLEGHTNAVQRC--SFIN 598

Query: 525 LGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLII 584
             + I+S               D  +KV+ L + +   +L  H   + ++ +  D K  +
Sbjct: 599 RNKQIVSTGA------------DGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFV 646

Query: 585 TSSADKNIKIW 595
           T+ AD   + W
Sbjct: 647 TADADGVFQFW 657

 Score = 38.9 bits (89), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 57/140 (40%), Gaps = 23/140 (16%)

Query: 113 IFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEV----GLCKLRSHKDSITGIWF 168
           ++  HT  +  L    +G  L + S+D  +I+W L  +        +   H   +T +  
Sbjct: 395 LYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGL 454

Query: 169 EN------DDWLISTSKDGLIKVWDIKSQQCVETHM-----------AHTTECWSLAIS- 210
            N       +++I+ S D  IK W +      +  M           AH  +  +L+IS 
Sbjct: 455 PNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISP 514

Query: 211 -DDLVVTANADSELKIWELD 229
            D +  TA+ D   KIW +D
Sbjct: 515 NDSVFATASYDKTCKIWNVD 534

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 55/124 (44%), Gaps = 12/124 (9%)

Query: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD----W 173
           ++ +  +  D S T +  G  D ++ + D+         + H  +I+ + F  +     W
Sbjct: 101 SSPVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIW 160

Query: 174 -LISTSKDGLIKVWDIKSQQCVETHMAHTTEC----WSLAISDDLV---VTANADSELKI 225
            L S    G++KVWD+  + C+ T   H        + L+ +DD V   +T   D  + +
Sbjct: 161 RLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRLSPADDGVLELLTGGRDDIVNL 220

Query: 226 WELD 229
           ++L+
Sbjct: 221 FQLN 224

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 40/80 (50%), Gaps = 9/80 (11%)

Query: 77  AEVAYLEYHHETN----LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF-----D 127
           A ++ +++H E +     LA+G   G++K+WD+  +  +     H AA+  L F     D
Sbjct: 144 ATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRLSPAD 203

Query: 128 PSGTRLISGSRDSNIIIWDL 147
                L++G RD  + ++ L
Sbjct: 204 DGVLELLTGGRDDIVNLFQL 223

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score =  110 bits (274), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 111/223 (49%), Gaps = 13/223 (5%)

Query: 483 LITGSADKTVKFWNF-QVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFL 541
           +IT S D T+K W   +   E       K +   +  HD      +DI ++ ISP D   
Sbjct: 469 IITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHD------KDINALSISPNDSTF 522

Query: 542 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGD 601
           A +  D T KV+ +DS +   +L  HK  +  +      KL+ T S DK +K+W LD   
Sbjct: 523 ATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLS 582

Query: 602 CHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALS 661
             ++L  H +A+    F+ ++    S G DG+IK WD    +C++ L AH++ +WAL++ 
Sbjct: 583 VVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSVL 642

Query: 662 SDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKL 704
            DG  FV+   D   + W++        EE+EKE  E ++ K+
Sbjct: 643 HDGDEFVTADADGVFQFWKDC------SEEQEKENLENHKRKV 679

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 76/172 (44%), Gaps = 16/172 (9%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
           AHD  I +L ++ +     T S DKT K W+               +  LQ    T    
Sbjct: 505 AHDKDINALSISPNDSTFATASYDKTCKVWDVD-------------SGELQ---GTLANH 548

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
              +  V     D+ LA    D TVKV+ LD++    +L GH   V        +K +++
Sbjct: 549 KRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVS 608

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW 637
           + AD  IK+W L  G+C R+L AH++ I  +  +     F +   DGV ++W
Sbjct: 609 TGADGLIKLWDLSTGECVRTLDAHENRIWALSVLHDGDEFVTADADGVFQFW 660

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 120/286 (41%), Gaps = 19/286 (6%)

Query: 6   QRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTLSDSIP 65
           ++F+  + F   A     V +P       P  IIT+S    N   IK   + K   ++  
Sbjct: 437 EKFKAYAKFTGHAGPVTAVGLPNVMRSAWPEFIITAS----NDLTIKKWTVPKPGHETAE 492

Query: 66  PGSID-AKYEKPA---EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAI 121
           P  +  + Y + A   ++  L      +  A    D   K+WD+ +  +     +H   +
Sbjct: 493 PHVVKVSDYTRRAHDKDINALSISPNDSTFATASYDKTCKVWDVDSGELQGTLANHKRGL 552

Query: 122 TFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLISTSKD 180
             + F      L + S D  + +W L     +  L  H +++    F N +  L+ST  D
Sbjct: 553 WDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGAD 612

Query: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAI--SDDLVVTANADSELKIWE---LDLERENG 235
           GLIK+WD+ + +CV T  AH    W+L++    D  VTA+AD   + W+    + E+EN 
Sbjct: 613 GLIKLWDLSTGECVRTLDAHENRIWALSVLHDGDEFVTADADGVFQFWKDCSEEQEKENL 672

Query: 236 SKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRI 281
              K K + + QS Q  +     TN     F      D    ++R+
Sbjct: 673 ENHKRK-VEQDQSLQNYMSQGDWTN----AFLLAMTLDHPMRLYRV 713

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 63/136 (46%), Gaps = 5/136 (3%)

Query: 527 EDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITS 586
           ++I ++K++P+  +L        ++++ L S +   S+     PV  ID    S L+   
Sbjct: 61  QEITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSS-PVYVIDCDPSSTLVALG 119

Query: 587 SADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN----FFSCGKDGVIKYWDGVKF 642
             D ++ +  ++ G    SL  H   I +VKF  + ++      S   +GV+K WD V+ 
Sbjct: 120 GTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRLGSGDTNGVVKVWDLVRR 179

Query: 643 DCIQKLIAHKSEVWAL 658
            C+  +  H + V  L
Sbjct: 180 SCLHTIQEHAAAVRGL 195

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 10/123 (8%)

Query: 381 ELQG----HRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYALC---CK 432
           ELQG    H+  +  +   + +KLLA  S +  +K+W++ T S ++T + G+      C 
Sbjct: 540 ELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLE-GHTNAVQRCS 598

Query: 433 FLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTV 492
           F+              ++L+DL++   +   +A H+  IW+L +  DG   +T  AD   
Sbjct: 599 FINKNKQLVSTGADGLIKLWDLSTGECVRTLDA-HENRIWALSVLHDGDEFVTADADGVF 657

Query: 493 KFW 495
           +FW
Sbjct: 658 QFW 660

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 57/118 (48%), Gaps = 10/118 (8%)

Query: 88  TNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF----DPSGTRLISGSRDSNII 143
           + L+A G  DG + + D++   V      H A I+ +KF    + +  RL SG  +  + 
Sbjct: 113 STLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRLGSGDTNGVVK 172

Query: 144 IWDLVGEVGLCKLRSHKDSITGIWFENDDW------LISTSKDGLIKVWDIKSQQCVE 195
           +WDLV    L  ++ H  ++ G+ F   D       L+S  +D ++ ++ + S + V+
Sbjct: 173 VWDLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVNLYQLGSTKKVK 230

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 61/152 (40%), Gaps = 23/152 (15%)

Query: 113 IFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEV----GLCKLRSHKDSITGIWF 168
           ++  HT  +  L     G  L + S+D  +I+W    E+       K   H   +T +  
Sbjct: 398 LYEGHTDLLNALDSSEDGKWLATCSKDHTVILWRYSSELEKFKAYAKFTGHAGPVTAVGL 457

Query: 169 EN------DDWLISTSKDGLIKVWDI--KSQQCVETHM---------AHTTECWSLAIS- 210
            N       +++I+ S D  IK W +     +  E H+         AH  +  +L+IS 
Sbjct: 458 PNVMRSAWPEFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISP 517

Query: 211 -DDLVVTANADSELKIWELDLERENGSKLKEK 241
            D    TA+ D   K+W++D     G+    K
Sbjct: 518 NDSTFATASYDKTCKVWDVDSGELQGTLANHK 549

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 96/199 (48%), Gaps = 6/199 (3%)

Query: 483 LITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLA 542
           L+T S D T+K W       ++     K +   +  H+      +DI ++ +SP D   A
Sbjct: 454 LLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHE------KDINALSVSPNDSIFA 507

Query: 543 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDC 602
            +  D T K++ L++ +   +L  HK  +  +      KL+ TSS DK +KIW LD    
Sbjct: 508 TASYDKTCKIWSLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSV 567

Query: 603 HRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSS 662
            ++L  H +A+    F+ +     SCG DG+IK WD    +C+  L  H + +WAL   +
Sbjct: 568 MKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMN 627

Query: 663 DGQFFVSVSHDRSIRVWEE 681
           DG   VS   D   + W++
Sbjct: 628 DGDMIVSADADGVFQFWKD 646

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 75/177 (42%), Gaps = 16/177 (9%)

Query: 65  PPGSIDAKYEKPAEVAYLEYHHETNL-----------LAAGYADGVIKIWDMQTQTVLII 113
           P   +D +  K +E  Y  + HE ++            A    D   KIW ++   +   
Sbjct: 471 PTSIMDVQIIKVSE--YTRHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEAT 528

Query: 114 FNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD- 172
             +H   +  + F      L + S D  + IW L     +  L  H +++    F N   
Sbjct: 529 LANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQK 588

Query: 173 WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISD--DLVVTANADSELKIWE 227
            L+S   DGLIK+WD  S +C+ T   H    W+L   +  D++V+A+AD   + W+
Sbjct: 589 QLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFWK 645

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 72/179 (40%), Gaps = 16/179 (8%)

Query: 459 VLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMV 518
           V E    AH+  I +L ++ +     T S DKT K W+ +             N  L+  
Sbjct: 482 VSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWSLE-------------NGELEA- 527

Query: 519 HDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISY 578
             T       +  V     D+ LA S  D TVK++ LD+     +L GH   V       
Sbjct: 528 --TLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFIN 585

Query: 579 DSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW 637
             K +++  AD  IKIW    G+C  +L  H + +  +  +       S   DGV ++W
Sbjct: 586 KQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFW 644

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 80/175 (45%), Gaps = 11/175 (6%)

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 575
           +++H  + E  ++I +++++P+ ++LA       +K+F L + +   SL     P   +D
Sbjct: 51  KILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISS-PSYILD 109

Query: 576 ISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN----FFSCGKD 631
               S L+     D +I I  ++ G    SL  H   I ++KF  Q  +      S   +
Sbjct: 110 TDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTN 169

Query: 632 GVIKYWDGVKFDCIQKLIAHKSEVWALAL----SSDGQF--FVSVSHDRSIRVWE 680
           G++K WD VK  C+  L  H S V  L +    S DG     +S   D  + VW+
Sbjct: 170 GMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWD 224

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 84/382 (21%), Positives = 157/382 (41%), Gaps = 57/382 (14%)

Query: 380 IELQGHRTDVRSIDISEDN-------KLLAAASNGMLKIWNI-TTQSC--IRTFDCGYAL 429
           + LQ H + VR +DI E         KLL+   + ++ +W+    + C  ++T      +
Sbjct: 184 LTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWDFDMKKKCKLVKTLPVNQQV 243

Query: 430 -CCKFLPXXXXXXXXXXXXE---LQLFDLASSIVLE--NKEAAHDAAIWSLDLTSDGRRL 483
             C FL                  QL DL S  VL+  NK       I  L + +D    
Sbjct: 244 ESCGFLKNHDGKRIIYTAGGDAIFQLIDLESGTVLKRTNKPIEELFIIGVLPIMNDSEMF 303

Query: 484 ITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVK-ISPEDRFLA 542
           +  S D+T++  N +   E++ +  D  N+R  +  +  +     I  ++ + PE   LA
Sbjct: 304 LVMS-DQTLQLINIE---EVLENENDTINARSTIAGNNGI-----IADMRFVGPELNKLA 354

Query: 543 VSLLDNTVKVFFLD-------SMKFFLSLY-GHKLPVLSIDISYDSKLIITSSADKNIKI 594
           ++    ++++  +        S+   + +Y GH+  + S+D + D   I T+S D    +
Sbjct: 355 LATNSPSLRIIPIPDLSGADASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIL 414

Query: 595 WGLDFG----DCHRSLFAHQDAIMNVKF---VPQSHNFF--SCGKDGVIKYWDGVKFDCI 645
           W  +      D +     H  A+  V     +P+ +  F  +   D  IK W   K   I
Sbjct: 415 WKYNERTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKWKVPKPTSI 474

Query: 646 QKLI----------AHKSEVWALALSSDGQFFVSVSHDRSIRVW--EETEDQVFLEEERE 693
             +           AH+ ++ AL++S +   F + S+D++ ++W  E  E +  L   + 
Sbjct: 475 MDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEATLANHKR 534

Query: 694 KEMDEQY--EEKLLSTLENDAS 713
              D  +   +KLL+T   D +
Sbjct: 535 GLWDVSFCQYDKLLATSSGDKT 556

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 6/73 (8%)

Query: 81  YLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF------DPSGTRLI 134
           Y +   ET LLA+G  +G++K+WD+  +  L+    H++A+  L        D S  +L+
Sbjct: 153 YGQLDSETWLLASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLL 212

Query: 135 SGSRDSNIIIWDL 147
           SG RD  + +WD 
Sbjct: 213 SGGRDDIVNVWDF 225

 Score = 35.8 bits (81), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 51/257 (19%), Positives = 89/257 (34%), Gaps = 72/257 (28%)

Query: 347 ELVFTTSNN-TIEYYSIPYKNQKPTQVAASKLYTIE---LQGHRTDVRSIDISEDNKLLA 402
           E + T SN+ TI+ + +P    KPT +   ++  +       H  D+ ++ +S ++ + A
Sbjct: 452 EFLLTASNDLTIKKWKVP----KPTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFA 507

Query: 403 AAS-NGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLE 461
            AS +   KIW++                                             LE
Sbjct: 508 TASYDKTCKIWSLENGE-----------------------------------------LE 526

Query: 462 NKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWN---FQVEKELISSSTDKYNSRLQMV 518
              A H   +W +      + L T S DKTVK W+   F V K L   S           
Sbjct: 527 ATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINK 586

Query: 519 HDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISY 578
               +  G D L                   +K++   S +   +L GH   + +++   
Sbjct: 587 QKQLVSCGADGL-------------------IKIWDCSSGECLNTLDGHNNRLWALNTMN 627

Query: 579 DSKLIITSSADKNIKIW 595
           D  +I+++ AD   + W
Sbjct: 628 DGDMIVSADADGVFQFW 644

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 56/145 (38%), Gaps = 26/145 (17%)

Query: 113 IFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVG----LCKLRSHKDSITGIWF 168
           I+  H   +  L     G  + + S+D+  I+W             K   H  ++T +  
Sbjct: 383 IYEGHEDLLNSLDATEDGLWIATASKDNTAILWKYNERTSKFDIYAKYIGHSSAVTAVGL 442

Query: 169 EN------DDWLISTSKDGLIKVWDIKSQQCVE----------THMAHTTECWSLAIS-- 210
            N       ++L++ S D  IK W +     +           T  AH  +  +L++S  
Sbjct: 443 PNVMPKGYPEFLLTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPN 502

Query: 211 DDLVVTANADSELKIWELDLERENG 235
           D +  TA+ D   KIW L    ENG
Sbjct: 503 DSIFATASYDKTCKIWSL----ENG 523

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/232 (31%), Positives = 113/232 (48%), Gaps = 17/232 (7%)

Query: 483 LITGSADKTVKFWNFQV-----EKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPE 537
           +IT S D T+K W          ++LI   T +Y  R    H+      +DI ++ ISP 
Sbjct: 456 IITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRR---AHE------KDINAISISPN 506

Query: 538 DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL 597
           D   A +  D T K++ LD  +F  +L  HK  +  +      KL+ T S DK IKIW L
Sbjct: 507 DSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSL 566

Query: 598 DFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWA 657
           +     ++L  H +A+    F+ ++    S G DG++  WD    + ++ L AH + +WA
Sbjct: 567 ESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWA 626

Query: 658 LALSSDGQFFVSVSHDRSIRVWE---ETEDQVFLEEEREKEMDEQYEEKLLS 706
           LA+ +DG+ FV+   D     W    E E +  LE+E+ K   EQ  +  LS
Sbjct: 627 LAVMNDGESFVTADADGFFEFWRDNSEEEHERNLEQEKLKIEQEQSLQNYLS 678

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 111/249 (44%), Gaps = 17/249 (6%)

Query: 13  FFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTLSDSIPPGSIDAK 72
           F G + S  N V +P    R+ P  IIT+S    N   IK   + K  SD  P   I  K
Sbjct: 432 FVGHVGS-VNAVGLPNVMPRSWPEFIITAS----NDLTIKKWKVPKVTSDE-PEDLILVK 485

Query: 73  ---YEKPA---EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF 126
              Y + A   ++  +      +L A    D   KIW++          +H   +  + F
Sbjct: 486 TSEYTRRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAF 545

Query: 127 DPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKV 185
                 L + S D  I IW L     +  L  H +++    F N +  LIST  DGL+ +
Sbjct: 546 CQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVII 605

Query: 186 WDIKSQQCVETHMAHTTECWSLAISDD--LVVTANADSELKIWELDLERENGSKLKEK-- 241
           WD+ + + V+T  AH    W+LA+ +D    VTA+AD   + W  + E E+   L+++  
Sbjct: 606 WDLSTGESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFWRDNSEEEHERNLEQEKL 665

Query: 242 GIYEKQSRQ 250
            I ++QS Q
Sbjct: 666 KIEQEQSLQ 674

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 72/177 (40%), Gaps = 16/177 (9%)

Query: 461 ENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHD 520
           E    AH+  I ++ ++ +     T S DKT K WN               +   Q    
Sbjct: 488 EYTRRAHEKDINAISISPNDSLFATASYDKTCKIWNLD-------------DGEFQA--- 531

Query: 521 TTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDS 580
           T       +  V     D+ LA    D T+K++ L+S     +L GH   V        +
Sbjct: 532 TLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKN 591

Query: 581 KLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW 637
           K +I++ AD  + IW L  G+  ++L AH + I  +  +    +F +   DG  ++W
Sbjct: 592 KQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 73/165 (44%), Gaps = 10/165 (6%)

Query: 503 LISSSTDKYN-----SRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDS 557
           L +S  DK N     S  +++H    E  +DI ++ ++P+  +L        ++V+ L  
Sbjct: 32  LATSVVDKINIVSLDSPRRVLHSVDTEDEQDITALHLTPDGSYLCFVSQAQLLRVYSLKQ 91

Query: 558 MKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVK 617
            +   S+     PV  ++    S L+     D ++ +  ++ G    SL  H   I +VK
Sbjct: 92  ERIIRSMKISS-PVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVK 150

Query: 618 FVPQSHN----FFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWAL 658
           F  + ++      S   +G+IK WD VK +C   +  H + V  L
Sbjct: 151 FHGELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGL 195

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 53/115 (46%), Gaps = 10/115 (8%)

Query: 88  TNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGT----RLISGSRDSNII 143
           + LLA G  DG + + D++   V      H A I+ +KF         +L SG  +  I 
Sbjct: 113 STLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIK 172

Query: 144 IWDLVGEVGLCKLRSHKDSITGIWFENDD------WLISTSKDGLIKVWDIKSQQ 192
           +WDLV     C ++ H  ++ G+ F   D       L+S  +D ++ +++  S +
Sbjct: 173 VWDLVKRNCQCTIQEHTTAVRGLDFRVTDEEKGTLQLLSGGRDNILNLFEFNSTK 227

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 382 LQGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYALC---CKFLPXX 437
           L  H+  +  +   + +KLLA  S +  +KIW++ + + ++T + G+      C F+   
Sbjct: 533 LANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLE-GHTNAVQRCSFINKN 591

Query: 438 XXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNF 497
                      + ++DL++   ++  +A H+  IW+L + +DG   +T  AD   +FW  
Sbjct: 592 KQLISTGADGLVIIWDLSTGESVKTLDA-HNNRIWALAVMNDGESFVTADADGFFEFWRD 650

Query: 498 QVEKE 502
             E+E
Sbjct: 651 NSEEE 655

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 9/73 (12%)

Query: 77  AEVAYLEYHHETNL----LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF----DP 128
           A ++ +++H E N     LA+G  +G+IK+WD+  +        HT A+  L F    + 
Sbjct: 144 ATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEE 203

Query: 129 SGT-RLISGSRDS 140
            GT +L+SG RD+
Sbjct: 204 KGTLQLLSGGRDN 216

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFE----NDDW 173
           ++ +  +  D + T L  G  D ++ + D+        L+ H  +I+ + F     ++ W
Sbjct: 101 SSPVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIW 160

Query: 174 -LISTSKDGLIKVWDIKSQQCVETHMAHTTECWSL 207
            L S   +G+IKVWD+  + C  T   HTT    L
Sbjct: 161 KLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGL 195

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 56/144 (38%), Gaps = 30/144 (20%)

Query: 113 IFNSHTAAITFLKFDPSGTRLISGSRDSNIIIW-------------DLVGEVGLCKLRSH 159
           ++  HT  +  L     G  + + S+D ++I+W               VG VG       
Sbjct: 385 MYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAVGL 444

Query: 160 KDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE------------THMAHTTECWSL 207
            + +   W E   ++I+ S D  IK W +      E            T  AH  +  ++
Sbjct: 445 PNVMPRSWPE---FIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAI 501

Query: 208 AIS--DDLVVTANADSELKIWELD 229
           +IS  D L  TA+ D   KIW LD
Sbjct: 502 SISPNDSLFATASYDKTCKIWNLD 525

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 76/174 (43%), Gaps = 27/174 (15%)

Query: 566 GHKLPVLSIDISYDSKLIITSSADKNIKIWGL-----DFGDCHRSLFAHQDAIMNVKF-- 618
           GH   + S+D + D   + T+S D ++ +W       DF   +     H  ++  V    
Sbjct: 388 GHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYP-YTKFVGHVGSVNAVGLPN 446

Query: 619 -VPQSHNFF--SCGKDGVIKYW--DGVKFDCIQKLI----------AHKSEVWALALSSD 663
            +P+S   F  +   D  IK W    V  D  + LI          AH+ ++ A+++S +
Sbjct: 447 VMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPN 506

Query: 664 GQFFVSVSHDRSIRVW--EETEDQVFLEEEREKEMDEQY--EEKLLSTLENDAS 713
              F + S+D++ ++W  ++ E Q  L   +    D  +   +KLL+T   D +
Sbjct: 507 DSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKT 560

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 37/189 (19%), Positives = 77/189 (40%), Gaps = 26/189 (13%)

Query: 459 VLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMV 518
           VL + +   +  I +L LT DG  L   S  + ++ ++ + E+ + S             
Sbjct: 51  VLHSVDTEDEQDITALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRS------------- 97

Query: 519 HDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDI-- 576
               +++   +  +        LA+   D +V V  +++     SL GH   + S+    
Sbjct: 98  ----MKISSPVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHG 153

Query: 577 SYDSKLIITSSADKN--IKIWGLDFGDCHRSLFAHQDAIMNVKFV-----PQSHNFFSCG 629
             +S++   +S D N  IK+W L   +C  ++  H  A+  + F        +    S G
Sbjct: 154 ELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEEKGTLQLLSGG 213

Query: 630 KDGVIKYWD 638
           +D ++  ++
Sbjct: 214 RDNILNLFE 222

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 106/225 (47%), Gaps = 20/225 (8%)

Query: 483 LITGSADKTVKFWNFQV------EKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISP 536
           L+T S D T+K W          E E       +Y  R    H+      +DI ++ ISP
Sbjct: 423 LLTASNDLTIKKWKIPKPSAGDEEVEFHDVKISEYTRR---AHE------KDINALSISP 473

Query: 537 EDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWG 596
            D   A +  D T K++ L++ +   +L  HK  +  +      K+I T S DK IKIW 
Sbjct: 474 NDSIFATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWS 533

Query: 597 LDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVW 656
           LD     ++L  H +A+    F+ + +   S G DG+IK WD    +CI  L  H + +W
Sbjct: 534 LDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIW 593

Query: 657 ALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYE 701
           AL + +DG   VS   D   + W +  D     E+RE++M ++ E
Sbjct: 594 ALCVQNDGDLIVSADADGVFQFWRDCTD-----EQREEDMAKEKE 633

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 130/288 (45%), Gaps = 21/288 (7%)

Query: 6   QRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLE-NINCWDI---KTGNLLKTLS 61
           Q+F Q + F   +S+   V +P    ++ P  ++T+S +  I  W I     G+      
Sbjct: 391 QKFTQYARFSGHSSSVTAVGLPNVMPKSYPEYLLTASNDLTIKKWKIPKPSAGDEEVEFH 450

Query: 62  DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA- 120
           D          +EK  ++  L      ++ A    D   KIWD++T   +   ++H    
Sbjct: 451 DVKISEYTRRAHEK--DINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRGL 508

Query: 121 --ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN-DDWLIST 177
             ++F +FD     + + S D  I IW L     +  L  H +++    F N  + L+ST
Sbjct: 509 WDVSFCQFDKI---IATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVST 565

Query: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSLAISD--DLVVTANADSELKIWE--LDLERE 233
             DGLIK+WDI + +C+ T   H    W+L + +  DL+V+A+AD   + W    D +RE
Sbjct: 566 GADGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWRDCTDEQRE 625

Query: 234 NGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRI 281
                +++ I ++QS Q  ++ +  TN     F    + D    +F +
Sbjct: 626 EDMAKEKERIEQEQSLQNYLNERDWTNA----FLLAISLDHPMRLFNV 669

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 77/190 (40%), Gaps = 19/190 (10%)

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
           E++  D+  S   E    AH+  I +L ++ +     T S DKT K W+ +  + + + S
Sbjct: 446 EVEFHDVKIS---EYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLS 502

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGH 567
             K                  +  V     D+ +A    D T+K++ LD+     +L GH
Sbjct: 503 NHK----------------RGLWDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGH 546

Query: 568 KLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFS 627
              V           ++++ AD  IKIW +  G+C  +L  H + I  +          S
Sbjct: 547 TNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVS 606

Query: 628 CGKDGVIKYW 637
              DGV ++W
Sbjct: 607 ADADGVFQFW 616

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 72/163 (44%), Gaps = 10/163 (6%)

Query: 527 EDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITS 586
           ++I ++K++P+ ++L        +K+  + + K   S+     P   ID    S L+   
Sbjct: 30  QEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKIIKSMKVSS-PSYIIDCDKTSTLVTIG 88

Query: 587 SADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQ--SHNFFSCGKD--GVIKYWDGVKF 642
             D ++ +  ++ G    SL  H   I ++KF  +  S+ +  C  D  G++K WD VK 
Sbjct: 89  GTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSGDTNGMVKIWDLVKR 148

Query: 643 DCIQKLIAHKSEVWALAL-----SSDGQFFVSVSHDRSIRVWE 680
            CI  +  H S V  + +      +D    V+   D  +  WE
Sbjct: 149 KCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWE 191

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 92/215 (42%), Gaps = 30/215 (13%)

Query: 38  IITSSLENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYAD 97
           I  S  + +   ++ TG ++K++  S P   ID                 + L+  G  D
Sbjct: 45  IFVSQAQLLKIVNVSTGKIIKSMKVSSPSYIIDCD-------------KTSTLVTIGGTD 91

Query: 98  GVIKIWDMQTQTVLIIFNSHTAAITFLKF----DPSGTRLISGSRDSNIIIWDLVGEVGL 153
           G + + D++   +      H   I+ LKF    + +   L SG  +  + IWDLV    +
Sbjct: 92  GSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSGDTNGMVKIWDLVKRKCI 151

Query: 154 CKLRSHKDSITGIWF---ENDD---WLISTSKDGLIKVWDIK-SQQC--VETHMAHTTEC 204
             ++ H   + G+     END     L++  +D ++  W+    ++C  V+T  AH    
Sbjct: 152 HTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWEFNLKKKCTLVKTIPAHQQIE 211

Query: 205 WSLAISDDLVVTANADSELKIWELDLERENGSKLK 239
            S  I+ D + TA +D+  ++  L    +NG  +K
Sbjct: 212 SSGFINHDFIYTAGSDAVFQVISL----KNGQVIK 242

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 47/115 (40%), Gaps = 42/115 (36%)

Query: 382 LQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXX 440
           L+GH   V+    I++ N+L++  ++G++KIW+I+   CI T D                
Sbjct: 543 LEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLD---------------- 586

Query: 441 XXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFW 495
                                     H+  IW+L + +DG  +++  AD   +FW
Sbjct: 587 -------------------------GHNNRIWALCVQNDGDLIVSADADGVFQFW 616

 Score = 32.3 bits (72), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 97/214 (45%), Gaps = 29/214 (13%)

Query: 500 EKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMK 559
           E ELISS +    +   ++ D T  +G D+  + ++     L +  + NT K    +   
Sbjct: 287 EDELISSKSCIAGNH-GIIADMTF-VGPDLKHLALATNSPTLRLIPVPNTNKSDGNEDES 344

Query: 560 FF---LSLY-GHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFA----HQD 611
           F    + +Y GH+  + +ID + D   I T+S D +  +W  +      + +A    H  
Sbjct: 345 FLPIDVDMYEGHEDLLNAIDSTEDGLWIATASKDHSAIVWKYNTIKQKFTQYARFSGHSS 404

Query: 612 AIMNVKF---VPQSHN--FFSCGKDGVIKYW---------DGVKFDCIQ----KLIAHKS 653
           ++  V     +P+S+     +   D  IK W         + V+F  ++       AH+ 
Sbjct: 405 SVTAVGLPNVMPKSYPEYLLTASNDLTIKKWKIPKPSAGDEEVEFHDVKISEYTRRAHEK 464

Query: 654 EVWALALSSDGQFFVSVSHDRSIRVWE-ETEDQV 686
           ++ AL++S +   F + S+D++ ++W+ ET + V
Sbjct: 465 DINALSISPNDSIFATASYDKTCKIWDLETGESV 498

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 114/234 (48%), Gaps = 20/234 (8%)

Query: 483 LITGSADKTVKFWNF-----QVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPE 537
           LIT S D TVK W       + + E+ S S+ +Y  R    H+      +DI  + ISP 
Sbjct: 471 LITASNDLTVKKWKVPKPTDRFDIEIYSISSSEYTRR---AHE------KDINMLSISPN 521

Query: 538 DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL 597
           D   A +  D T K++ L++ +   +L  HK  +  +      K I T+S DK +KIW L
Sbjct: 522 DSIFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSL 581

Query: 598 DFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWA 657
           D     ++L  H +A+    F  +     S G DG++K WD    +CI  L  H + +WA
Sbjct: 582 DTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWA 641

Query: 658 LALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMD-EQYEEKLLSTLEN 710
           L +  DG   ++   D   + W++       EE RE++++ E+ + + + TLEN
Sbjct: 642 LNVIKDGDIVITADADGVFQFWKDRT-----EEAREEDIEKEKLKVEQMQTLEN 690

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 73/156 (46%), Gaps = 11/156 (7%)

Query: 89  NLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLV 148
           ++ A    D   KIWD++T  +    N+H   +  + F      + + S D  + IW L 
Sbjct: 523 SIFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLD 582

Query: 149 GEVGLCKLRSHKDSITGI-WFENDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSL 207
               +  L  H +++    +F     L+ST  DGL+K+WD  + +C+ T   H    W+L
Sbjct: 583 TFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWAL 642

Query: 208 AI--SDDLVVTANADSELKIW--------ELDLERE 233
            +    D+V+TA+AD   + W        E D+E+E
Sbjct: 643 NVIKDGDIVITADADGVFQFWKDRTEEAREEDIEKE 678

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 81/190 (42%), Gaps = 19/190 (10%)

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
           +++++ ++SS   E    AH+  I  L ++ +     T S DKT K W+ +  +   + +
Sbjct: 493 DIEIYSISSS---EYTRRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGELKATLN 549

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGH 567
             K                  +  V     D+F+A +  D TVK++ LD+     +L GH
Sbjct: 550 NHK----------------RGLWDVSFCQYDKFIATASGDKTVKIWSLDTFTVVKTLEGH 593

Query: 568 KLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFS 627
              V         K ++++ AD  +K+W    G+C  +L  H + I  +  +       +
Sbjct: 594 SNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALNVIKDGDIVIT 653

Query: 628 CGKDGVIKYW 637
              DGV ++W
Sbjct: 654 ADADGVFQFW 663

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 69/151 (45%), Gaps = 25/151 (16%)

Query: 51  IKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTV 110
           + TG ++K++           K   P+ V  LE    + LLA G  DG + + D++   +
Sbjct: 102 LSTGKIVKSM-----------KISSPSYV--LETDPTSTLLAIGGTDGSVTVIDIENGYI 148

Query: 111 LIIFNSHTAAITFLKF---DPSGTRLI-SGSRDSNIIIWDLVGEVGLCKLRSHKDSITGI 166
                 H A I+ LKF     + T L+ SG  +  + IWDLV    +  L+ H  ++ GI
Sbjct: 149 THSLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGI 208

Query: 167 WF--------ENDDWLISTSKDGLIKVWDIK 189
            F        E+   LI+ ++D +I  W+ K
Sbjct: 209 DFKLIEKKNSEDSLQLITGARDDVINHWEFK 239

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 60/124 (48%), Gaps = 6/124 (4%)

Query: 382 LQGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYALC---CKFLPXX 437
           L  H+  +  +   + +K +A AS +  +KIW++ T + ++T + G++     C F    
Sbjct: 548 LNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDTFTVVKTLE-GHSNAVQRCSFFNKQ 606

Query: 438 XXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNF 497
                      ++L+D ++   + N    HD  IW+L++  DG  +IT  AD   +FW  
Sbjct: 607 KQLVSTGADGLVKLWDCSTGECI-NTLDGHDNRIWALNVIKDGDIVITADADGVFQFWKD 665

Query: 498 QVEK 501
           + E+
Sbjct: 666 RTEE 669

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 78/182 (42%), Gaps = 13/182 (7%)

Query: 510 KYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 569
           K+N+  Q++H    +  ++I ++ ++P+ ++L        +K+F L + K   S+     
Sbjct: 58  KHNAS-QILHKIENDDEQEITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISS- 115

Query: 570 PVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN---FF 626
           P   ++    S L+     D ++ +  ++ G    SL  H   I ++KF  + H      
Sbjct: 116 PSYVLETDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLL 175

Query: 627 SCG-KDGVIKYWDGVKFDCIQKLIAHKSEVWALAL-------SSDGQFFVSVSHDRSIRV 678
           S G  +G++K WD V    I  L  H S V  +         S D    ++ + D  I  
Sbjct: 176 SSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINH 235

Query: 679 WE 680
           WE
Sbjct: 236 WE 237

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 9/85 (10%)

Query: 81  YLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF-------DPSGTRL 133
           Y E H  T LL++G  +G++KIWD+ ++  +     H +A+  + F            +L
Sbjct: 165 YGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQL 224

Query: 134 ISGSRDSNIIIWDL--VGEVGLCKL 156
           I+G+RD  I  W+   V  +  CKL
Sbjct: 225 ITGARDDVINHWEFKDVTNLKRCKL 249

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 61/141 (43%), Gaps = 24/141 (17%)

Query: 113 IFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGL-CK---LRSHKDSITGIWF 168
           ++  HT  +  +     G  + + S+D++ I+W       L CK    + H  S+T +  
Sbjct: 400 LYEGHTDLLNAVDATEDGLWIATASKDNSAILWRYNPRTTLFCKYAHFQGHVSSVTSVGL 459

Query: 169 EN------DDWLISTSKDGLIKVW-----------DIKSQQCVE-THMAHTTECWSLAIS 210
            N       ++LI+ S D  +K W           +I S    E T  AH  +   L+IS
Sbjct: 460 PNVMNKGWPEYLITASNDLTVKKWKVPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSIS 519

Query: 211 --DDLVVTANADSELKIWELD 229
             D +  TA+ D   KIW+L+
Sbjct: 520 PNDSIFATASYDKTCKIWDLE 540

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 104/222 (46%), Gaps = 7/222 (3%)

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
           + +IT S D TVK W     K  ++       S +   H       +DI ++ ++P D  
Sbjct: 454 KYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHE----KDINAISMAPNDSI 509

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
            A +  D T K++ +D+ +   +L  HK  +  +      K I T S DK +KIW L+  
Sbjct: 510 FATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESF 569

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL 660
              ++L  H +A+    F+ +     S G DG+IK WD    DCI+ L  H + +WAL++
Sbjct: 570 TVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSV 629

Query: 661 SSDGQFFVSVSHDRSIRVWE---ETEDQVFLEEEREKEMDEQ 699
             DG   +S   D   + W+   E E Q  LEE + +   EQ
Sbjct: 630 LEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVRVEQEQ 671

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 116/254 (45%), Gaps = 10/254 (3%)

Query: 3   NSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLE-NINCWDIKTGNLLKTLS 61
           N+ +RF   + F   A++ + V +P    +  P  IIT+S +  +  W+I     +K   
Sbjct: 421 NTSKRFYIYATFVGHAASVSAVCLPNVMEKNYPKYIITASNDLTVKKWEIPP---MKNDL 477

Query: 62  DSIP---PGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHT 118
           + +P     SI  ++    ++  +      ++ A    D   K+W++ T   +    +H 
Sbjct: 478 NEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHK 537

Query: 119 AAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLIST 177
             +  + F  S   + + S D  + IW L     L  L  H +++    F N    L+S 
Sbjct: 538 RGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSA 597

Query: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSLAI--SDDLVVTANADSELKIWELDLERENG 235
             DGLIKVWDI S  C++    H+   W+L++    DL+++A+ADS  + W+   E E  
Sbjct: 598 GADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEIQ 657

Query: 236 SKLKEKGIYEKQSR 249
             L+E  +  +Q +
Sbjct: 658 GALEENKVRVEQEQ 671

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 84/174 (48%), Gaps = 18/174 (10%)

Query: 88  TNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF-DPSGTRL-ISGSRDSNII-- 143
           + L+A G  DG I + D++   +   F  H   I+ LKF    GT + + GS D+N +  
Sbjct: 115 STLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSGDTNGMAK 174

Query: 144 IWDLVGEVGLCKLRSHKDSITGIWF-ENDDW----LISTSKDGLIKVWDI----KSQQCV 194
           +WDLV       ++ H  +I GI F +NDD     LI+  +D ++ +W      KS + V
Sbjct: 175 VWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIKGKSSKLV 234

Query: 195 ETHMAH--TTECWSLAISDD-LVVTANADSELKIWELDLERENGSKLKEKGIYE 245
           +T  AH     C  +  +D+    TA  D+  +I  +DL   +  K  +K I E
Sbjct: 235 KTIPAHLQIEACGFITHNDETFAYTAGGDAVFQI--IDLNESSVVKCTKKPIEE 286

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 6/126 (4%)

Query: 382 LQGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYALC---CKFLPXX 437
           L  H+  +  +   E  K +A  S +  +KIW++ + + ++T + G+      C F+   
Sbjct: 533 LANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLE-GHTNAVQRCSFMNKQ 591

Query: 438 XXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNF 497
                      ++++D+AS   ++N +  H   IW+L +  DG  +I+  AD   +FW  
Sbjct: 592 KQLVSAGADGLIKVWDIASGDCIKNLDG-HSNRIWALSVLEDGDLIISADADSVFQFWKD 650

Query: 498 QVEKEL 503
             E E+
Sbjct: 651 CTEAEI 656

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 104/213 (48%), Gaps = 3/213 (1%)

Query: 483 LITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLA 542
           +IT S D TVK W  +V      S  D     +++   T     +DI ++ I+P D   A
Sbjct: 396 IITSSNDFTVKKW--KVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFA 453

Query: 543 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDC 602
            +  D T K++ LDS +   +L  HK  +  +      K I T+S DK IKIW L+    
Sbjct: 454 TASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKV 513

Query: 603 HRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSS 662
             +L  H +A+    F+ +     S G DG+IK WD    +C++ L  H + +WAL +  
Sbjct: 514 VNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVLR 573

Query: 663 DGQFFVSVSHDRSIRVWEETEDQVFLEEEREKE 695
           DG   ++   D   + W++  ++V  E++ EKE
Sbjct: 574 DGDMIITADADGVFQFWKDCTEEV-KEQDLEKE 605

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 110/246 (44%), Gaps = 16/246 (6%)

Query: 3   NSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLE-NINCWDIKTGNLLKTLS 61
           +S  +F++ + F   AS+   V +P   +   P  IITSS +  +  W + +        
Sbjct: 361 DSENKFKKYAQFIGHASSVTSVSLPNVINNGWPEFIITSSNDFTVKKWKVPSPTKKSDND 420

Query: 62  DSIPPGSIDAKYEKPA---EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHT 118
           D +    + ++Y + A   ++  L      ++ A    D   KIWD+ +  ++    +H 
Sbjct: 421 DDMHLIKV-SEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATLANHK 479

Query: 119 AAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLIST 177
             +  + F      + + S D  I IW L     +  L  H +++    F N    ++ST
Sbjct: 480 RGLWDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVST 539

Query: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSLAI--SDDLVVTANADSELKIW--------E 227
             DGLIK+WD  S +C++T   H    W+L +    D+++TA+AD   + W        E
Sbjct: 540 GADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWKDCTEEVKE 599

Query: 228 LDLERE 233
            DLE+E
Sbjct: 600 QDLEKE 605

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 80/190 (42%), Gaps = 20/190 (10%)

Query: 459 VLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMV 518
           V E    AH+  I +L +  +     T S DKT K W+    + + + +  K        
Sbjct: 428 VSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATLANHK-------- 479

Query: 519 HDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISY 578
                     +  V     D+++A +  D T+K++ L++ K   +L GH   V       
Sbjct: 480 --------RGLWDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFIN 531

Query: 579 DSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWD 638
             K I+++ AD  IKIW    G+C ++L  H + I  +  +       +   DGV ++W 
Sbjct: 532 KQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWK 591

Query: 639 GVKFDCIQKL 648
               DC +++
Sbjct: 592 ----DCTEEV 597

 Score = 38.5 bits (88), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 45/115 (39%), Gaps = 42/115 (36%)

Query: 382 LQGHRTDV-RSIDISEDNKLLAAASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXX 440
           L+GH   V R   I++  ++++  ++G++KIW+ ++  C++T D                
Sbjct: 517 LEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLD---------------- 560

Query: 441 XXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFW 495
                                     H   IW+L +  DG  +IT  AD   +FW
Sbjct: 561 -------------------------GHANRIWALCVLRDGDMIITADADGVFQFW 590

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 44/254 (17%), Positives = 98/254 (38%), Gaps = 62/254 (24%)

Query: 347 ELVFTTSNN-TIEYYSIPYKNQKPTQ---VAASKLYTIELQGHRTDVRSIDISEDNKLLA 402
           E + T+SN+ T++ + +P   +K      +   K+     + H  D+ ++ I+ ++ + A
Sbjct: 394 EFIITSSNDFTVKKWKVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFA 453

Query: 403 AAS-NGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLE 461
            AS +   KIW++ +   + T                                       
Sbjct: 454 TASYDKTCKIWDLDSGELMATL-------------------------------------- 475

Query: 462 NKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDT 521
              A H   +W +      + + T S DKT+K W+ +  K  + ++ + + + +Q     
Sbjct: 476 ---ANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFK--VVNTLEGHTNAVQRCS-- 528

Query: 522 TLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSK 581
                       I+ + + ++    D  +K++   S +   +L GH   + ++ +  D  
Sbjct: 529 -----------FINKQKQIVSTG-ADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGD 576

Query: 582 LIITSSADKNIKIW 595
           +IIT+ AD   + W
Sbjct: 577 MIITADADGVFQFW 590

 Score = 35.8 bits (81), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 44/82 (53%), Gaps = 10/82 (12%)

Query: 77  AEVAYLEYHHETN----LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGT- 131
           A ++ L+++ E+     LLA+G  + ++K+WD+  +  +     H++A+  + F  S T 
Sbjct: 90  ATISSLKFYGESEDSVWLLASGDTN-MVKVWDLVKRKCIHTLQEHSSAVRGIDFKQSSTD 148

Query: 132 ----RLISGSRDSNIIIWDLVG 149
                L++G RD+ I  W + G
Sbjct: 149 SDIIHLVTGGRDNIINHWTISG 170

 Score = 35.4 bits (80), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 71/349 (20%), Positives = 139/349 (39%), Gaps = 63/349 (18%)

Query: 382 LQGHRTDVRSIDISEDN------KLLAAASNGMLKIWNITTQS---CIRTFDCGYAL-CC 431
           LQ H + VR ID  + +       L+    + ++  W I+       IRTF     +  C
Sbjct: 130 LQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIINHWTISGLKNFKLIRTFPVHQQVEAC 189

Query: 432 KFLPXXXXXXXXXXXXELQLFDLAS----SIVLENKEAAHDAAIWSLDLTSDGRRLITGS 487
            F+                +F + S    S++ + K+   +  I  +    +  +L    
Sbjct: 190 GFIKSTEDDNCIYTAGGDAVFQILSLSNGSVIKKTKKPTEELFIIGVLPIKNFTKLYLVL 249

Query: 488 ADKTVKFWN----FQVEKELISSSTDKYNSRLQMVHDTTLEL---GEDILSVKI---SPE 537
           +D+T++  +    F+ + E+I+       S +   H T  ++   G ++ S+ +   SP 
Sbjct: 250 SDQTLQLIDLIDTFEEDSEIIT-----IKSSIAGNHGTIADMRLVGPELKSIALATNSPT 304

Query: 538 DRFLAVSLLDNTVKVFFLDSMKFFLSLY-GHKLPVLSIDISYDSKLIITSSADKNIKIWG 596
            R + V   DN       +++   + LY GH+  + S+D + D   I T+S D    +W 
Sbjct: 305 LRIIPVISEDNK------NNIPLGVELYDGHEDLLNSLDATEDGLWIATASKDNTAMLW- 357

Query: 597 LDFGDC------HRSLFAHQDAIMNV-----------KFVPQSHNFFSCGKDGVIKYWDG 639
             F D       +     H  ++ +V           +F+  S N F+  K  V      
Sbjct: 358 -RFNDSENKFKKYAQFIGHASSVTSVSLPNVINNGWPEFIITSSNDFTVKKWKVPSPTKK 416

Query: 640 VKFDCIQKLI--------AHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
              D    LI        AH+ ++ AL+++ +   F + S+D++ ++W+
Sbjct: 417 SDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWD 465

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 156 LRSHKDSITGIWF----ENDDWLISTSKDGLIKVWDIKSQQCVETHMAHTT 202
           L+ H  +I+ + F    E+  WL+++    ++KVWD+  ++C+ T   H++
Sbjct: 85  LKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSS 135

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 35/84 (41%), Gaps = 8/84 (9%)

Query: 604 RSLFAHQDAIMNVKFVPQSHN---FFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWAL-- 658
            SL  H   I ++KF  +S +     + G   ++K WD VK  CI  L  H S V  +  
Sbjct: 83  HSLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDF 142

Query: 659 ---ALSSDGQFFVSVSHDRSIRVW 679
              +  SD    V+   D  I  W
Sbjct: 143 KQSSTDSDIIHLVTGGRDNIINHW 166

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 11/101 (10%)

Query: 563 SLYGHKLPVLSIDI---SYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFV 619
           SL GH   + S+     S DS  ++ S     +K+W L    C  +L  H  A+  + F 
Sbjct: 84  SLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDFK 143

Query: 620 PQSHN-----FFSCGKDGVIKYW--DGVK-FDCIQKLIAHK 652
             S +       + G+D +I +W   G+K F  I+    H+
Sbjct: 144 QSSTDSDIIHLVTGGRDNIINHWTISGLKNFKLIRTFPVHQ 184

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 89/361 (24%), Positives = 157/361 (43%), Gaps = 60/361 (16%)

Query: 347 ELVFTTSNNTIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASN 406
           +L   T++ T+    +  +   P  V   +LY    +GH+  + ++D +ED   LA AS 
Sbjct: 347 KLALATNSPTLRIIPVSMEGGLPIDV---ELY----EGHKDLLNAVDATEDGLWLATASK 399

Query: 407 GMLKI-WNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEA 465
               I W   + S             KF+P                           K  
Sbjct: 400 DSTAILWWYQSNSN------------KFVPYA-------------------------KFE 422

Query: 466 AHDAAIWSLDLTSDGRR-----LITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHD 520
            H +A+ ++ L +   +     ++T S D TVK W   V K +  +S + +  ++  V +
Sbjct: 423 GHSSAVTAVGLPNIMHKGWPEFILTASNDLTVKKW--AVPKPV--ASNESFELQVVKVSE 478

Query: 521 TTLELGE-DILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYD 579
            T    E DI ++ ++P D   A +  D T KV+ L+S +   +L  H+  +  +     
Sbjct: 479 YTRRAHEKDINALSVAPNDSTFATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQY 538

Query: 580 SKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDG 639
            +LI T S DK IKIW LD     ++   H +A+    F+ +     S   DG++K WD 
Sbjct: 539 ERLIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDC 598

Query: 640 VKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQ 699
              +C++ L  H + +WAL ++ DG   VS   D   + W+++ +Q     ER++  ++Q
Sbjct: 599 STGECVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFWKDSTEQ-----ERQQHNEQQ 653

Query: 700 Y 700
           +
Sbjct: 654 H 654

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 91/196 (46%), Gaps = 9/196 (4%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A    D   K+WD+++  V     +H   +  + F      + + S D  I IW L   
Sbjct: 500 FATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTF 559

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             +     H +++    F N    L+S+S DGL+K+WD  + +CV+T   HT   W+L +
Sbjct: 560 AVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWALCV 619

Query: 210 SD--DLVVTANADSELKIWE--LDLERENGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVK 265
           ++  DL+V+A+AD   + W+   + ER+  ++ +   + ++QS Q  +     TN     
Sbjct: 620 AEDGDLIVSADADGVFQFWKDSTEQERQQHNEQQHLKVEQEQSLQNYLSQGDWTNA---- 675

Query: 266 FFYVQNADKTTEVFRI 281
           F      D    +FR+
Sbjct: 676 FLLAITLDHPLRLFRV 691

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 99/504 (19%), Positives = 193/504 (38%), Gaps = 92/504 (18%)

Query: 81  YLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF------DPSGTRLI 134
           Y E + E  LLA+G  +G++KIWD+  +  +     HTAA+  + F      D S   LI
Sbjct: 152 YGEQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLI 211

Query: 135 SGSRDSNIIIW--DLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQ 192
           SG RD  I  W  +L  +  L K       +    F N + + +   D  +++  ++S +
Sbjct: 212 SGGRDDVINYWQFNLKKKCTLLKTLPVSQQVESCGFANSELIYTAGSDAFLQLISLESGK 271

Query: 193 CVETHMAHTTECWSLAISDDL----VVTANADSELKIWELDLERENGSKLKEKGIYEKQS 248
            V+       E +++ +   L    +    +D  L +  L+   E+ S L E   Y   +
Sbjct: 272 AVKRTHKPVEELFTVGVLSILGGSKLYMVISDQTLALINLEEALESESALIEVESYIAGN 331

Query: 249 RQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXX---XXXXXXXXXXXXXXGISE 305
                D+  V  P+  K     N+  T  +  +                         +E
Sbjct: 332 HGTIADMNFV-GPELDKLALATNS-PTLRIIPVSMEGGLPIDVELYEGHKDLLNAVDATE 389

Query: 306 DEIQEKIKSSFVNDIIQPFQ------VVRSSFKFKSAAWTRCSLSKL------ELVFTTS 353
           D +     S     I+  +Q      V  + F+  S+A T   L  +      E + T S
Sbjct: 390 DGLWLATASKDSTAILWWYQSNSNKFVPYAKFEGHSSAVTAVGLPNIMHKGWPEFILTAS 449

Query: 354 NN-TIEYYSIPYKNQKPTQVAASKLYTIEL--------QGHRTDVRSIDISEDNKLLAAA 404
           N+ T++ +++P    KP  VA+++ + +++        + H  D+ ++ ++ ++   A A
Sbjct: 450 NDLTVKKWAVP----KP--VASNESFELQVVKVSEYTRRAHEKDINALSVAPNDSTFATA 503

Query: 405 S-------------------------------------------NGMLKIWNITTQSCIR 421
           S                                           +  +KIW++ T + ++
Sbjct: 504 SYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTFAVVK 563

Query: 422 TFDCGYALC---CKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTS 478
           TF+ G+      C F+              ++++D ++   ++  +  H   IW+L +  
Sbjct: 564 TFE-GHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLD-GHTNRIWALCVAE 621

Query: 479 DGRRLITGSADKTVKFWNFQVEKE 502
           DG  +++  AD   +FW    E+E
Sbjct: 622 DGDLIVSADADGVFQFWKDSTEQE 645

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 68/164 (41%), Gaps = 11/164 (6%)

Query: 527 EDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITS 586
           +DI ++K++ + R+L  +     +K+F L   K   S+     P   +D    S L+   
Sbjct: 61  QDITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISS-PSYVVDSDSTSTLLAIG 119

Query: 587 SADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN----FFSCGKDGVIKYWDGVKF 642
             D +I +  ++ G    SL  H   I +VKF  + +       S   +G++K WD VK 
Sbjct: 120 GTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKR 179

Query: 643 DCIQKLIAHKSEVWALALSSDGQ------FFVSVSHDRSIRVWE 680
            CI  +  H + V  +             F +S   D  I  W+
Sbjct: 180 KCIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQ 223

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 99/214 (46%), Gaps = 29/214 (13%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           +  +D++ G +++++  S P   +D+                + LLA G  DG I + D+
Sbjct: 84  LKIFDLREGKIVRSMKISSPSYVVDSD-------------STSTLLAIGGTDGSITVVDV 130

Query: 106 QTQTVLIIFNSHTAAITFLKF--DPSGTRLISGSRDSN--IIIWDLVGEVGLCKLRSHKD 161
           +   V      H   I+ +KF  + +G   +  S D+N  + IWDLV    +  ++ H  
Sbjct: 131 ENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTA 190

Query: 162 SITGIWF-------ENDDWLISTSKDGLIKVW--DIKSQQCVETHMAHTTECWSLAISD- 211
           ++ GI F       E++ +LIS  +D +I  W  ++K +  +   +  + +  S   ++ 
Sbjct: 191 AVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLKKKCTLLKTLPVSQQVESCGFANS 250

Query: 212 DLVVTANADSELKIWELDLERENGSKLKEKGIYE 245
           +L+ TA +D+ L++  + LE     K   K + E
Sbjct: 251 ELIYTAGSDAFLQL--ISLESGKAVKRTHKPVEE 282

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 97/200 (48%), Gaps = 8/200 (4%)

Query: 483 LITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGE-DILSVKISPEDRFL 541
           L+T S D T+K W        I   T   + ++  V + T    E DI ++ +SP D   
Sbjct: 455 LLTASNDLTIKKWK-------IPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIF 507

Query: 542 AVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGD 601
           A +  D T K++ L++ +   +L  HK  +  +      KL+ T S DK +KIW L+   
Sbjct: 508 ATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFS 567

Query: 602 CHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALS 661
             ++L  H +A+    F+ +     SCG DG+IK WD    +C++ L  H + +WAL   
Sbjct: 568 VMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNTM 627

Query: 662 SDGQFFVSVSHDRSIRVWEE 681
           +DG   VS   D   + W++
Sbjct: 628 NDGDTIVSADADGIFQFWKD 647

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 72/179 (40%), Gaps = 16/179 (8%)

Query: 459 VLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMV 518
           V E    AH+  I +L ++ +     T S DKT K WN +             N  L+  
Sbjct: 483 VSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLE-------------NGELEA- 528

Query: 519 HDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISY 578
             T       +  V     D+ LA    D TVK++ L++     +L GH   V       
Sbjct: 529 --TLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFIN 586

Query: 579 DSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW 637
             K +++  AD  IKIW    G+C ++L  H + +  +  +       S   DG+ ++W
Sbjct: 587 KQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNTMNDGDTIVSADADGIFQFW 645

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 65/142 (45%), Gaps = 3/142 (2%)

Query: 89  NLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLV 148
           ++ A    D   KIW+++   +     +H   +  + F      L + S D  + IW L 
Sbjct: 505 SIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLE 564

Query: 149 GEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSL 207
               +  L  H +++    F N    L+S   DGLIK+WD  S +C++T   H    W+L
Sbjct: 565 TFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWAL 624

Query: 208 AISD--DLVVTANADSELKIWE 227
              +  D +V+A+AD   + W+
Sbjct: 625 NTMNDGDTIVSADADGIFQFWK 646

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 100/228 (43%), Gaps = 38/228 (16%)

Query: 33  TSPGQIIT--SSLENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNL 90
           T  GQ +T  S  + +  + +KTG +++++           K   P+ +  L+    + L
Sbjct: 70  TPDGQYLTYVSQAQLLKIFQLKTGKVVRSM-----------KISSPSYI--LDTDSTSTL 116

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKF----DPSGTRLISGSRDSNIIIWD 146
           LA G  DG I + D++   +      H   I+ LKF    D     L SG  +  + +WD
Sbjct: 117 LAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWD 176

Query: 147 LVGEVGLCKLRSHKDSITGI---WFENDDW-----LISTSKDGLIKVWDI---KSQQCVE 195
           LV    L  L+ H  ++ G+     EN+D      LIS  +D ++  WD    K  + ++
Sbjct: 177 LVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWDFDMKKKCKLIK 236

Query: 196 THMAH--TTECWSLAISDD--LVVTANADSELKIWELDLERENGSKLK 239
           T   +     C  L   D   ++ TA  D+  ++ +L    E+GS LK
Sbjct: 237 TLPVNQQVESCGFLNTRDGKHIIYTAGGDAIFQLIDL----ESGSMLK 280

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 79/176 (44%), Gaps = 12/176 (6%)

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 575
           +++H  + E  ++I +++++P+ ++L        +K+F L + K   S+     P   +D
Sbjct: 51  KILHKISNEDEQEITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISS-PSYILD 109

Query: 576 ISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN----FFSCGKD 631
               S L+     D +I +  ++ G    SL  H   I ++KF  Q  +      S   +
Sbjct: 110 TDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTN 169

Query: 632 GVIKYWDGVKFDCIQKLIAHKSEVWALALS----SDGQF---FVSVSHDRSIRVWE 680
           G++K WD VK  C+  L  H S V  L ++    +DG      +S   D  +  W+
Sbjct: 170 GMVKVWDLVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWD 225

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 88/379 (23%), Positives = 156/379 (41%), Gaps = 54/379 (14%)

Query: 382 LQGHRTDVRSIDISE--DN------KLLAAASNGMLKIWNI-TTQSC--IRTFDCGYAL- 429
           LQ H + VR +DI+E  +N      KL++   + ++  W+    + C  I+T      + 
Sbjct: 186 LQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWDFDMKKKCKLIKTLPVNQQVE 245

Query: 430 CCKFLPXXXXXXXXXXXXE---LQLFDLASSIVLE--NKEAAHDAAIWSLDLTSDGRRLI 484
            C FL                  QL DL S  +L+  NK       I  L + SD +  +
Sbjct: 246 SCGFLNTRDGKHIIYTAGGDAIFQLIDLESGSMLKRTNKPIEELYIIGVLPIMSDSKMFL 305

Query: 485 TGSADKTVKFWNFQV---EKELISSSTDKYNSRLQMVHDTTL---ELGEDILSVKISPED 538
             S D+T++  N +     KE I  +         ++ D      EL +  L+   SP  
Sbjct: 306 VMS-DQTLQLINIEEALESKEEIIQAESSIAGNHGIIADMRFVGPELNKLALATN-SPAL 363

Query: 539 RFLAVSLLDNTVKVFFLDSMKFFLSLY-GHKLPVLSIDISYDSKLIITSSADKNIKIWGL 597
           R + +  L +T     LD     + +Y GH+  + S+D + D   I T+S D +  +W  
Sbjct: 364 RIIPIPDLTSTESSLPLD-----VEIYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKY 418

Query: 598 DFG----DCHRSLFAHQDAIMNVKF---VPQSHNFF--SCGKDGVIKYW--------DGV 640
           +      D +     H  A+  V     +P+ +  F  +   D  IK W        + V
Sbjct: 419 NNDTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKWKIPKPTSTNDV 478

Query: 641 KFDCIQKLI--AHKSEVWALALSSDGQFFVSVSHDRSIRVW--EETEDQVFLEEEREKEM 696
           +   + +    AH+ ++ AL++S +   F + S+D++ ++W  E  E +  L   +    
Sbjct: 479 QIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLW 538

Query: 697 DEQY--EEKLLSTLENDAS 713
           D  +   +KLL+T   D +
Sbjct: 539 DVSFCQYDKLLATCSGDKT 557

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 57/118 (48%), Gaps = 6/118 (5%)

Query: 382 LQGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYALC---CKFLPXX 437
           L  H+  +  +   + +KLLA  S +  +KIW++ T S ++T + G+      C F+   
Sbjct: 530 LANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMKTLE-GHTNAVQRCSFINKQ 588

Query: 438 XXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFW 495
                      ++++D  S   L+  +  H+  +W+L+  +DG  +++  AD   +FW
Sbjct: 589 KQLVSCGADGLIKIWDCYSGECLKTLDG-HNNRLWALNTMNDGDTIVSADADGIFQFW 645

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 57/145 (39%), Gaps = 26/145 (17%)

Query: 113 IFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVG----LCKLRSHKDSITGIWF 168
           I+  H   +  L     G  + + S+D++ I+W    +        K   H  ++T +  
Sbjct: 384 IYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNNDTSKFDIYAKYIGHSSAVTAVGL 443

Query: 169 EN------DDWLISTSKDGLIKVWDIKSQQCVE----------THMAHTTECWSLAIS-- 210
            N       ++L++ S D  IK W I                 T  AH  +  +L++S  
Sbjct: 444 PNVMPKGYPEFLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPN 503

Query: 211 DDLVVTANADSELKIWELDLERENG 235
           D +  TA+ D   KIW L    ENG
Sbjct: 504 DSIFATASYDKTCKIWNL----ENG 524

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 131/312 (41%), Gaps = 40/312 (12%)

Query: 371 QVAASKLYTIELQGHRTDVRSIDISEDNKLLAAA-SNGMLKIWNITTQSCIRTFDCGYAL 429
           Q+A   +          D+ S++ S+D++L AA   +  +K+W++   S I      Y  
Sbjct: 467 QLALPTVCMYTFHNTNRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSY-- 524

Query: 430 CCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSAD 489
                             E++  D A+S ++      H  +++S   + D R L++GS D
Sbjct: 525 ---------------KRKEMETTDPATSTLI-----GHSGSVYSTSFSPDSRFLLSGSED 564

Query: 490 KTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNT 549
           KTV+ W+      L+S     Y      V D           VK SP   + A +  D T
Sbjct: 565 KTVRLWSLDTHTALVS-----YKGHNHPVWD-----------VKFSPLGHYFATASHDQT 608

Query: 550 VKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAH 609
            +++  D +       GH   V ++    +   + T S+DK  ++W +  GD  R  + H
Sbjct: 609 ARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVH 668

Query: 610 QDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAH-KSEVWALALSSDGQFFV 668
              I++    P      +   DG+I  WD      I+++  H K+ V +L L+ +G   +
Sbjct: 669 TAPILSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLL 728

Query: 669 SVSHDRSIRVWE 680
           S   D S+RVW+
Sbjct: 729 SGGADHSVRVWD 740

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 4/142 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A    D   ++W       L IF  H + +  + F P+G  + +GS D    +WD+   
Sbjct: 600 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTG 659

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAH---TTECWS 206
             +     H   I       D  WL + S DGLI +WDI + + ++    H        +
Sbjct: 660 DSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLT 719

Query: 207 LAISDDLVVTANADSELKIWEL 228
           L    +++++  AD  +++W+L
Sbjct: 720 LNKEGNVLLSGGADHSVRVWDL 741

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 62/148 (41%), Gaps = 3/148 (2%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  ++  L +G  D  +++W + T T L+ +  H   +  +KF P G    + S D    
Sbjct: 551 FSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATASHDQTAR 610

Query: 144 IWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTT 202
           +W       L     H   +  + F  N  ++ + S D   ++WDI +   V     HT 
Sbjct: 611 LWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTA 670

Query: 203 ECWSLAISDD--LVVTANADSELKIWEL 228
              S  ++ D   + T + D  + +W++
Sbjct: 671 PILSTVVTPDGRWLCTGSDDGLINLWDI 698

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 57/115 (49%), Gaps = 2/115 (1%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
           ++V  + +H     +  G +D   ++WD+ T   +  F  HTA I      P G  L +G
Sbjct: 628 SDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTG 687

Query: 137 SRDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDIK 189
           S D  I +WD+     + ++R H K+++  +    + + L+S   D  ++VWD+K
Sbjct: 688 SDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/173 (18%), Positives = 66/173 (38%), Gaps = 22/173 (12%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQ-------------------TQTVLIIFNSHT 118
           ++  LE+  ++ L AAG+ D  IK+W +                    T         H+
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHS 543

Query: 119 AAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN-DDWLIST 177
            ++    F P    L+SGS D  + +W L     L   + H   +  + F     +  + 
Sbjct: 544 GSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATA 603

Query: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDD--LVVTANADSELKIWEL 228
           S D   ++W       +     H ++  +++   +   V T ++D   ++W++
Sbjct: 604 SHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDI 656

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 54/141 (38%), Gaps = 22/141 (15%)

Query: 111 LIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG-------------------EV 151
           +  F++    +T L+F        +G +DS I +W L G                   + 
Sbjct: 475 MYTFHNTNRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDP 534

Query: 152 GLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAIS 210
               L  H  S+    F  D  +L+S S+D  +++W + +   + ++  H    W +  S
Sbjct: 535 ATSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFS 594

Query: 211 --DDLVVTANADSELKIWELD 229
                  TA+ D   ++W  D
Sbjct: 595 PLGHYFATASHDQTARLWSCD 615

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 11/64 (17%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           IN WDI TG  +K +           +      V  L  + E N+L +G AD  +++WD+
Sbjct: 693 INLWDIGTGKRIKQM-----------RGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDL 741

Query: 106 QTQT 109
           +  T
Sbjct: 742 KKAT 745

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 83/155 (53%)

Query: 527 EDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITS 586
           +DI ++ +SP D   A +  D T K++ LD+ +   +L  HK  +  ++     KL+ T 
Sbjct: 525 KDINALAVSPNDSVFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATC 584

Query: 587 SADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQ 646
           S DK +KIW LD     ++L  H +A+    F+ ++    S G DG++K WD    +C++
Sbjct: 585 SGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVK 644

Query: 647 KLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEE 681
            L AH + +WAL++  DG   V+   D   + W++
Sbjct: 645 TLDAHNNRIWALSVLKDGDIIVTADADGVFQFWKD 679

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 68/142 (47%), Gaps = 3/142 (2%)

Query: 89  NLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLV 148
           ++ A    D   KIW + T  +     +H   +  + F      L + S D  + IW L 
Sbjct: 537 SVFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLD 596

Query: 149 GEVGLCKLRSHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSL 207
               +  L  H +++    F   +  L+S+  DGL+K+WD  + +CV+T  AH    W+L
Sbjct: 597 TYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWAL 656

Query: 208 AI--SDDLVVTANADSELKIWE 227
           ++    D++VTA+AD   + W+
Sbjct: 657 SVLKDGDIIVTADADGVFQFWK 678

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 73/177 (41%), Gaps = 16/177 (9%)

Query: 461 ENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHD 520
           E    AH+  I +L ++ +     T S DKT K W+    +   + +  K          
Sbjct: 517 EYTRRAHEKDINALAVSPNDSVFATASYDKTCKIWSLDTGELEATLANHK---------- 566

Query: 521 TTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDS 580
                   +  V     D+ LA    D TVK++ LD+     +L GH   V        +
Sbjct: 567 ------RGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKN 620

Query: 581 KLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW 637
           K +++S AD  +K+W    G+C ++L AH + I  +  +       +   DGV ++W
Sbjct: 621 KQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 93/221 (42%), Gaps = 32/221 (14%)

Query: 503 LISSSTDKYN-----SRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDS 557
           L +S  D+ N     S  Q+VH    +  ++I +++I+P+ +FL        ++V+ L S
Sbjct: 52  LATSVLDRINIVQLSSPRQVVHIIENDDEQEITALRITPDGQFLCFVSQAQLLRVYHLPS 111

Query: 558 MKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVK 617
            K   S+     PV  ++    S L+     D ++ I  ++ G    S   H   I +VK
Sbjct: 112 KKIVRSMKVSS-PVYVMECDVTSTLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVK 170

Query: 618 FVPQSHN----FFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHD 673
           F  + ++      S    GV+K WD VK  C+  +  H   V  L               
Sbjct: 171 FHGELNSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGL--------------- 215

Query: 674 RSIRVWEETEDQV-FLEEEREK-----EMDEQYEEKLLSTL 708
              RV +E EDQ+  +   R+      + D + + KLL TL
Sbjct: 216 -DFRVLDEDEDQMQLISGGRDNIINLYQFDSRKKCKLLKTL 255

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 63/139 (45%), Gaps = 10/139 (7%)

Query: 64  IPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITF 123
           +P   I    +  + V  +E    + LLA G  DG + I D++   V   F  H   I+ 
Sbjct: 109 LPSKKIVRSMKVSSPVYVMECDVTSTLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISS 168

Query: 124 LKF----DPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWF------ENDDW 173
           +KF    + +  RL SG     + IWDLV    L  ++ H  ++ G+ F      E+   
Sbjct: 169 VKFHGELNSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQ 228

Query: 174 LISTSKDGLIKVWDIKSQQ 192
           LIS  +D +I ++   S++
Sbjct: 229 LISGGRDNIINLYQFDSRK 247

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 59/118 (50%), Gaps = 6/118 (5%)

Query: 382 LQGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYALC---CKFLPXX 437
           L  H+  +  ++  + +KLLA  S +  +KIW++ T S ++T + G+      C F+   
Sbjct: 562 LANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVMKTLE-GHTNAVQRCSFISKN 620

Query: 438 XXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFW 495
                      ++L+D ++   ++  +A H+  IW+L +  DG  ++T  AD   +FW
Sbjct: 621 KQLVSSGADGLVKLWDCSTGECVKTLDA-HNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 50/251 (19%), Positives = 90/251 (35%), Gaps = 59/251 (23%)

Query: 347 ELVFTTSNN-TIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAAS 405
           E + + SN+ TI+ +++P        V   K      + H  D+ ++ +S ++ + A AS
Sbjct: 484 EFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFATAS 543

Query: 406 -NGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKE 464
            +   KIW++ T                                           LE   
Sbjct: 544 YDKTCKIWSLDTGE-----------------------------------------LEATL 562

Query: 465 AAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLE 524
           A H   +W ++     + L T S DKTVK W           S D Y+     V  T   
Sbjct: 563 ANHKRGLWDVNFCQYDKLLATCSGDKTVKIW-----------SLDTYS-----VMKTLEG 606

Query: 525 LGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLII 584
               +       +++ L  S  D  VK++   + +   +L  H   + ++ +  D  +I+
Sbjct: 607 HTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLKDGDIIV 666

Query: 585 TSSADKNIKIW 595
           T+ AD   + W
Sbjct: 667 TADADGVFQFW 677

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 57/140 (40%), Gaps = 23/140 (16%)

Query: 113 IFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGL----CKLRSHKDSITGIWF 168
           ++  H   +  L     G  L + S+D+ +I+W    +  L     K   H   +T +  
Sbjct: 415 MYEGHEDLLNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVGL 474

Query: 169 EN------DDWLISTSKDGLIKVWDIKSQQCVE-----------THMAHTTECWSLAIS- 210
            N       ++L+S S D  IK W +   +  +           T  AH  +  +LA+S 
Sbjct: 475 PNVMNRPWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSP 534

Query: 211 -DDLVVTANADSELKIWELD 229
            D +  TA+ D   KIW LD
Sbjct: 535 NDSVFATASYDKTCKIWSLD 554

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 61/162 (37%), Gaps = 23/162 (14%)

Query: 91  LAAGYADGVIKIWDMQTQTVLII----FNSHTAAITFLKFDPSGTR-----LISGSRDSN 141
           LA    D  + +W    QT L      F  H   +T +       R     L+S S D  
Sbjct: 435 LATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVGLPNVMNRPWPEFLLSASNDLT 494

Query: 142 IIIW---------DLVGEVGLCKL--RSHKDSITGIWFENDDWLIST-SKDGLIKVWDIK 189
           I  W         D V  V   +   R+H+  I  +    +D + +T S D   K+W + 
Sbjct: 495 IKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFATASYDKTCKIWSLD 554

Query: 190 SQQCVETHMAHTTECWSLAIS--DDLVVTANADSELKIWELD 229
           + +   T   H    W +     D L+ T + D  +KIW LD
Sbjct: 555 TGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLD 596

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 69/172 (40%), Gaps = 24/172 (13%)

Query: 566 GHKLPVLSIDISYDSKLIITSSADKNIKIWGLD----FGDCHRSLFAHQDAIM-----NV 616
           GH+  + S+D + D   + T+S D  + +W  D        +     H   +      NV
Sbjct: 418 GHEDLLNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVGLPNV 477

Query: 617 KFVPQSHNFFSCGKDGVIKYW------DGVKFDCIQKLI-----AHKSEVWALALSSDGQ 665
              P      S   D  IK W      DG     + K       AH+ ++ ALA+S +  
Sbjct: 478 MNRPWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDS 537

Query: 666 FFVSVSHDRSIRVW--EETEDQVFLEEEREKEMDEQY--EEKLLSTLENDAS 713
            F + S+D++ ++W  +  E +  L   +    D  +   +KLL+T   D +
Sbjct: 538 VFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKT 589

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 131/315 (41%), Gaps = 45/315 (14%)

Query: 370 TQVAASKLYTIELQGHRT--DVRSIDISEDNKLLAAA-SNGMLKIWNITTQSCIRTFDCG 426
           T + +  +YT     H T  D+  ++ S+D +L A    +  +KIW++           G
Sbjct: 465 TSLPSVCMYTF----HNTNKDMSCLEFSDDCRLAATGFQDSFIKIWSLD----------G 510

Query: 427 YALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITG 486
            +L    LP             L   D  SS+++      H  A++S   + D + L++G
Sbjct: 511 SSLVTNKLPSYKKEEI------LTTGDETSSLLI-----GHSGAVYSTSFSPDNKFLLSG 559

Query: 487 SADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLL 546
           S DKTV+ W+      L+S     Y      V D           VK SP   + A +  
Sbjct: 560 SEDKTVRLWSMDTHTTLVS-----YKGHNHPVWD-----------VKFSPMGHYFATASH 603

Query: 547 DNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSL 606
           D T +++  D +       GH   V ++    +   + T SADK  ++W +  GD  R  
Sbjct: 604 DQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLF 663

Query: 607 FAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAH-KSEVWALALSSDGQ 665
             H   ++     P      + G+DGVI  WD      ++++  H K+ + + + + +G 
Sbjct: 664 LGHTAPVLTTAVTPDGRWLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGN 723

Query: 666 FFVSVSHDRSIRVWE 680
             +S   D S+RVW+
Sbjct: 724 ILISGGADHSVRVWD 738

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 68/160 (42%), Gaps = 7/160 (4%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +   L +G  D  +++W M T T L+ +  H   +  +KF P G    + S D    
Sbjct: 549 FSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTAR 608

Query: 144 IWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTT 202
           +W       L     H + +  + F  N  ++ + S D   ++WDI +   V   + HT 
Sbjct: 609 LWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTA 668

Query: 203 ECWSLAISDD--LVVTANADSELKIWELDLERENGSKLKE 240
              + A++ D   + T   D  + +W++      G +LK+
Sbjct: 669 PVLTTAVTPDGRWLCTGGEDGVINVWDIG----TGKRLKQ 704

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 71/149 (47%), Gaps = 7/149 (4%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +V  + +H     +  G AD   ++WD+ T   + +F  HTA +      P G  L +G 
Sbjct: 627 DVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGG 686

Query: 138 RDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDIKSQQCVE 195
            D  I +WD+     L ++R H K++I    F  + + LIS   D  ++VWD+K  +   
Sbjct: 687 EDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK--KATP 744

Query: 196 THMAHTTECWSLAISDDLVVTANADSELK 224
              A   + ++  + D   VTA+ + ++K
Sbjct: 745 EPSAEPEQPFAGYVGD---VTASVNQDIK 770

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 62/142 (43%), Gaps = 4/142 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDL-VG 149
            A    D   ++W       L IF  H   +  + F P+G  + +GS D    +WD+  G
Sbjct: 598 FATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTG 657

Query: 150 EVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDI---KSQQCVETHMAHTTECWS 206
           +     L      +T     +  WL +  +DG+I VWDI   K  + +  H  +    +S
Sbjct: 658 DSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFS 717

Query: 207 LAISDDLVVTANADSELKIWEL 228
                +++++  AD  +++W+L
Sbjct: 718 FNKEGNILISGGADHSVRVWDL 739

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/175 (19%), Positives = 68/175 (38%), Gaps = 6/175 (3%)

Query: 359 YYSIPYKNQKPTQVAASKLYTIEL-QGHRTDVRSIDISEDN-KLLAAASNGMLKIWNITT 416
           Y++    +Q     +   +Y + +  GH  DV ++    +   +   +++   ++W+I+T
Sbjct: 597 YFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDIST 656

Query: 417 QSCIRTF--DCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSL 474
              +R F       L     P             + ++D+ +   L+        AI S 
Sbjct: 657 GDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSF 716

Query: 475 DLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDI 529
               +G  LI+G AD +V+ W+ +  K     S +        V D T  + +DI
Sbjct: 717 SFNKEGNILISGGADHSVRVWDLK--KATPEPSAEPEQPFAGYVGDVTASVNQDI 769

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 11/64 (17%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           IN WDI TG  LK +           +      +    ++ E N+L +G AD  +++WD+
Sbjct: 691 INVWDIGTGKRLKQM-----------RGHGKNAIHSFSFNKEGNILISGGADHSVRVWDL 739

Query: 106 QTQT 109
           +  T
Sbjct: 740 KKAT 743

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 123/308 (39%), Gaps = 40/308 (12%)

Query: 377 LYTIELQGHRT--DVRSIDISEDNKLLAAA-SNGMLKIWNITTQSCIRTFDCGYALCCKF 433
           LYT     H T  D+ S+D SED++L A    +  +K+W++   S  +  D         
Sbjct: 512 LYTF----HNTNRDMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDV-------- 559

Query: 434 LPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVK 493
                              D  S          H  A++S   + D + LI+GS DKTV+
Sbjct: 560 --------SSSPSPSATTADKYSKDFTNTTLIGHSGAVYSTSFSPDNKYLISGSEDKTVR 611

Query: 494 FWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVF 553
            W+      L+S     Y      V D           VK SP   + A +  D T +++
Sbjct: 612 LWSLDTNTTLVS-----YKGHNHPVWD-----------VKFSPLGHYFATASHDQTARLW 655

Query: 554 FLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAI 613
             D +       GH   V  +    +   + T S+DK  ++W +  GD  R    H   +
Sbjct: 656 SCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 715

Query: 614 MNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAH-KSEVWALALSSDGQFFVSVSH 672
           ++    P      +  +DG+I  WD      ++ +  H K+ +++L+ S +G   VS   
Sbjct: 716 ISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGA 775

Query: 673 DRSIRVWE 680
           D S+RVW+
Sbjct: 776 DHSVRVWD 783

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 66/142 (46%), Gaps = 4/142 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A    D   ++W       L IF  H + +  + F P+G  + +GS D    +WD+   
Sbjct: 643 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 702

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTEC-WSLA 208
             +     H   +       D  WL + S+DG+I VWDI + + ++    H     +SL+
Sbjct: 703 DSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLS 762

Query: 209 IS--DDLVVTANADSELKIWEL 228
            S   +++V++ AD  +++W+L
Sbjct: 763 YSKEGNVLVSSGADHSVRVWDL 784

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 65/152 (42%), Gaps = 7/152 (4%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
           L +G  D  +++W + T T L+ +  H   +  +KF P G    + S D    +W     
Sbjct: 601 LISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHI 660

Query: 151 VGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             L     H   +  + F  N  ++ + S D   ++WD+ +   V   + HT    S A+
Sbjct: 661 YPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAV 720

Query: 210 SDDL--VVTANADSELKIWELDLERENGSKLK 239
           S D   + T + D  + +W++      G +LK
Sbjct: 721 SPDGRWLSTGSEDGIINVWDIG----TGKRLK 748

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 59/115 (51%), Gaps = 2/115 (1%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
           ++V  + +H     +  G +D   ++WD+ T   + +F  HTA +      P G  L +G
Sbjct: 671 SDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTG 730

Query: 137 SRDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDIK 189
           S D  I +WD+     L  +R H K++I  + +  + + L+S+  D  ++VWD+K
Sbjct: 731 SEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLK 785

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 95/220 (43%), Gaps = 21/220 (9%)

Query: 382 LQGHRTDVRSIDISEDNK-LLAAASNGMLKIWNITTQSCIRTFDCGYALC--CKFLPXXX 438
           L GH   V S   S DNK L++ + +  +++W++ T + + ++          KF P   
Sbjct: 582 LIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGH 641

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQ 498
                      +L+     I      A H + +  +    +G  + TGS+DKT + W+  
Sbjct: 642 YFATASHDQTARLWS-CDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVS 700

Query: 499 VEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSM 558
               +          RL + H         ++S  +SP+ R+L+    D  + V+ + + 
Sbjct: 701 TGDSV----------RLFLGHTAP------VISTAVSPDGRWLSTGSEDGIINVWDIGTG 744

Query: 559 KFFLSLYGH-KLPVLSIDISYDSKLIITSSADKNIKIWGL 597
           K    + GH K  + S+  S +  ++++S AD ++++W L
Sbjct: 745 KRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDL 784

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 67/182 (36%), Gaps = 34/182 (18%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQ----------------------------TQT 109
           ++  L++  ++ L A G+ D  IK+W +                             T T
Sbjct: 521 DMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNT 580

Query: 110 VLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFE 169
            LI    H+ A+    F P    LISGS D  + +W L     L   + H   +  + F 
Sbjct: 581 TLI---GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFS 637

Query: 170 N-DDWLISTSKDGLIKVWDIKSQQCVETHMAHTT--ECWSLAISDDLVVTANADSELKIW 226
               +  + S D   ++W       +     H +  +C S   +   V T ++D   ++W
Sbjct: 638 PLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMW 697

Query: 227 EL 228
           ++
Sbjct: 698 DV 699

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 11/65 (16%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           IN WDI TG  LK +           +      +  L Y  E N+L +  AD  +++WD+
Sbjct: 736 INVWDIGTGKRLKLM-----------RGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDL 784

Query: 106 QTQTV 110
           +  T 
Sbjct: 785 KKATA 789

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 97/216 (44%), Gaps = 17/216 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   ++S+  + D R L++ S DKTV+ W+      L+S     Y      V D     
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVS-----YKGHNHPVWD----- 589

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
                 VK SP   + A    D T +++  D +       GH   V  +    +   ++T
Sbjct: 590 ------VKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLT 643

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S+DK  ++W +  GD  R    H  ++++V   P      +  +DGVI  WD      I
Sbjct: 644 GSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRI 703

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +++  H KS V++L+ + +G   VS   D+S+RVW+
Sbjct: 704 KQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWD 739

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 93/210 (44%), Gaps = 9/210 (4%)

Query: 474 LDLTSDGRRLITGSADKTVKFWNF---QVEKELISSSTDKYNSRLQMVHDTTLELGEDIL 530
           L  + D R +  G  D  +K W+     +E +L S + D  N+   + H         + 
Sbjct: 493 LRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGP------VY 546

Query: 531 SVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADK 590
           SV  SP++R+L  +  D TV+++ LD+    +S  GH  PV  +  S       T S D+
Sbjct: 547 SVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQ 606

Query: 591 NIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIA 650
             ++W  D     R    H + +  V F P      +   D   + WD    D ++  + 
Sbjct: 607 TARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLG 666

Query: 651 HKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           H + V ++A+S DG++  + S D  I VW+
Sbjct: 667 HTASVVSVAVSPDGRWLTTGSEDGVIIVWD 696

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/285 (22%), Positives = 114/285 (40%), Gaps = 66/285 (23%)

Query: 363 PYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIR 421
           P ++Q P++ A     T+ L GH   V S+  S DN+ L +AS +  +++W++ T +C+ 
Sbjct: 520 PLESQLPSK-AKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV 578

Query: 422 TFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGR 481
           ++                                           H+  +W +  +  G 
Sbjct: 579 SYK-----------------------------------------GHNHPVWDVKFSPLGH 597

Query: 482 RLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFL 541
              TGS D+T + W          S    Y  R+   H        D+  V   P   ++
Sbjct: 598 YFATGSHDQTARLW----------SCDHIYPLRIFAGHL------NDVDCVTFHPNGTYV 641

Query: 542 AVSLLDNTVKVFFL---DSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLD 598
                D T +++ +   DS++ FL   GH   V+S+ +S D + + T S D  I +W + 
Sbjct: 642 LTGSSDKTCRMWDIQTGDSVRLFL---GHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIG 698

Query: 599 FGDCHRSLFAH-QDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKF 642
            G   + +  H + A+ ++ F  + +   S G D  ++ WD  KF
Sbjct: 699 TGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKKF 743

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 70/142 (49%), Gaps = 4/142 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A G  D   ++W       L IF  H   +  + F P+GT +++GS D    +WD+   
Sbjct: 599 FATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTG 658

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHT-TECWSLA 208
             +     H  S+  +    D  WL + S+DG+I VWDI + + ++    H  +  +SL+
Sbjct: 659 DSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLS 718

Query: 209 IS--DDLVVTANADSELKIWEL 228
            +   +++V+  AD  +++W+L
Sbjct: 719 FNKEGNILVSGGADQSVRVWDL 740

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 61/114 (53%), Gaps = 2/114 (1%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +V  + +H     +  G +D   ++WD+QT   + +F  HTA++  +   P G  L +GS
Sbjct: 628 DVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGS 687

Query: 138 RDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDIK 189
            D  II+WD+     + ++R H K ++  + F  + + L+S   D  ++VWD+K
Sbjct: 688 EDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 74/167 (44%), Gaps = 7/167 (4%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
             V  + +  +   L +   D  +++W + T T L+ +  H   +  +KF P G    +G
Sbjct: 543 GPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATG 602

Query: 137 SRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVE 195
           S D    +W       L     H + +  + F  N  ++++ S D   ++WDI++   V 
Sbjct: 603 SHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVR 662

Query: 196 THMAHTTECWSLAISDDL--VVTANADSELKIWELDLERENGSKLKE 240
             + HT    S+A+S D   + T + D  + +W++      G ++K+
Sbjct: 663 LFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIG----TGKRIKQ 705

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 13/73 (17%)

Query: 36  GQIITSSLEN--INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAA 93
           G+ +T+  E+  I  WDI TG  +K +           +    + V  L ++ E N+L +
Sbjct: 680 GRWLTTGSEDGVIIVWDIGTGKRIKQM-----------RGHGKSAVYSLSFNKEGNILVS 728

Query: 94  GYADGVIKIWDMQ 106
           G AD  +++WD++
Sbjct: 729 GGADQSVRVWDLK 741

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/318 (25%), Positives = 131/318 (41%), Gaps = 41/318 (12%)

Query: 369 PTQVAASKLYTIELQGHRT--DVRSIDISEDNKLLAAA-SNGMLKIWNITTQSCIRTFDC 425
           P  + +  +YT     H T  D+ S++ S+D +L +    +  +KIW++           
Sbjct: 440 PNSLPSVCMYTF----HNTNQDMTSLEFSDDCRLASTGFQDSYIKIWSLD---------- 485

Query: 426 GYALCCKFLPXXXXXXXXX-XXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLI 484
           G +L  KF                L   D   S  L      H   ++S   + D R LI
Sbjct: 486 GTSLNTKFTQANKDRNRITITDRSLTHMDNELSATL----IGHSGTVYSTSFSPDNRYLI 541

Query: 485 TGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVS 544
           +GS DKTV+ W+      L+S     Y      + D           V+ SP   + A +
Sbjct: 542 SGSEDKTVRLWSLDTHTALVS-----YKGHNHPIWD-----------VQFSPLGHYFATA 585

Query: 545 LLDNTVKVFFLDSMKFFLSLY-GHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCH 603
             D T +++  D + F L ++ GH   V  +    +   + T S+DK  ++W +  GD  
Sbjct: 586 SHDQTARLWSCDHI-FPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSV 644

Query: 604 RSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAH-KSEVWALALSS 662
           R    H  A+++    P      +   DG I  WD      ++ L  H K+ V++L  S 
Sbjct: 645 RLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYSK 704

Query: 663 DGQFFVSVSHDRSIRVWE 680
           +G   VS   D+S+RVW+
Sbjct: 705 EGNLLVSSGADQSVRVWD 722

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 97/220 (44%), Gaps = 21/220 (9%)

Query: 382 LQGHRTDVRSIDISEDNK-LLAAASNGMLKIWNITTQSCIRTFDCGYALC--CKFLPXXX 438
           L GH   V S   S DN+ L++ + +  +++W++ T + + ++          +F P   
Sbjct: 521 LIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLGH 580

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQ 498
                      +L+       L    A H   +  +    +G  + TGS+DKT + W+  
Sbjct: 581 YFATASHDQTARLWSCDHIFPLR-IFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDIS 639

Query: 499 VEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSM 558
               +          RL + H +       ++S  +SP+ R+L     D T+ V+ + S 
Sbjct: 640 TGDSV----------RLFLGHTSA------VVSTAVSPDGRWLTTGSDDGTINVWDIGSG 683

Query: 559 KFFLSLYGH-KLPVLSIDISYDSKLIITSSADKNIKIWGL 597
           K   SL GH K  V S+  S +  L+++S AD+++++W L
Sbjct: 684 KRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 68/152 (44%), Gaps = 7/152 (4%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
           L +G  D  +++W + T T L+ +  H   I  ++F P G    + S D    +W     
Sbjct: 540 LISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSCDHI 599

Query: 151 VGLCKLRSHKDSITGIWFENDDWLIST-SKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             L     H + +  + F  + + + T S D   ++WDI +   V   + HT+   S A+
Sbjct: 600 FPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAV 659

Query: 210 SDD--LVVTANADSELKIWELDLERENGSKLK 239
           S D   + T + D  + +W++     +G +LK
Sbjct: 660 SPDGRWLTTGSDDGTINVWDIG----SGKRLK 687

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 64/142 (45%), Gaps = 4/142 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A    D   ++W       L IF  H   +  + F P+G  + +GS D    +WD+   
Sbjct: 582 FATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTG 641

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTEC-WSLA 208
             +     H  ++       D  WL + S DG I VWDI S + +++   H     +SL 
Sbjct: 642 DSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSLT 701

Query: 209 IS--DDLVVTANADSELKIWEL 228
            S   +L+V++ AD  +++W+L
Sbjct: 702 YSKEGNLLVSSGADQSVRVWDL 723

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 58/113 (51%), Gaps = 2/113 (1%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +V  + +H     +  G +D   ++WD+ T   + +F  HT+A+      P G  L +GS
Sbjct: 611 DVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGS 670

Query: 138 RDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDI 188
            D  I +WD+     L  LR H K+++  + +  + + L+S+  D  ++VWD+
Sbjct: 671 DDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 11/60 (18%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           IN WDI +G  LK+L           +      V  L Y  E NLL +  AD  +++WD+
Sbjct: 675 INVWDIGSGKRLKSL-----------RGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 99/209 (47%), Gaps = 4/209 (1%)

Query: 473 SLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSV 532
           SLD +SD     TG  D  +K W   +E   I+ +   Y S++  +  T +   + + SV
Sbjct: 710 SLDFSSDYTLAATGFQDSYIKIW--SLEGTSINENEQNY-SQINSIFKTLVGHSDAVYSV 766

Query: 533 KISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDIS-YDSKLIITSSADKN 591
             SP +RFL     D T +++  D+ K  +S  GH+ P+  ++ S   + L  T+S+D  
Sbjct: 767 NFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNT 826

Query: 592 IKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAH 651
            ++W  D     R L  H   +  V F P     F+   D   + WD    D ++  I H
Sbjct: 827 ARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGH 886

Query: 652 KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
            S V A A+S DG++  + + D +I VW+
Sbjct: 887 SSAVTATAVSPDGRWLSTANEDGTITVWD 915

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 95/217 (43%), Gaps = 18/217 (8%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H  A++S++ +   R L++GS DKT + W+    K L+S     Y    + + D     
Sbjct: 758 GHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVS-----YKGHEKPIWD----- 807

Query: 526 GEDILSVKISPE-DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLII 584
                 V  SP  +   A +  DNT +V+  D +     L GH   V  +    + + + 
Sbjct: 808 ------VNFSPTGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVF 861

Query: 585 TSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDC 644
           T S+DK  ++W L  GD  R    H  A+      P      +  +DG I  WD      
Sbjct: 862 TGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKK 921

Query: 645 IQKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           ++ +  H K+ +++L+ +  G   VS   D S+RVW+
Sbjct: 922 LKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWD 958

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 71/144 (49%), Gaps = 4/144 (2%)

Query: 89  NLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLV 148
           NL A   +D   ++W       + I   H + +  + F P+G  + +GS D    +WDL 
Sbjct: 816 NLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLS 875

Query: 149 GEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAH-TTECWS 206
               +     H  ++T      D  WL + ++DG I VWDI S + +++   H     +S
Sbjct: 876 SGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYS 935

Query: 207 LAI--SDDLVVTANADSELKIWEL 228
           L+   + +++V++ AD+ +++W++
Sbjct: 936 LSYNKTGNILVSSGADNSVRVWDI 959

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 60/115 (52%), Gaps = 2/115 (1%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
           ++V  + +H     +  G +D   ++WD+ +   + +F  H++A+T     P G  L + 
Sbjct: 846 SDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTA 905

Query: 137 SRDSNIIIWDLVGEVGLCKLRSH-KDSITGIWF-ENDDWLISTSKDGLIKVWDIK 189
           + D  I +WD+     L  +R H K+SI  + + +  + L+S+  D  ++VWDIK
Sbjct: 906 NEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIK 960

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 74/165 (44%), Gaps = 12/165 (7%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLI-SGSRDSNIIIW--D 146
            L +G  D   ++W   T   L+ +  H   I  + F P+G  L  + S D+   +W  D
Sbjct: 774 FLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNTARVWSCD 833

Query: 147 LVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECW 205
            V  V +  L  H   +  + F  N  ++ + S D   ++WD+ S   V   + H++   
Sbjct: 834 RVYPVRI--LAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVT 891

Query: 206 SLAISDDL--VVTANADSELKIWELDLERENGSKLKEKGIYEKQS 248
           + A+S D   + TAN D  + +W++     +G KLK    + K S
Sbjct: 892 ATAVSPDGRWLSTANEDGTITVWDIG----SGKKLKSMRGHGKNS 932

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 72/183 (39%), Gaps = 17/183 (9%)

Query: 63  SIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM-------------QTQT 109
           S+P  S+         ++ L++  +  L A G+ D  IKIW +             Q  +
Sbjct: 692 SLPSVSMYTYTNTEKNMSSLDFSSDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINS 751

Query: 110 VLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFE 169
           +      H+ A+  + F P    L+SGS D    +W      GL   + H+  I  + F 
Sbjct: 752 IFKTLVGHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFS 811

Query: 170 --NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTT--ECWSLAISDDLVVTANADSELKI 225
              ++   + S D   +VW       V     H +  +C S   +   V T ++D   ++
Sbjct: 812 PTGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRM 871

Query: 226 WEL 228
           W+L
Sbjct: 872 WDL 874

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 68/134 (50%), Gaps = 17/134 (12%)

Query: 465 AAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLE 524
           A H + +  +    +G+ + TGS+DKT + W+         SS D    RL + H +   
Sbjct: 842 AGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDL--------SSGDSV--RLFIGHSSA-- 889

Query: 525 LGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSIDISYDSKLI 583
               + +  +SP+ R+L+ +  D T+ V+ + S K   S+ GH K  + S+  +    ++
Sbjct: 890 ----VTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNIL 945

Query: 584 ITSSADKNIKIWGL 597
           ++S AD ++++W +
Sbjct: 946 VSSGADNSVRVWDI 959

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 130/312 (41%), Gaps = 46/312 (14%)

Query: 371 QVAASKLYTIELQGHRTDVRSIDISEDNKLLAAA-SNGMLKIWNITTQSCIRTFDCGYAL 429
           Q +A  +          D+ S+  SED++L+AA   +  +KIW++           G  L
Sbjct: 457 QTSAPSVCMYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLD----------GTPL 506

Query: 430 CCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSAD 489
             K LP                 + +++  L      H   ++S+  + D R L++ S D
Sbjct: 507 ESK-LPSKSK-------------EASNTTTL----IGHSGPVYSVSFSPDNRYLVSASED 548

Query: 490 KTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNT 549
           KTV+ W+      L+S     Y      V D           VK SP   + A    D T
Sbjct: 549 KTVRLWSLDTFTCLVS-----YKGHNHPVWD-----------VKFSPLGHYFATVSHDQT 592

Query: 550 VKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAH 609
            +++  D +       GH   V  +    +   ++T S+DK  ++W +  GD  R    H
Sbjct: 593 ARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGH 652

Query: 610 QDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAH-KSEVWALALSSDGQFFV 668
             ++++V   P      +  +DGVI  WD      I+++  H KS V +L+ + +G   V
Sbjct: 653 TASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILV 712

Query: 669 SVSHDRSIRVWE 680
           S   D+S+RVW+
Sbjct: 713 SGGADQSVRVWD 724

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 77/160 (48%), Gaps = 17/160 (10%)

Query: 45  NINCWDIK---TGNLLKTLS----------DSIPPGSIDAKYEKPAEVAYLEYHHETNLL 91
           N   WD+K    G+   T+S          D I P  I A +    +V  + +H     +
Sbjct: 569 NHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPLRIFAGHLN--DVDCVAFHPNGTYV 626

Query: 92  AAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEV 151
             G +D   ++WD+QT   + +F  HTA++  +   P G  L +GS D  II+WD+    
Sbjct: 627 LTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGK 686

Query: 152 GLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDIK 189
            + ++R H K ++  + F  + + L+S   D  ++VWD+K
Sbjct: 687 RIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLK 726

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 63/136 (46%), Gaps = 4/136 (2%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D   ++W       L IF  H   +  + F P+GT +++GS D    +WD+     +   
Sbjct: 590 DQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 649

Query: 157 RSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAH---TTECWSLAISDD 212
             H  S+  +    D  WL + S+DG+I VWDI + + ++    H        S     +
Sbjct: 650 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGN 709

Query: 213 LVVTANADSELKIWEL 228
           ++V+  AD  +++W+L
Sbjct: 710 ILVSGGADQSVRVWDL 725

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 68/155 (43%), Gaps = 3/155 (1%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
             V  + +  +   L +   D  +++W + T T L+ +  H   +  +KF P G    + 
Sbjct: 528 GPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATV 587

Query: 137 SRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVE 195
           S D    +W       L     H + +  + F  N  ++++ S D   ++WDI++   V 
Sbjct: 588 SHDQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVR 647

Query: 196 THMAHTTECWSLAISDDL--VVTANADSELKIWEL 228
             + HT    S+A+S D   + T + D  + +W++
Sbjct: 648 LFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDI 682

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/118 (19%), Positives = 50/118 (42%), Gaps = 3/118 (2%)

Query: 384 GHRTDVRSIDISEDNK-LLAAASNGMLKIWNITTQSCIRTF--DCGYALCCKFLPXXXXX 440
           GH  DV  +    +   +L  +S+   ++W+I T   +R F       +     P     
Sbjct: 609 GHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWL 668

Query: 441 XXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQ 498
                   + ++D+ +   ++       +A+ SL    +G  L++G AD++V+ W+ +
Sbjct: 669 TTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLK 726

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 13/73 (17%)

Query: 36  GQIITSSLEN--INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAA 93
           G+ +T+  E+  I  WDI TG  +K +           +    + V  L ++ E N+L +
Sbjct: 665 GRWLTTGSEDGVIIVWDIGTGKRIKQM-----------RGHGKSAVNSLSFNKEGNILVS 713

Query: 94  GYADGVIKIWDMQ 106
           G AD  +++WD++
Sbjct: 714 GGADQSVRVWDLK 726

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 103/245 (42%), Gaps = 18/245 (7%)

Query: 458 IVLENKEAAHDAAIWSLDLT-SDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQ 516
           +VL      H+  + SL  + +    L++GS DKT+  W    E +        +     
Sbjct: 23  LVLRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSH 82

Query: 517 MVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDI 576
           +V D T           ++ + ++   +  D T++++ L S K      GHK  V+S+ I
Sbjct: 83  IVQDCT-----------VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSI 131

Query: 577 SYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN-----FFSCGKD 631
              +  I+++S DK +K+W    GDC  +L  H D + NV+  P   +       S G D
Sbjct: 132 DPRATQIVSASRDKTVKVWNT-VGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMD 190

Query: 632 GVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEE 691
            V+K WD   F      I H + V  +  S DG  F S   D  I +W   E       +
Sbjct: 191 KVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLD 250

Query: 692 REKEM 696
            + E+
Sbjct: 251 AKDEV 255

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 75/152 (49%), Gaps = 9/152 (5%)

Query: 86  HETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIW 145
           H+     +   D  +++WD+Q+   +  F  H + +  +  DP  T+++S SRD  + +W
Sbjct: 91  HDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVW 150

Query: 146 DLVGEVGLCKLRSHKDSITGIWF----ENDDW--LISTSKDGLIKVWDIKSQQCVETHMA 199
           + VG+  +  L  H D ++ +      ++DD   +IS   D ++KVWD++S       + 
Sbjct: 151 NTVGDC-VVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIG 209

Query: 200 HTTECWSLAISDD--LVVTANADSELKIWELD 229
           H     ++  S D  +  +A  D ++ +W L+
Sbjct: 210 HNNYVTTVTPSPDGSIFASAGKDGQIILWNLN 241

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 81/336 (24%), Positives = 131/336 (38%), Gaps = 72/336 (21%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNIT-------------------TQSCI 420
           L+GH   V S+  S  + N LL+ + +  L  W +T                    Q C 
Sbjct: 29  LEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCT 88

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
            T D  YAL   +               L+L+DL S   ++ +   H + + S+ +    
Sbjct: 89  VTHDGKYALSASW------------DKTLRLWDLQSGKCIK-RFVGHKSDVMSVSIDPRA 135

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL-GED--ILSVKISP- 536
            ++++ S DKTVK WN                     V D  + L G +  + +V+I+P 
Sbjct: 136 TQIVSASRDKTVKVWN--------------------TVGDCVVTLLGHNDWVSNVRIAPS 175

Query: 537 ---EDRFLAVSL-LDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNI 592
              +D    +S  +D  VKV+ L S        GH   V ++  S D  +  ++  D  I
Sbjct: 176 EKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQI 235

Query: 593 KIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLI--- 649
            +W L+      +L A +D +  V F P  +   +    G IK +D  +   +  L    
Sbjct: 236 ILWNLNEKTALYTLDA-KDEVFAVAFSPNRYWLTAATASG-IKIFDLEERTIVDDLKPEF 293

Query: 650 -----AHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
                A      +LA S+DGQ   +   D  IRVW+
Sbjct: 294 AGYNKAQDPHAVSLAWSADGQTLFAGYTDNIIRVWQ 329

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 67/134 (50%), Gaps = 12/134 (8%)

Query: 105 MQTQTVLII---FNSHTAAITFLKFDPS-GTRLISGSRDSNIIIWDLVGE-----VGLCK 155
           M T  +L++      H   +T L   P+    L+SGSRD  +I W L GE     V +  
Sbjct: 17  MSTDEILVLRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRS 76

Query: 156 LRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDL- 213
            + H   +      +D  + +S S D  +++WD++S +C++  + H ++  S++I     
Sbjct: 77  FKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRAT 136

Query: 214 -VVTANADSELKIW 226
            +V+A+ D  +K+W
Sbjct: 137 QIVSASRDKTVKVW 150

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 59/108 (54%), Gaps = 4/108 (3%)

Query: 89  NLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLV 148
            +++AG  D V+K+WD+Q+ T+   F  H   +T +   P G+   S  +D  II+W+L 
Sbjct: 183 TVISAGM-DKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLN 241

Query: 149 GEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVE 195
            +  L  L + KD +  + F  N  WL + +  G IK++D++ +  V+
Sbjct: 242 EKTALYTLDA-KDEVFAVAFSPNRYWLTAATASG-IKIFDLEERTIVD 287

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 66/155 (42%), Gaps = 14/155 (9%)

Query: 87  ETNLLAAGYADGVIKIW-----DMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           + N+L +G  D  +  W     D Q    +  F  H+  +        G   +S S D  
Sbjct: 45  QPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKT 104

Query: 142 IIIWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAH 200
           + +WDL     + +   HK  +  +  +     ++S S+D  +KVW+     CV T + H
Sbjct: 105 LRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVG-DCVVTLLGH 163

Query: 201 TTECWSLAI-----SDD--LVVTANADSELKIWEL 228
                ++ I     SDD   V++A  D  +K+W+L
Sbjct: 164 NDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDL 198

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 54/128 (42%), Gaps = 10/128 (7%)

Query: 378 YTIELQ--GHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYALCCKFL 434
           +TIE    GH   V ++  S D  + A+A  +G + +WN+  ++ + T D    +     
Sbjct: 201 FTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLDAKDEVFAVAF 260

Query: 435 PXXXXXXXXXXXXELQLFDLASSIVLENKEA-------AHDAAIWSLDLTSDGRRLITGS 487
                         +++FDL    ++++ +        A D    SL  ++DG+ L  G 
Sbjct: 261 SPNRYWLTAATASGIKIFDLEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTLFAGY 320

Query: 488 ADKTVKFW 495
            D  ++ W
Sbjct: 321 TDNIIRVW 328

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 100/222 (45%), Gaps = 19/222 (8%)

Query: 463 KEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTT 522
           K   H  AI+S   + D + L++ S DKT++ W+      L++     Y      V D  
Sbjct: 548 KLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVT-----YKGHNHPVWD-- 600

Query: 523 LELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLY-GHKLPVLSIDISYDSK 581
                    V+ SP   + A +  D T +++  D + F L ++ GH   V  +    +  
Sbjct: 601 ---------VQFSPVGHYFATASHDQTARLWSCDHI-FPLRIFSGHISDVDCVTFHPNGC 650

Query: 582 LIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVK 641
            I T S+DK  ++W +  G+  R    H   I++V   P      +  +DGVI  WD   
Sbjct: 651 YIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGT 710

Query: 642 FDCIQKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWEET 682
              ++KLI H KS V +L+ + +    VS   D S+R+W+ T
Sbjct: 711 GKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/230 (22%), Positives = 96/230 (41%), Gaps = 20/230 (8%)

Query: 471 IWSLDLTSDGRRLITGSADKTVKFWNF---------------QVEKELISSSTDKYN--S 513
           + SL  ++D R    G  D  +K W+                + +  L +   +K N  +
Sbjct: 478 MLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTLESKATKIQPSKSQAALRAGLDNKINEKT 537

Query: 514 RLQMVHDTTLEL---GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLP 570
           R Q    TT++L      I S   SP+++ L  +  D T++++ +D+    ++  GH  P
Sbjct: 538 RSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHP 597

Query: 571 VLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK 630
           V  +  S       T+S D+  ++W  D     R    H   +  V F P     F+   
Sbjct: 598 VWDVQFSPVGHYFATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSS 657

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           D   + WD    + ++  I H + + ++A++ DG    + S D  I +W+
Sbjct: 658 DKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWD 707

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/274 (20%), Positives = 110/274 (40%), Gaps = 65/274 (23%)

Query: 370 TQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYA 428
           T+   + + T++L GH   + S   S DNKLL +AS +  +++W++ T++ + T+     
Sbjct: 537 TRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVTY----- 591

Query: 429 LCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSA 488
                                                 H+  +W +  +  G    T S 
Sbjct: 592 ------------------------------------KGHNHPVWDVQFSPVGHYFATASH 615

Query: 489 DKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDN 548
           D+T + W          S    +  R+   H +      D+  V   P   ++     D 
Sbjct: 616 DQTARLW----------SCDHIFPLRIFSGHIS------DVDCVTFHPNGCYIFTGSSDK 659

Query: 549 TVKVFFL---DSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRS 605
           T +++ +   +S++ F+   GH  P+LS+ ++ D   + T S D  I IW +  G   + 
Sbjct: 660 TCRMWDITTGESVRLFI---GHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKK 716

Query: 606 LFAH-QDAIMNVKFVPQSHNFFSCGKDGVIKYWD 638
           L  H + A+ ++ +  +S+   S G D  ++ WD
Sbjct: 717 LIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWD 750

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 66/148 (44%), Gaps = 3/148 (2%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +  LL +   D  I++W M T+T L+ +  H   +  ++F P G    + S D    
Sbjct: 561 FSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTAR 620

Query: 144 IWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTT 202
           +W       L     H   +  + F  N  ++ + S D   ++WDI + + V   + HT 
Sbjct: 621 LWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTA 680

Query: 203 ECWSLAISDD--LVVTANADSELKIWEL 228
              S+A++ D   + T + D  + IW++
Sbjct: 681 PILSVAVAPDGLRLATGSEDGVIHIWDI 708

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 58/114 (50%), Gaps = 2/114 (1%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
           ++V  + +H     +  G +D   ++WD+ T   + +F  HTA I  +   P G RL +G
Sbjct: 638 SDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATG 697

Query: 137 SRDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDI 188
           S D  I IWD+     L KL  H K ++  + +  + + L+S   D  +++WD+
Sbjct: 698 SEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 65/142 (45%), Gaps = 4/142 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A    D   ++W       L IF+ H + +  + F P+G  + +GS D    +WD+   
Sbjct: 610 FATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTG 669

Query: 151 VGLCKLRSHKDSITGIWFENDDWLIST-SKDGLIKVWDIKSQQCVETHMAH---TTECWS 206
             +     H   I  +    D   ++T S+DG+I +WDI + + ++  + H        S
Sbjct: 670 ESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLS 729

Query: 207 LAISDDLVVTANADSELKIWEL 228
                +++V+  +D+ ++IW+L
Sbjct: 730 YNKESNILVSGGSDNSVRIWDL 751

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 69/165 (41%), Gaps = 29/165 (17%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG- 136
           E+  L Y ++  L AAG+ D  IK+W +   T+        +  T ++   S   L +G 
Sbjct: 477 EMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTL-------ESKATKIQPSKSQAALRAGL 529

Query: 137 ---------SRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVW 186
                    S+++ I    LVG         H  +I    F  D+  L+S S+D  I++W
Sbjct: 530 DNKINEKTRSQETPITTVKLVG---------HSGAIYSTSFSPDNKLLVSASEDKTIRLW 580

Query: 187 DIKSQQCVETHMAHTTECWSLAIS--DDLVVTANADSELKIWELD 229
            + ++  + T+  H    W +  S       TA+ D   ++W  D
Sbjct: 581 SMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSCD 625

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 58/142 (40%), Gaps = 18/142 (12%)

Query: 8   FEQRSFFGVIASNSNCVWIPTEGSRTSPGQIITSSLENINCWDIKTGNLLKTLSDSIPPG 67
           F  R F G I S+ +CV     G     G    SS +    WDI TG  ++       P 
Sbjct: 628 FPLRIFSGHI-SDVDCVTFHPNGCYIFTG----SSDKTCRMWDITTGESVRLFIGHTAP- 681

Query: 68  SIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHT-AAITFLKF 126
                      +  +    +   LA G  DGVI IWD+ T   L     H  +A+  L +
Sbjct: 682 -----------ILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSY 730

Query: 127 DPSGTRLISGSRDSNIIIWDLV 148
           +     L+SG  D+++ IWDL 
Sbjct: 731 NKESNILVSGGSDNSVRIWDLT 752

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 50/121 (41%), Gaps = 3/121 (2%)

Query: 382 LQGHRTDVRSIDISEDN-KLLAAASNGMLKIWNITTQSCIRTFDCGYA--LCCKFLPXXX 438
             GH +DV  +    +   +   +S+   ++W+ITT   +R F    A  L     P   
Sbjct: 633 FSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGL 692

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQ 498
                     + ++D+ +   L+       +A+ SL    +   L++G +D +V+ W+  
Sbjct: 693 RLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

Query: 499 V 499
           V
Sbjct: 753 V 753

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 104/249 (41%), Gaps = 19/249 (7%)

Query: 455 ASSIVLENKEAAHDAAIWSLDLT-SDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNS 513
           A  +VL      H+  + SL  + +    L++GS DK++  W    + +        +  
Sbjct: 4   AEVLVLRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRG 63

Query: 514 RLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS 573
              +V D T           ++P+  +   +  D TV+++ L S K      GHK  VLS
Sbjct: 64  HSHIVQDCT-----------VTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLS 112

Query: 574 IDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVP------QSHNFFS 627
           + I   +  I+++S DK +K+W    G+C  +L  H D +  V+  P      ++    S
Sbjct: 113 VTIDRRASQIVSASRDKTVKVWNT-LGECMVTLLGHNDWVSQVRVAPNETPEDETVTVIS 171

Query: 628 CGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVF 687
            G D V+K W+   F      I H + V  +  S DG    S   D  I +W  TE +  
Sbjct: 172 AGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEAL 231

Query: 688 LEEEREKEM 696
                + E+
Sbjct: 232 YTLNAQDEV 240

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 76/317 (23%), Positives = 133/317 (41%), Gaps = 33/317 (10%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNITTQS-----CIRTFDCGYALC--CK 432
           L+GH   V S+  S  + N LL+ + +  L  W +T         +R+F     +   C 
Sbjct: 13  LEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCT 72

Query: 433 FLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTV 492
             P             ++L++LAS   ++ +   H + + S+ +     ++++ S DKTV
Sbjct: 73  VTPDGEYALSASWDKTVRLWELASGKCIQ-RFVGHKSDVLSVTIDRRASQIVSASRDKTV 131

Query: 493 KFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAV--SLLDNTV 550
           K WN   E  +     + + S++++  + T             PED  + V  + +D  V
Sbjct: 132 KVWNTLGECMVTLLGHNDWVSQVRVAPNET-------------PEDETVTVISAGMDKVV 178

Query: 551 KVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQ 610
           KV+ L S +      GH   V ++  S D  L+ ++  D  I +W L   +   +L A Q
Sbjct: 179 KVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTLNA-Q 237

Query: 611 DAIMNVKFVPQSHNFFSCGKDGV-------IKYWDGVKFDCIQKLIAHKSEVWALALSSD 663
           D +  V F P  +   +    G+        K  D +K +      A +    +LA S+D
Sbjct: 238 DEVFAVAFSPNRYWLTAATSSGIKIFNLEERKVVDELKPEFAGYTKAAEPHAISLAWSAD 297

Query: 664 GQFFVSVSHDRSIRVWE 680
           GQ   +   D  IRVW+
Sbjct: 298 GQTLFAGYTDNVIRVWQ 314

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  +++W++ +   +  F  H + +  +  D   ++++S SRD  + +W+ +GE  +  L
Sbjct: 86  DKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGEC-MVTL 144

Query: 157 RSHKDSITGIWFENDD-------WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             H D ++ +    ++        +IS   D ++KVW++ S Q     + H     ++  
Sbjct: 145 LGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTA 204

Query: 210 SDD--LVVTANADSELKIWEL 228
           S D  LV +A  D ++ +W L
Sbjct: 205 SPDGTLVASAGKDGQIMLWNL 225

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 66/134 (49%), Gaps = 12/134 (8%)

Query: 105 MQTQTVLII---FNSHTAAITFLKFDPSGTRLI-SGSRDSNIIIWDLVGE-----VGLCK 155
           M +  VL++      H   +T L   P+   L+ SGSRD ++I W L G+     V +  
Sbjct: 1   MSSAEVLVLRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRS 60

Query: 156 LRSHKDSITGIWFEND-DWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAIS--DD 212
            R H   +       D ++ +S S D  +++W++ S +C++  + H ++  S+ I     
Sbjct: 61  FRGHSHIVQDCTVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRAS 120

Query: 213 LVVTANADSELKIW 226
            +V+A+ D  +K+W
Sbjct: 121 QIVSASRDKTVKVW 134

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 54/109 (49%), Gaps = 1/109 (0%)

Query: 87  ETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWD 146
           ET  + +   D V+K+W++ +  +   F  H   +  +   P GT + S  +D  I++W+
Sbjct: 165 ETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWN 224

Query: 147 LVGEVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
           L  +  L  L +  +     +  N  WL + +  G IK+++++ ++ V+
Sbjct: 225 LTEKEALYTLNAQDEVFAVAFSPNRYWLTAATSSG-IKIFNLEERKVVD 272

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 65/156 (41%), Gaps = 15/156 (9%)

Query: 87  ETNLLAAGYADGVIKIW-----DMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           + NLL +G  D  +  W     D Q    +  F  H+  +      P G   +S S D  
Sbjct: 29  QPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKT 88

Query: 142 IIIWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAH 200
           + +W+L     + +   HK  +  +  +     ++S S+D  +KVW+    +C+ T + H
Sbjct: 89  VRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLG-ECMVTLLGH 147

Query: 201 TTECWSLAISDD--------LVVTANADSELKIWEL 228
                 + ++ +         V++A  D  +K+W L
Sbjct: 148 NDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNL 183

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 119/295 (40%), Gaps = 41/295 (13%)

Query: 388 DVRSIDISEDNKLLAAA-SNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXX 446
           D+ S++ S+D +L AA   +  +KIW++   S I                          
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINP-----------------------K 511

Query: 447 XELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISS 506
                FD  S     +    H   ++S   + D   L++GS DKTVK W+      L++ 
Sbjct: 512 YSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVN- 570

Query: 507 STDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYG 566
               Y      V D           VK SP   + A +  D T +++  D +       G
Sbjct: 571 ----YKGHNHPVWD-----------VKFSPLGHYFASASHDQTARLWACDHIYPLRIFAG 615

Query: 567 HKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFF 626
           H   V ++    +   + T S+DK  ++W +  GD  R    H   +++ +  P      
Sbjct: 616 HTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLA 675

Query: 627 SCGKDGVIKYWDGVKFDCIQKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +  +DGVI  WD      I+++  H K+ V +L+ + +G   +S   D S+RVW+
Sbjct: 676 TGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWD 730

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 61/141 (43%), Gaps = 3/141 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
           L +G  D  +K+W M T T L+ +  H   +  +KF P G    S S D    +W     
Sbjct: 548 LVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHI 607

Query: 151 VGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             L     H + +  + F  N  ++ + S D   ++WD+ +   V   + HT    S  +
Sbjct: 608 YPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQV 667

Query: 210 SDDL--VVTANADSELKIWEL 228
           S D   + T + D  + +W++
Sbjct: 668 SPDGRWLATGSEDGVICLWDI 688

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 59/114 (51%), Gaps = 2/114 (1%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +V  + +H     +  G +D   ++WD+ T   + +F  HTA +   +  P G  L +GS
Sbjct: 619 DVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGS 678

Query: 138 RDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDIK 189
            D  I +WD+     + ++R H K+++  + F  + + LIS   D  ++VWD+K
Sbjct: 679 EDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVK 732

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 62/142 (43%), Gaps = 4/142 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A+   D   ++W       L IF  HT  +  + F P+G  + +GS D    +WD+   
Sbjct: 590 FASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTG 649

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAH---TTECWS 206
             +     H   +       D  WL + S+DG+I +WDI + + ++    H        S
Sbjct: 650 DSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLS 709

Query: 207 LAISDDLVVTANADSELKIWEL 228
                +++++  AD  +++W++
Sbjct: 710 FNKEGNVLISGGADHSVRVWDV 731

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/172 (19%), Positives = 66/172 (38%), Gaps = 21/172 (12%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVL------------------IIFNSHTA 119
           ++  LE+  +  L AAG+ D  IKIW +   +++                       H+ 
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSG 534

Query: 120 AITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN-DDWLISTS 178
            +    F P    L+SGS D  + +W +     L   + H   +  + F     +  S S
Sbjct: 535 TVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASAS 594

Query: 179 KDGLIKVWDIKSQQCVETHMAHTTECWSLAISDD--LVVTANADSELKIWEL 228
            D   ++W       +     HT +  +++   +   V T ++D   ++W++
Sbjct: 595 HDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDV 646

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 46/105 (43%), Gaps = 20/105 (19%)

Query: 27  PTEGSRTSPGQ--IITSSLENINC-WDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLE 83
           P   ++ SP    + T S + + C WDI TG  +K +           +      V  L 
Sbjct: 661 PVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQM-----------RGHGKNAVHSLS 709

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTV------LIIFNSHTAAIT 122
           ++ E N+L +G AD  +++WD++  T          FN+H   IT
Sbjct: 710 FNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDIT 754

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 107/223 (47%), Gaps = 16/223 (7%)

Query: 467 HDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELG 526
           HD+ +  +  +++G  L TG  +KT K +       L++   D   +  +   D      
Sbjct: 317 HDSVVCCVKFSNNGEYLATG-CNKTTKIFEVAT-GNLVTELVDDTKTGTE---DANSASS 371

Query: 527 ED--ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLII 584
            D  I SV  SP+ +FLA    D  ++++ +   K  + L GH+  + S+D       ++
Sbjct: 372 ADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLV 431

Query: 585 TSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK-DGVIKYWDGVKFD 643
           + S D+ I+IW L  G C  +L + +D +  V   P + N+ + G  D  ++ WD     
Sbjct: 432 SGSGDRTIRIWDLHTGQCSLTL-SIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGF 490

Query: 644 CIQKL-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
            +++L       + HK  V+++  + DG+  VS S DRS+++W
Sbjct: 491 LVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLW 533

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/322 (22%), Positives = 132/322 (40%), Gaps = 90/322 (27%)

Query: 389 VRSIDISEDNKLLA-AASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXX 447
           +RS+  S D K LA  A + +++IW+I  +  +                           
Sbjct: 376 IRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIV--------------------------- 408

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
                     +VL      H+  I+SLD    G +L++GS D+T++ W+    +  +   
Sbjct: 409 ----------MVLR----GHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSL--- 451

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISPED-RFLAVSLLDNTVKVFFLDSMKFFL---- 562
                         TL + + + +V +SP +  ++A   LD TV+V+  DS   FL    
Sbjct: 452 --------------TLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVW--DSNSGFLVERL 495

Query: 563 -----SLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL-------------DFGDCHR 604
                +  GHK  V S+  + D K I++ S D+++K+W L               G+C  
Sbjct: 496 DSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEM 555

Query: 605 SLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA----- 659
           +   H+D +++V          S  KD  + +WD V    +  L  H++ V ++A     
Sbjct: 556 TYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGK 615

Query: 660 -LSSDGQFFVSVSHDRSIRVWE 680
            L ++   F + S D   ++W+
Sbjct: 616 PLGANYNVFATGSGDCKAKIWK 637

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 97/195 (49%), Gaps = 18/195 (9%)

Query: 49  WDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLE---YHHETNLLAAGYADGVIKIWDM 105
           +++ TGNL+  L D    G+ DA     A++ Y+    +  +   LA G  D +I+IWD+
Sbjct: 344 FEVATGNLVTELVDDTKTGTEDANSASSADL-YIRSVCFSPDGKFLATGAEDKLIRIWDI 402

Query: 106 QTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLR-SHKDSIT 164
             + ++++   H   I  L +  SG +L+SGS D  I IWDL    G C L  S +D +T
Sbjct: 403 AQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDL--HTGQCSLTLSIEDGVT 460

Query: 165 GIWFE--NDDWLISTSKDGLIKVWDIKSQQCV-------ETHMAHTTECWSLAISDDL-- 213
            +     N +++ + S D  ++VWD  S   V       ET + H    +S+  + D   
Sbjct: 461 TVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKN 520

Query: 214 VVTANADSELKIWEL 228
           +V+ + D  +K+W L
Sbjct: 521 IVSGSLDRSVKLWNL 535

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 102/237 (43%), Gaps = 18/237 (7%)

Query: 374 ASKLYTIELQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALC 430
           A +   + L+GH  D+ S+D     NKL++ + +  ++IW++ T  C  T     G    
Sbjct: 403 AQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTV 462

Query: 431 CKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLI 484
                             ++++D  S  ++E  ++       H  +++S+  T DG+ ++
Sbjct: 463 AVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIV 522

Query: 485 TGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVS 544
           +GS D++VK WN +      +S   K     +M   T +   + +LSV  +  D+++   
Sbjct: 523 SGSLDRSVKLWNLRNINGASTSPQPKTEGNCEM---TYIGHKDFVLSVTTTENDQYILSG 579

Query: 545 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIKIW 595
             D  V  +   S    L L GH+  V+S+ ++    L        T S D   KIW
Sbjct: 580 SKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIW 636

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 91/224 (40%), Gaps = 55/224 (24%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           I  WD+ TG    TLS        ++ PG+                    N +AAG  D 
Sbjct: 439 IRIWDLHTGQCSLTLSIEDGVTTVAVSPGN-------------------GNYVAAGSLDR 479

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG-- 149
            +++WD  +  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L    
Sbjct: 480 TVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNIN 539

Query: 150 ---------EVGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETH 197
                      G C++    HKD +  +   END +++S SKD  +  WD  S   +   
Sbjct: 540 GASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLML 599

Query: 198 MAHTTECWSLAISD--------DLVVTANADSELKIWELDLERE 233
             H     S+A+++        ++  T + D + KIW+    R+
Sbjct: 600 QGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWKFQTIRK 643

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 51/127 (40%), Gaps = 2/127 (1%)

Query: 569 LPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSC 628
           L + S+  S D K + T + DK I+IW +        L  H+  I ++ +    +   S 
Sbjct: 374 LYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSG 433

Query: 629 GKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFL 688
             D  I+ WD     C   L              +G +  + S DR++RVW+      FL
Sbjct: 434 SGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSG--FL 491

Query: 689 EEEREKE 695
            E  + E
Sbjct: 492 VERLDSE 498

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 75/181 (41%), Gaps = 29/181 (16%)

Query: 34  SPGQ---IITSSLE-NINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETN 89
           SPG    +   SL+  +  WD  +G L++ L DS     +  K      V  + +  +  
Sbjct: 465 SPGNGNYVAAGSLDRTVRVWDSNSGFLVERL-DSEGETGVGHK----DSVYSVVFTRDGK 519

Query: 90  LLAAGYADGVIKIWDM----------QTQT---VLIIFNSHTAAITFLKFDPSGTRLISG 136
            + +G  D  +K+W++          Q +T     + +  H   +  +    +   ++SG
Sbjct: 520 NIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSG 579

Query: 137 SRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWL-------ISTSKDGLIKVWDIK 189
           S+D  +I WD V  V L  L+ H++S+  +   N   L        + S D   K+W  +
Sbjct: 580 SKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWKFQ 639

Query: 190 S 190
           +
Sbjct: 640 T 640

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 94/216 (43%), Gaps = 17/216 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   ++S   + D + L++GS DKTV+ W+      L+S     Y      V D     
Sbjct: 525 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVS-----YKGHNHPVWD----- 574

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
                 V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 575 ------VNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFT 628

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S+DK  ++W +  GD  R    H   ++++   P      +  +DG+I  WD      +
Sbjct: 629 GSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRL 688

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +++  H K+ +++L+ S +G   +S   D S+RVW+
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 93/212 (43%), Gaps = 7/212 (3%)

Query: 474 LDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHD-----TTLELGED 528
           LD + D R    G  D  +K W+  ++   +++     N+      D     T +     
Sbjct: 472 LDFSDDCRVAAAGFQDSYIKIWS--LDGSSLNNPNIVLNNETNYKDDDPTCKTLVGHSGT 529

Query: 529 ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSA 588
           + S   SP++++L     D TV+++ +D+    +S  GH  PV  ++ S       T+S 
Sbjct: 530 VYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASH 589

Query: 589 DKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKL 648
           D+  ++W  D     R    H + +  V F P     F+   D   + W+    D ++  
Sbjct: 590 DQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLF 649

Query: 649 IAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           + H + V ++A+S DG++  + S D  I VW+
Sbjct: 650 LGHTAPVISIAVSPDGRWLSTGSEDGIINVWD 681

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 69/160 (43%), Gaps = 7/160 (4%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +   L +G  D  +++W M T T L+ +  H   +  + F P G    + S D    
Sbjct: 535 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 594

Query: 144 IWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTT 202
           +W       L     H + +  + F  N  +L + S D   ++W++ +   V   + HT 
Sbjct: 595 LWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTA 654

Query: 203 ECWSLAISDDL--VVTANADSELKIWELDLERENGSKLKE 240
              S+A+S D   + T + D  + +W++      G +LK+
Sbjct: 655 PVISIAVSPDGRWLSTGSEDGIINVWDIG----TGKRLKQ 690

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 65/142 (45%), Gaps = 4/142 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A    D   ++W       L IF  H   +  + F P+G  L +GS D    +W++   
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTG 643

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTEC-WSLA 208
             +     H   +  I    D  WL + S+DG+I VWDI + + ++    H     +SL+
Sbjct: 644 DSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 209 IS--DDLVVTANADSELKIWEL 228
            S   +++++  AD  +++W+L
Sbjct: 704 YSKEGNVLISGGADHSVRVWDL 725

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 59/114 (51%), Gaps = 2/114 (1%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +V  + +H     L  G +D   ++W++ T   + +F  HTA +  +   P G  L +GS
Sbjct: 613 DVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGS 672

Query: 138 RDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDIK 189
            D  I +WD+     L ++R H K++I  + +  + + LIS   D  ++VWD+K
Sbjct: 673 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 71/175 (40%), Gaps = 6/175 (3%)

Query: 359 YYSIPYKNQKPTQVAASKLYTIEL-QGHRTDVRSIDISEDN-KLLAAASNGMLKIWNITT 416
           Y++    +Q     +   +Y + +  GH  DV  +    +   L   +S+   ++WN++T
Sbjct: 583 YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVST 642

Query: 417 QSCIRTF--DCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSL 474
              +R F       +     P             + ++D+ +   L+        AI+SL
Sbjct: 643 GDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSL 702

Query: 475 DLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDI 529
             + +G  LI+G AD +V+ W+ +  K     S +     +  + D T  + +DI
Sbjct: 703 SYSKEGNVLISGGADHSVRVWDLK--KATTEPSAEPDEPFIGYLGDVTASINQDI 755

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           IN WDI TG  LK +           +      +  L Y  E N+L +G AD  +++WD+
Sbjct: 677 INVWDIGTGKRLKQM-----------RGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

Query: 106 QTQTV 110
           +  T 
Sbjct: 726 KKATT 730

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 111/238 (46%), Gaps = 27/238 (11%)

Query: 467 HDAAIWSLDLTSDGRRLITGSADKTVKFWNFQ----VEKELISSSTDKYNSRLQMVHDTT 522
           H + +  +  ++DG  L TG  +KT + +       V +    S++   NS +    + +
Sbjct: 303 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGALVARLSDDSASTTANSSISQDANNS 361

Query: 523 LELGED-------------ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 569
            E GE+             I SV  SP+ +FLA    D  ++++ L + +  ++L GH+ 
Sbjct: 362 GENGENAVSSASTSSSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQ 421

Query: 570 PVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCG 629
            + S+D       +++ S D+ ++IW L  G C  +L + +D +  V   P    F + G
Sbjct: 422 DIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGEGKFIAAG 480

Query: 630 K-DGVIKYWDGVKFDCIQKL-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
             D  ++ WD      +++L         HK  V+++  + DGQ  VS S DRS+++W
Sbjct: 481 SLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLW 538

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 123/283 (43%), Gaps = 56/283 (19%)

Query: 468 DAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELIS--------SSTDKYNSRLQMVH 519
           D  I S+  + DG+ L TG+ DK ++ W+   ++ +++         S D + S  ++V 
Sbjct: 378 DLYIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVS 437

Query: 520 DT-----------------TLELGEDILSVKISP-EDRFLAVSLLDNTVKVFFLDSMKFF 561
            +                 TL + + + +V +SP E +F+A   LD T++V+  DS   F
Sbjct: 438 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVW--DSETGF 495

Query: 562 LS---------LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL-------------DF 599
           L            GHK  V S+  + D + +++ S D+++K+W L               
Sbjct: 496 LVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGSSSKNDSKPTA 555

Query: 600 GDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA 659
             C  +   H+D +++V          S  KD  + +WD    + +  L  H++ V ++A
Sbjct: 556 ATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVA 615

Query: 660 ------LSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEM 696
                 L  D   F + S D   R+W+ ++++    E + +E+
Sbjct: 616 VANGFPLGPDYGVFATGSGDCKARIWKYSKNKANASEPQVQEV 658

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 75/151 (49%), Gaps = 14/151 (9%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
            LA G  D +I+IWD+ T+ +++    H   I  L + PSG +L+SGS D  + IWDL  
Sbjct: 392 FLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL-- 449

Query: 150 EVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCVET-------HMA 199
             G C L  S +D +T +     +  ++ + S D  ++VWD ++   VE           
Sbjct: 450 RTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENELGTG 509

Query: 200 HTTECWSLAISDD--LVVTANADSELKIWEL 228
           H    +S+  + D   VV+ + D  +K+W L
Sbjct: 510 HKDSVYSVVFTRDGQGVVSGSLDRSVKLWNL 540

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 103/239 (43%), Gaps = 22/239 (9%)

Query: 374 ASKLYTIELQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALC 430
           ++K   + LQGH  D+ S+D     +KL++ + +  ++IW++ T  C  T     G    
Sbjct: 408 STKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTV 467

Query: 431 CKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLI 484
                             L+++D  +  ++E  ++       H  +++S+  T DG+ ++
Sbjct: 468 AVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVV 527

Query: 485 TGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGED--ILSVKISPEDRFLA 542
           +GS D++VK WN        + S+ K +S+           G    +LSV  +  D+++ 
Sbjct: 528 SGSLDRSVKLWNLH-----NTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYIL 582

Query: 543 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDIS------YDSKLIITSSADKNIKIW 595
               D  V  +   S    L L GH+  V+S+ ++       D  +  T S D   +IW
Sbjct: 583 SGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIW 641

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 94/228 (41%), Gaps = 55/228 (24%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD++TG    TLS        ++ PG                   E   +AAG  D 
Sbjct: 444 VRIWDLRTGQCSLTLSIEDGVTTVAVSPG-------------------EGKFIAAGSLDR 484

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDL--VG 149
            +++WD +T  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L   G
Sbjct: 485 TLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTG 544

Query: 150 E---------VGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETH 197
                        C++    HKD +  +   +ND +++S SKD  +  WD +S   +   
Sbjct: 545 SSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLML 604

Query: 198 MAHTTECWSLAISD--------DLVVTANADSELKIWELDLERENGSK 237
             H     S+A+++         +  T + D + +IW+    + N S+
Sbjct: 605 QGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIWKYSKNKANASE 652

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 14/128 (10%)

Query: 126 FDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGI-WFENDDWLISTSKDGLIK 184
           F P G  L +G+ D  I IWDL  +  +  L+ H+  I  + +F + D L+S S D  ++
Sbjct: 386 FSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 445

Query: 185 VWDIKSQQCVETHMAHTTECWSLAISDD---LVVTANADSELKIWE---------LDLER 232
           +WD+++ QC  T ++      ++A+S      +   + D  L++W+         LD E 
Sbjct: 446 IWDLRTGQCSLT-LSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSEN 504

Query: 233 ENGSKLKE 240
           E G+  K+
Sbjct: 505 ELGTGHKD 512

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 58/138 (42%)

Query: 571 VLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK 630
           + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S   
Sbjct: 381 IRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 440

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEE 690
           D  ++ WD     C   L              +G+F  + S DR++RVW+     +    
Sbjct: 441 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERL 500

Query: 691 EREKEMDEQYEEKLLSTL 708
           + E E+   +++ + S +
Sbjct: 501 DSENELGTGHKDSVYSVV 518

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 89/219 (40%), Gaps = 41/219 (18%)

Query: 36  GQIITSSLEN--INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAA 93
           G+ + +  E+  I  WD+ T  ++ TL            +E+  ++  L+Y    + L +
Sbjct: 390 GKFLATGAEDKLIRIWDLSTKRIVMTLQG----------HEQ--DIYSLDYFPSGDKLVS 437

Query: 94  GYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGL 153
           G  D  ++IWD++T    +  +      T       G  + +GS D  + +WD   E G 
Sbjct: 438 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWD--SETGF 495

Query: 154 CKLR---------SHKDSITGIWFEND-DWLISTSKDGLIKVWDI-------------KS 190
              R          HKDS+  + F  D   ++S S D  +K+W++              +
Sbjct: 496 LVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTGSSSKNDSKPTA 555

Query: 191 QQCVETHMAHTTECWSLAIS--DDLVVTANADSELKIWE 227
             C  T+  H     S+A +  D  +++ + D  +  W+
Sbjct: 556 ATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWD 594

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 65/156 (41%), Gaps = 26/156 (16%)

Query: 34  SPGQ---IITSSLE-NINCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHE 87
           SPG+   I   SL+  +  WD +TG L++ L   + +  G  D+ Y        + +  +
Sbjct: 470 SPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYS-------VVFTRD 522

Query: 88  TNLLAAGYADGVIKIWDMQ-------------TQTVLIIFNSHTAAITFLKFDPSGTRLI 134
              + +G  D  +K+W++                T  + +  H   +  +    +   ++
Sbjct: 523 GQGVVSGSLDRSVKLWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYIL 582

Query: 135 SGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN 170
           SGS+D  ++ WD      L  L+ H++S+  +   N
Sbjct: 583 SGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAVAN 618

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 105/247 (42%), Gaps = 22/247 (8%)

Query: 458 IVLENKEAAHDAAIWSLDLTSDGRR--LITGSADKTVKFWNFQVEKELISSSTDKYNSRL 515
           +VL      H+  + SL  TS G+   L++GS DKT+  W    + +        +    
Sbjct: 7   LVLRGTLEGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHS 65

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSL-LDNTVKVFFLDSMKFFLSLYGHKLPVLSI 574
            +V D TL             +D   A+S   D T++++ + + + +    GHK  V+S+
Sbjct: 66  HIVQDCTLT------------QDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV 113

Query: 575 DISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN-----FFSCG 629
            I   + +II+ S DK IK+W +  G C  +L  H D +  V+  P   N       S G
Sbjct: 114 AIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAG 172

Query: 630 KDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLE 689
            D ++K W+  +F      + H   V A+  S DG    S   D  I +W   E +    
Sbjct: 173 NDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYT 232

Query: 690 EEREKEM 696
              + E+
Sbjct: 233 LSAQDEV 239

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 81/345 (23%), Positives = 136/345 (39%), Gaps = 90/345 (26%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNIT-------------------TQSCI 420
           L+GH   V S+  S  + N LL+ + +  L  W +T                    Q C 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
            T D  YAL   +               L+L+D+A+    + +   H + + S+ +    
Sbjct: 73  LTQDGAYALSASW------------DKTLRLWDVATGETYQ-RFVGHKSDVMSVAIDRKA 119

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
             +I+GS DKT+K W   ++ + ++               T L   + +  V+I+P D+ 
Sbjct: 120 SMIISGSRDKTIKVWT--IKGQCLA---------------TLLGHNDWVSQVRIAPTDQN 162

Query: 541 L-AVSLL----DNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIW 595
             AV+++    D  VK + L+  +      GH   V ++  S D  LI ++  D  I +W
Sbjct: 163 DDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLW 222

Query: 596 GLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW------DGVKFDCI--QK 647
            L       +L A QD + ++ F P              +YW       G+K  C+  Q 
Sbjct: 223 NLAEKKAMYTLSA-QDEVFSLAFSPN-------------RYWLAAATASGIKIFCLDPQS 268

Query: 648 LI------------AHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           LI            + +    +LA S+DGQ   +   D  IRVW+
Sbjct: 269 LIDDLRPEFAGYNKSAEPHAVSLAWSADGQTLFAGYTDSVIRVWQ 313

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  +++WD+ T      F  H + +  +  D   + +ISGSRD  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 157 RSHKDSITGIWF----ENDDW--LISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAIS 210
             H D ++ +      +NDD   +IS   D ++K W++   Q     + H     ++  S
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 211 DD--LVVTANADSELKIWEL 228
            D  L+ +A  D E+ +W L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 62/136 (45%), Gaps = 12/136 (8%)

Query: 105 MQTQTVLII---FNSHTAAITFLKFDPSGTRLI-SGSRDSNIIIWDLVGE-----VGLCK 155
           M +  VL++      H   +T L        L+ SGSRD  +I W L G+     V +  
Sbjct: 1   MSSNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRS 60

Query: 156 LRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI--SDD 212
            + H   +       D  + +S S D  +++WD+ + +  +  + H ++  S+AI     
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKAS 120

Query: 213 LVVTANADSELKIWEL 228
           ++++ + D  +K+W +
Sbjct: 121 MIISGSRDKTIKVWTI 136

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 65/156 (41%), Gaps = 14/156 (8%)

Query: 87  ETNLLAAGYADGVIKIW-----DMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           + NLL +G  D  +  W     D +    +  F  H+  +        G   +S S D  
Sbjct: 29  QPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKT 88

Query: 142 IIIWDLVGEVGLCKLRSHKDSITGIWFEND-DWLISTSKDGLIKVWDIKSQQCVETHMAH 200
           + +WD+       +   HK  +  +  +     +IS S+D  IKVW IK  QC+ T + H
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG-QCLATLLGH 147

Query: 201 TTECWSLAIS-----DDL--VVTANADSELKIWELD 229
                 + I+     DD   V++A  D  +K W L+
Sbjct: 148 NDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLN 183

 Score = 38.1 bits (87), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 46/99 (46%), Gaps = 1/99 (1%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D ++K W++    +   F  H   +  +   P GT + S  +D  I++W+L  +  +  L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL 233

Query: 157 RSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
            +  +  +  +  N  WL + +  G IK++ +  Q  ++
Sbjct: 234 SAQDEVFSLAFSPNRYWLAAATASG-IKIFCLDPQSLID 271

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 40/193 (20%), Positives = 81/193 (41%), Gaps = 21/193 (10%)

Query: 44  ENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIW 103
           + +  WD+ TG   +                  ++V  +    + +++ +G  D  IK+W
Sbjct: 87  KTLRLWDVATGETYQRF------------VGHKSDVMSVAIDRKASMIISGSRDKTIKVW 134

Query: 104 DMQTQTVLIIFNSHTAAITFLKFDPS-----GTRLISGSRDSNIIIWDLVGEVGLCKLRS 158
            ++ Q +  +   H   ++ ++  P+        +IS   D  +  W+L           
Sbjct: 135 TIKGQCLATLLG-HNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVG 193

Query: 159 HKDSITGIWFENDDWLI-STSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLV-VT 216
           H  ++  +    D  LI S  KDG I +W++  ++ + T ++   E +SLA S +   + 
Sbjct: 194 HNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYT-LSAQDEVFSLAFSPNRYWLA 252

Query: 217 ANADSELKIWELD 229
           A   S +KI+ LD
Sbjct: 253 AATASGIKIFCLD 265

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/313 (23%), Positives = 136/313 (43%), Gaps = 81/313 (25%)

Query: 389 VRSIDISEDNKLLAA-ASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXX 447
           +RS+  S D K LAA A + +++IW+ITT+  +                           
Sbjct: 460 IRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIV--------------------------- 492

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
                     ++L+     H+  I+SLD    G +L++GS DKTV+ W+ +  +  +   
Sbjct: 493 ----------MILK----GHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDLRTGQCSL--- 535

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISPED-RFLAVSLLDNTVKV------FFLDSMKF 560
                         TL + + + +V  SP + +F+A   LD + ++      F L  +  
Sbjct: 536 --------------TLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDS 581

Query: 561 FLSLY-GHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGD------CHRSLFAHQDAI 613
              L  GHK  + S+  + D K +++ S D+++K+W LD  +      C  +   H+D +
Sbjct: 582 QTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHKDFV 641

Query: 614 MNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQ-------F 666
           ++V          S  KD  + +WD    + +  L  HK+ V ++A+ ++GQ        
Sbjct: 642 LSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSVISVAV-ANGQPLGPEFGV 700

Query: 667 FVSVSHDRSIRVW 679
           F + S D + ++W
Sbjct: 701 FSTGSGDFTAKIW 713

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 114/228 (50%), Gaps = 20/228 (8%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISS------STDKYNSRLQMVH 519
           +H + +  +  ++DG+ L TG  +KT + +      ELI++      S++  NS  Q   
Sbjct: 396 SHPSVVCCVRFSNDGQFLATG-CNKTTRVYKTST-GELIATLLVDPQSSNNSNSEQQTNP 453

Query: 520 DTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYD 579
           +++      I SV  SP+ +FLA    D  ++++ + + +  + L GH+  + S+D    
Sbjct: 454 ESSDLY---IRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPS 510

Query: 580 SKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK-DGVIKYWD 638
            + +++ S DK ++IW L  G C  +L + +D +  V   P +  F + G  D   + WD
Sbjct: 511 GEKLVSGSGDKTVRIWDLRTGQCSLTL-SIEDGVTTVSSSPNNGKFIAAGSLDRSARIWD 569

Query: 639 GVKFDCIQKL-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
                 +++L         HK  +++++ + DG+  VS S DRS+++W
Sbjct: 570 TETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLW 617

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 82/166 (49%), Gaps = 14/166 (8%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +   LAAG  D +I+IWD+ T+ +++I   H   I  L + PSG +L+SGS D  + 
Sbjct: 465 FSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTVR 524

Query: 144 IWDLVGEVGLCKLR-SHKDSITGIWF--ENDDWLISTSKDGLIKVWDIKS-------QQC 193
           IWDL    G C L  S +D +T +     N  ++ + S D   ++WD ++          
Sbjct: 525 IWDL--RTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQ 582

Query: 194 VETHMAHTTECWSLAISDD--LVVTANADSELKIWELDLERENGSK 237
            +    H    +S++ + D   +V+ + D  +K+W LD    N ++
Sbjct: 583 TDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNE 628

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 96/230 (41%), Gaps = 27/230 (11%)

Query: 382 LQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALCCKFLPXXX 438
           L+GH  D+ S+D      KL++ + +  ++IW++ T  C  T     G            
Sbjct: 495 LKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGK 554

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLITGSADKTV 492
                      +++D  +  +L+  ++       H  +I+S+  T DG++L++GS D++V
Sbjct: 555 FIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSV 614

Query: 493 KFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGED-ILSVKISPEDRFLAVSLLDNTVK 551
           K WN            D  N+      + T    +D +LSV  S  D ++     D  V 
Sbjct: 615 KLWNL-----------DTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVL 663

Query: 552 VFFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIKIW 595
            +  +S    L L GHK  V+S+ ++    L        T S D   KIW
Sbjct: 664 FWDTNSGNPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIW 713

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 84/205 (40%), Gaps = 38/205 (18%)

Query: 46  INCWDIKTGNLLKTLS--DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIW 103
           +  WD++TG    TLS  D +   S      K               +AAG  D   +IW
Sbjct: 523 VRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGK--------------FIAAGSLDRSARIW 568

Query: 104 DMQTQTVLI-------IFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDL------VGE 150
           D +T  +L        + N H  +I  + F   G +L+SGS D ++ +W+L        E
Sbjct: 569 DTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNE 628

Query: 151 VGLCKLRSHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
                   HKD +  +   +ND++++S SKD  +  WD  S   +     H     S+A+
Sbjct: 629 SCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSVISVAV 688

Query: 210 SD--------DLVVTANADSELKIW 226
           ++         +  T + D   KIW
Sbjct: 689 ANGQPLGPEFGVFSTGSGDFTAKIW 713

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 54/131 (41%), Gaps = 6/131 (4%)

Query: 571 VLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK 630
           + S+  S D K +   + DK I+IW +        L  H+  I ++ + P      S   
Sbjct: 460 IRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSG 519

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEE 690
           D  ++ WD     C   L          +  ++G+F  + S DRS R+W +TE    L  
Sbjct: 520 DKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIW-DTETGFLL-- 576

Query: 691 EREKEMDEQYE 701
              K +D Q +
Sbjct: 577 ---KRLDSQTD 584

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 94/216 (43%), Gaps = 17/216 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   ++S   + D + L++GS DKTV+ W+      L+S     Y      V D     
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVS-----YKGHNHPVWD----- 572

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
                 V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 573 ------VSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 626

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S+DK  ++W +  GD  R    H   ++++   P      +  +DG+I  WD      +
Sbjct: 627 GSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRL 686

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +++  H K+ +++L+ S +G   +S   D ++RVW+
Sbjct: 687 KQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWD 722

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 89/209 (42%), Gaps = 3/209 (1%)

Query: 474 LDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGED--ILS 531
           LD + D R    G  D  +K W+         +     N + +     TL +G    + S
Sbjct: 472 LDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTL-VGHSGTVYS 530

Query: 532 VKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKN 591
              SP++++L     D TV+++ +D+    +S  GH  PV  +  S       T+S D+ 
Sbjct: 531 TSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQT 590

Query: 592 IKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAH 651
            ++W  D     R    H + +  V F P     F+   D   + WD    D ++  + H
Sbjct: 591 ARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGH 650

Query: 652 KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
            + V ++A+  DG++  + S D  I VW+
Sbjct: 651 TAPVISIAVCPDGRWLSTGSEDGIINVWD 679

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 66/153 (43%), Gaps = 7/153 (4%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
           L +G  D  +++W M T T L+ +  H   +  + F P G    + S D    +W     
Sbjct: 540 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHI 599

Query: 151 VGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             L     H + +  + F  N  ++ + S D   ++WD+ +   V   + HT    S+A+
Sbjct: 600 YPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAV 659

Query: 210 SDDL--VVTANADSELKIWELDLERENGSKLKE 240
             D   + T + D  + +W++      G +LK+
Sbjct: 660 CPDGRWLSTGSEDGIINVWDIG----TGKRLKQ 688

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 65/142 (45%), Gaps = 4/142 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A    D   ++W       L IF  H   +  + F P+G  + +GS D    +WD+   
Sbjct: 582 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 641

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTEC-WSLA 208
             +     H   +  I    D  WL + S+DG+I VWDI + + ++    H     +SL+
Sbjct: 642 DSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLS 701

Query: 209 IS--DDLVVTANADSELKIWEL 228
            S   +++++  AD  +++W+L
Sbjct: 702 YSKEGNVLISGGADHTVRVWDL 723

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 59/114 (51%), Gaps = 2/114 (1%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +V  + +H     +  G +D   ++WD+ T   + +F  HTA +  +   P G  L +GS
Sbjct: 611 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGS 670

Query: 138 RDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDIK 189
            D  I +WD+     L ++R H K++I  + +  + + LIS   D  ++VWD+K
Sbjct: 671 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/171 (18%), Positives = 64/171 (37%), Gaps = 20/171 (11%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLI-----------------IFNSHTAA 120
           +++ L++  +  + AAG+ D  IKIW +   ++                       H+  
Sbjct: 468 DMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGT 527

Query: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN-DDWLISTSK 179
           +    F P    L+SGS D  + +W +     L   + H   +  + F     +  + S 
Sbjct: 528 VYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASH 587

Query: 180 DGLIKVWDIKSQQCVETHMAHTT--ECWSLAISDDLVVTANADSELKIWEL 228
           D   ++W       +     H    +C S   +   V T ++D   ++W++
Sbjct: 588 DQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 638

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/175 (19%), Positives = 71/175 (40%), Gaps = 6/175 (3%)

Query: 359 YYSIPYKNQKPTQVAASKLYTIEL-QGHRTDVRSIDISEDN-KLLAAASNGMLKIWNITT 416
           Y++    +Q     +   +Y + +  GH  DV  +    +   +   +S+   ++W+++T
Sbjct: 581 YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVST 640

Query: 417 QSCIRTF--DCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSL 474
              +R F       +     P             + ++D+ +   L+        AI+SL
Sbjct: 641 GDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSL 700

Query: 475 DLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDI 529
             + +G  LI+G AD TV+ W+ +  K     S +     +  + D T  + +DI
Sbjct: 701 SYSKEGNVLISGGADHTVRVWDLK--KATTEPSAEPDEPFIGYLGDVTASINQDI 753

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           IN WDI TG  LK +           +      +  L Y  E N+L +G AD  +++WD+
Sbjct: 675 INVWDIGTGKRLKQM-----------RGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723

Query: 106 QTQTV 110
           +  T 
Sbjct: 724 KKATT 728

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 114/242 (47%), Gaps = 16/242 (6%)

Query: 451 LFDLASSIVLE---NKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
           L++ A    LE   +K   H + +  +  ++DG+ L TG  +KT + +    + EL++  
Sbjct: 295 LYNPALPRTLEVELHKSLEHTSVVCCVKFSNDGQYLATG-CNKTTQVFRVS-DGELVARL 352

Query: 508 TDKYNSRLQMVHDTTLELGED--ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLY 565
           +D     +Q   + +     D  I SV  SP+ +FLA    D  ++++ L   K  + L 
Sbjct: 353 SDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQ 412

Query: 566 GHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNF 625
           GH   V S+D       +++ S D+ ++IW L  G C  +L + +D +  V   P    +
Sbjct: 413 GHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSLTL-SIEDGVTTVAVSPGDGKY 471

Query: 626 FSCGK-DGVIKYWDGVKFDCIQKL-------IAHKSEVWALALSSDGQFFVSVSHDRSIR 677
            + G  D  ++ WD      +++L         H+  V+++  + DG   VS S DRS++
Sbjct: 472 IAAGSLDRAVRVWDSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVK 531

Query: 678 VW 679
           +W
Sbjct: 532 LW 533

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 73/325 (22%), Positives = 133/325 (40%), Gaps = 93/325 (28%)

Query: 389 VRSIDISEDNKLLA-AASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXX 447
           +RS+  S D K LA  A + +++IW++  Q  +                           
Sbjct: 376 IRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIV--------------------------- 408

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
                     +VL+     HD  ++SLD    G +L++GS D+TV+ W+ +  +  +   
Sbjct: 409 ----------MVLQ----GHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSL--- 451

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISPED-RFLAVSLLDNTVKVFFLDSMKFFLS--- 563
                         TL + + + +V +SP D +++A   LD  V+V+  DS   FL    
Sbjct: 452 --------------TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERL 495

Query: 564 ------LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL-------DFGD--------- 601
                   GH+  V S+  + D   +++SS D+++K+W L       +  D         
Sbjct: 496 DSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAADNNKSQSSVV 555

Query: 602 CHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA-- 659
           C  +   H+D +++V          S  KD  + +WD    + +  L  H++ V ++A  
Sbjct: 556 CEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRNSVISVAVA 615

Query: 660 ----LSSDGQFFVSVSHDRSIRVWE 680
               L  + Q F + S D   R+W+
Sbjct: 616 NGHPLGPEYQVFATGSGDCRARIWK 640

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 84/167 (50%), Gaps = 16/167 (9%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +   LA G  D +I+IWD+  Q ++++   H   +  L + PSG +L+SGS D  + 
Sbjct: 381 FSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVR 440

Query: 144 IWDLVGEVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCVET---- 196
           IWDL  + G C L  S +D +T +     D  ++ + S D  ++VWD ++   VE     
Sbjct: 441 IWDL--KTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSE 498

Query: 197 ---HMAHTTECWSLAISDD--LVVTANADSELKIWELDL--ERENGS 236
                 H    +S+  + D   VV+++ D  +K+W L    E+EN +
Sbjct: 499 NELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAA 545

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 104/232 (44%), Gaps = 21/232 (9%)

Query: 382 LQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALCCKFLPXXX 438
           LQGH  DV S+D     +KL++ + +  ++IW++ T  C  T     G            
Sbjct: 411 LQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGK 470

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLITGSADKTV 492
                     ++++D  +  ++E  ++       H  +++S+  T DG ++++ S D++V
Sbjct: 471 YIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSV 530

Query: 493 KFWNFQV--EKELISSSTDKYNSRLQMVHDTTLELGED-ILSVKISPEDRFLAVSLLDNT 549
           K WN +   EKE   ++ D   S+  +V + T    +D +LSV  +  D F+     D  
Sbjct: 531 KLWNLRGYNEKE---NAADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRG 587

Query: 550 VKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIKIW 595
           V  +  ++    L L GH+  V+S+ ++    L        T S D   +IW
Sbjct: 588 VLFWDTNTGNPLLMLQGHRNSVISVAVANGHPLGPEYQVFATGSGDCRARIW 639

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 99/234 (42%), Gaps = 59/234 (25%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD+KTG    TLS        ++ PG  D KY                 +AAG  D 
Sbjct: 439 VRIWDLKTGQCSLTLSIEDGVTTVAVSPG--DGKY-----------------IAAGSLDR 479

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG-- 149
            +++WD +T  ++   +S       H  ++  + F   G +++S S D ++ +W+L G  
Sbjct: 480 AVRVWDSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYN 539

Query: 150 ------------EVGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCV 194
                          +C++    HKD +  +    ND++++S SKD  +  WD  +   +
Sbjct: 540 EKENAADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPL 599

Query: 195 ETHMAHTTECWSLAISD--------DLVVTANADSELKIWELDLERENGSKLKE 240
                H     S+A+++         +  T + D   +IW+   + ++ SK+KE
Sbjct: 600 LMLQGHRNSVISVAVANGHPLGPEYQVFATGSGDCRARIWKFS-KLDSASKVKE 652

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 76/204 (37%), Gaps = 18/204 (8%)

Query: 522 TLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLP----------- 570
           +LE    +  VK S + ++LA    + T +VF +   +    L     P           
Sbjct: 311 SLEHTSVVCCVKFSNDGQYLATGC-NKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDS 369

Query: 571 ------VLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN 624
                 + S+  S D K + T + D+ I+IW L        L  H   + ++ + P    
Sbjct: 370 GSTDLYIRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDK 429

Query: 625 FFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETED 684
             S   D  ++ WD     C   L              DG++  + S DR++RVW+    
Sbjct: 430 LVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 489

Query: 685 QVFLEEEREKEMDEQYEEKLLSTL 708
            +    + E E+   + + + S +
Sbjct: 490 FLVERLDSENELGTGHRDSVYSVV 513

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 117/240 (48%), Gaps = 18/240 (7%)

Query: 451 LFDLASSIVLE---NKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
           LF+ A    L+   +K   H + +  +  + DG  L TG  +KT + +      ELI+  
Sbjct: 423 LFNPALPRTLDVELHKSLDHSSVVCCVKFSYDGEFLATG-CNKTTQVYRVST-GELIAKL 480

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGH 567
           +D  N +L   + T+ +L   I SV  SP+ +FLA    D  ++++ +   K  + L GH
Sbjct: 481 SDD-NVKLDS-NSTSTDLY--IRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLKGH 536

Query: 568 KLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFS 627
           +  V S+D   D + +++ S D+ ++IW L  G C  +L + +D +  V   P    F +
Sbjct: 537 EQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPHDGRFIA 595

Query: 628 CGK-DGVIKYWDGVKFDCIQKL-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
            G  D  ++ WD      +++L         H+  V+++  + DG   VS S D+S+++W
Sbjct: 596 AGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLW 655

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 78/356 (21%), Positives = 137/356 (38%), Gaps = 81/356 (22%)

Query: 385 HRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSCI-------------RTFDCGYALCC 431
           H + V  +  S D + LA   N   +++ ++T   I              T    Y    
Sbjct: 442 HSSVVCCVKFSYDGEFLATGCNKTTQVYRVSTGELIAKLSDDNVKLDSNSTSTDLYIRSV 501

Query: 432 KFLPXXXXXXXXXXXXELQLFDLASS-IVLENKEAAHDAAIWSLDLTSDGRRLITGSADK 490
            F P             ++++D+    IV+  K   H+  ++SLD   DG++L++GS D+
Sbjct: 502 CFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLK--GHEQDVYSLDYFPDGQKLVSGSGDR 559

Query: 491 TVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPED-RFLAVSLLDNT 549
           TV+ W+ +  +  +                 TL + + + +V +SP D RF+A   LD  
Sbjct: 560 TVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPHDGRFIAAGSLDRA 602

Query: 550 VKVFFLDSMKFFLS---------LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDF- 599
           V+V+  DS   FL            GH+  V S+  + D   +++ S DK++K+W L   
Sbjct: 603 VRVW--DSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWNLGND 660

Query: 600 -----------------------------GDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK 630
                                          C  +   H+D +++V          S  K
Sbjct: 661 VNSNNNGNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYILSGSK 720

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALA------LSSDGQFFVSVSHDRSIRVWE 680
           D  + +WD    + +  L  HK+ V ++A      L      F + S D   R+W+
Sbjct: 721 DRGVLFWDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGSGDCKARIWK 776

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 75/157 (47%), Gaps = 14/157 (8%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +   LA G  D +I+IWD+Q   ++++   H   +  L + P G +L+SGS D  + 
Sbjct: 503 FSPDGKFLATGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVR 562

Query: 144 IWDLVGEVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCVET---- 196
           IWDL    G C L  S +D +T +     D  ++ + S D  ++VWD  +   VE     
Sbjct: 563 IWDL--RTGQCSLTLSIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSE 620

Query: 197 ---HMAHTTECWSLAISDDL--VVTANADSELKIWEL 228
                 H    +S+  + D   VV+ + D  +K+W L
Sbjct: 621 NELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWNL 657

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 70/168 (41%), Gaps = 8/168 (4%)

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
           L   L D+ VK   LDS      LY     + S+  S D K + T + DK I+IW +  G
Sbjct: 476 LIAKLSDDNVK---LDSNSTSTDLY-----IRSVCFSPDGKFLATGAEDKLIRIWDIQEG 527

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL 660
                L  H+  + ++ + P      S   D  ++ WD     C   L            
Sbjct: 528 KIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS 587

Query: 661 SSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTL 708
             DG+F  + S DR++RVW+ T   +    + E E+   +++ + S +
Sbjct: 588 PHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVV 635

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/230 (20%), Positives = 92/230 (40%), Gaps = 62/230 (26%)

Query: 46  INCWDIKTGNLLKTLS--DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIW 103
           +  WD++TG    TLS  D +   ++                H+   +AAG  D  +++W
Sbjct: 561 VRIWDLRTGQCSLTLSIEDGVTTVAVSP--------------HDGRFIAAGSLDRAVRVW 606

Query: 104 DMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLV-------- 148
           D  T  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L         
Sbjct: 607 DSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWNLGNDVNSNNN 666

Query: 149 --------------------GEVGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKV 185
                               G    C++    HKD +  +   +ND++++S SKD  +  
Sbjct: 667 GNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYILSGSKDRGVLF 726

Query: 186 WDIKSQQCVETHMAHTTECWSLAISD--------DLVVTANADSELKIWE 227
           WD KS   +     H     S+A+++        ++  T + D + +IW+
Sbjct: 727 WDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGSGDCKARIWK 776

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 93/216 (43%), Gaps = 17/216 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   ++S   + D + L++GS DKTV+ W+      L+S     Y      V D     
Sbjct: 527 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVS-----YKGHNHPVWD----- 576

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
                 V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 577 ------VNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 630

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S+DK  ++W +  GD  R    H   ++ +   P      +  +DG+I  WD      +
Sbjct: 631 GSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRL 690

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +++  H K+ +++L+ S +G   +S   D S+RVW+
Sbjct: 691 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 726

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 92/217 (42%), Gaps = 16/217 (7%)

Query: 474 LDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHD----------TTL 523
           L+ + D R    G  D  +K W+      L  SS +  N  L   ++          T +
Sbjct: 473 LNFSDDCRIAAAGFQDSYIKIWS------LDGSSLNNPNIMLNSANNNYRDDDPTCKTLV 526

Query: 524 ELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLI 583
                + S   SP++++L     D TV+++ +D+    +S  GH  PV  ++ S      
Sbjct: 527 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYF 586

Query: 584 ITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFD 643
            T+S D+  ++W  D     R    H + +  V F P     F+   D   + WD    D
Sbjct: 587 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGD 646

Query: 644 CIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
            ++  + H + V  +A+S DG++  + S D  I +W+
Sbjct: 647 SVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWD 683

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 66/153 (43%), Gaps = 7/153 (4%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
           L +G  D  +++W M T T L+ +  H   +  + F P G    + S D    +W     
Sbjct: 544 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 603

Query: 151 VGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             L     H + +  + F  N  ++ + S D   ++WD+ +   V   + HT     +A+
Sbjct: 604 YPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAV 663

Query: 210 SDDL--VVTANADSELKIWELDLERENGSKLKE 240
           S D   + T + D  + IW++      G +LK+
Sbjct: 664 SPDGRWLSTGSEDGIINIWDIGT----GKRLKQ 692

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 65/142 (45%), Gaps = 4/142 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A    D   ++W       L IF  H   +  + F P+G  + +GS D    +WD+   
Sbjct: 586 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 645

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTEC-WSLA 208
             +     H   +  I    D  WL + S+DG+I +WDI + + ++    H     +SL+
Sbjct: 646 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 705

Query: 209 IS--DDLVVTANADSELKIWEL 228
            S   +++++  AD  +++W+L
Sbjct: 706 YSKEGNVLISGGADHSVRVWDL 727

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 2/114 (1%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +V  + +H     +  G +D   ++WD+ T   + +F  HTA +  +   P G  L +GS
Sbjct: 615 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGS 674

Query: 138 RDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDIK 189
            D  I IWD+     L ++R H K++I  + +  + + LIS   D  ++VWD+K
Sbjct: 675 EDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 728

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/174 (19%), Positives = 67/174 (38%), Gaps = 23/174 (13%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVL---IIFNS-----------------H 117
           +++ L +  +  + AAG+ D  IKIW +   ++    I+ NS                 H
Sbjct: 469 DMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNYRDDDPTCKTLVGH 528

Query: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN-DDWLIS 176
           +  +    F P    L+SGS D  + +W +     L   + H   +  + F     +  +
Sbjct: 529 SGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFAT 588

Query: 177 TSKDGLIKVWDIKSQQCVETHMAHTT--ECWSLAISDDLVVTANADSELKIWEL 228
            S D   ++W       +     H    +C S   +   V T ++D   ++W++
Sbjct: 589 ASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 642

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/175 (19%), Positives = 72/175 (41%), Gaps = 6/175 (3%)

Query: 359 YYSIPYKNQKPTQVAASKLYTIEL-QGHRTDVRSIDISEDN-KLLAAASNGMLKIWNITT 416
           Y++    +Q     +   +Y + +  GH  DV  +    +   +   +S+   ++W+++T
Sbjct: 585 YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVST 644

Query: 417 QSCIRTF--DCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSL 474
              +R F       +C    P             + ++D+ +   L+        AI+SL
Sbjct: 645 GDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSL 704

Query: 475 DLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDI 529
             + +G  LI+G AD +V+ W+ +  K     S +     +  + D T  + +DI
Sbjct: 705 SYSKEGNVLISGGADHSVRVWDLK--KATTEPSAEPDEPFIGYLGDVTASINQDI 757

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           IN WDI TG  LK +           +      +  L Y  E N+L +G AD  +++WD+
Sbjct: 679 INIWDIGTGKRLKQM-----------RGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 727

Query: 106 QTQTV 110
           +  T 
Sbjct: 728 KKATT 732

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 116/243 (47%), Gaps = 20/243 (8%)

Query: 454 LASSIVLE-NKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELIS------S 506
           L  SI L+ +K   H + +  +  ++DG  L TG  +KT + +    + EL++      +
Sbjct: 476 LPRSIDLDLHKTLEHTSVVCCVKFSNDGEFLATG-CNKTTQIYRVS-DGELVARFSDENA 533

Query: 507 STDKYNSRLQMVHDTTLELGED--ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSL 564
            TDK +       +T+     D  I SV  SP+ +FLA    D  ++++ ++  K  + L
Sbjct: 534 HTDKADGNDNAEAETSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVL 593

Query: 565 YGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN 624
            GH+  + S+D       +++ S D+ ++IW L  G C  +L + +D +  V   P    
Sbjct: 594 KGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTL-SIEDGVTTVAVSPGDGK 652

Query: 625 FFSCGK-DGVIKYWDGVKFDCIQKL-------IAHKSEVWALALSSDGQFFVSVSHDRSI 676
           F + G  D  ++ WD      +++L         HK  V+++  + DG   VS S DRS+
Sbjct: 653 FIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSV 712

Query: 677 RVW 679
           ++W
Sbjct: 713 KLW 715

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 133/326 (40%), Gaps = 87/326 (26%)

Query: 384 GHRTD--VRSIDISEDNKLLA-AASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXX 440
           G  TD  +RS+  S D K LA  A + +++IW+I  +  +                    
Sbjct: 551 GATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIV-------------------- 590

Query: 441 XXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVE 500
                            +VL+     H+  I+SLD    G +L++GS D+TV+ W+ +  
Sbjct: 591 -----------------MVLK----GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTG 629

Query: 501 KELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPED-RFLAVSLLDNTVKVFFLDSMK 559
           +  +                 TL + + + +V +SP D +F+A   LD  V+V+  D+  
Sbjct: 630 QCTL-----------------TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGF 672

Query: 560 FFLSL-------YGHKLPVLSIDISYDSKLIITSSADKNIKIWGL------------DFG 600
               L        GHK  V S+  + D   +++ S D+++K+W L              G
Sbjct: 673 LVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSG 732

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA- 659
            C  +   H+D +++V          S  KD  + +WD V  + +  L  H++ V ++A 
Sbjct: 733 TCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAV 792

Query: 660 -----LSSDGQFFVSVSHDRSIRVWE 680
                L  +   F + S D   R+W+
Sbjct: 793 NHGHPLGPNYHIFATGSGDCKARIWK 818

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 76/151 (50%), Gaps = 14/151 (9%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
            LA G  D +I+IWD++ + ++++   H   I  L + PSG +L+SGS D  + IWDL  
Sbjct: 569 FLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL-- 626

Query: 150 EVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCVET-------HMA 199
           + G C L  S +D +T +     D  ++ + S D  ++VWD  +   VE           
Sbjct: 627 KTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTG 686

Query: 200 HTTECWSLAISDD--LVVTANADSELKIWEL 228
           H    +S+  + D   VV+ + D  +K+W L
Sbjct: 687 HKDSVYSVVFTRDGNGVVSGSLDRSVKLWNL 717

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 61/140 (43%), Gaps = 4/140 (2%)

Query: 571 VLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK 630
           + S+  S D K + T + DK I+IW ++       L  H+  I ++ + P      S   
Sbjct: 558 IRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSG 617

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEE 690
           D  ++ WD     C   L              DG+F  + S DR++RVW+   D  FL E
Sbjct: 618 DRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD--SDTGFLVE 675

Query: 691 --EREKEMDEQYEEKLLSTL 708
             + E E+   +++ + S +
Sbjct: 676 RLDSENELGTGHKDSVYSVV 695

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 100/234 (42%), Gaps = 27/234 (11%)

Query: 382 LQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALCCKFLPXXX 438
           L+GH  D+ S+D     +KL++ + +  ++IW++ T  C  T     G            
Sbjct: 593 LKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGK 652

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLITGSADKTV 492
                     ++++D  +  ++E  ++       H  +++S+  T DG  +++GS D++V
Sbjct: 653 FIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSV 712

Query: 493 KFWNFQVEKELISSSTDKYNSRLQMVHDT---TLELGED-ILSVKISPEDRFLAVSLLDN 548
           K WN +        + +  N+  +    T   T    +D +LSV  + +D ++     D 
Sbjct: 713 KLWNLR--------NVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDR 764

Query: 549 TVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDC 602
            V  +   S    L L GH+  V+S+ +++   L        N  I+    GDC
Sbjct: 765 GVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPL------GPNYHIFATGSGDC 812

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 57/108 (52%), Gaps = 5/108 (4%)

Query: 126 FDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGI-WFENDDWLISTSKDGLIK 184
           F P G  L +G+ D  I IWD+  +  +  L+ H+  I  + +F + D L+S S D  ++
Sbjct: 563 FSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVR 622

Query: 185 VWDIKSQQCVETHMAHTTECWSLAISDD---LVVTANADSELKIWELD 229
           +WD+K+ QC  T ++      ++A+S      +   + D  +++W+ D
Sbjct: 623 IWDLKTGQCTLT-LSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSD 669

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 90/217 (41%), Gaps = 54/217 (24%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD+KTG    TLS        ++ PG  D K+                 +AAG  D 
Sbjct: 621 VRIWDLKTGQCTLTLSIEDGVTTVAVSPG--DGKF-----------------IAAGSLDR 661

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG-- 149
            +++WD  T  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L    
Sbjct: 662 AVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVN 721

Query: 150 --------EVGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETHM 198
                     G C++    HKD +  +   E+D++++S SKD  +  WD  S   +    
Sbjct: 722 HNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQ 781

Query: 199 AHTTECWSLAISDD--------LVVTANADSELKIWE 227
            H     S+A++          +  T + D + +IW+
Sbjct: 782 GHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWK 818

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 72/170 (42%), Gaps = 26/170 (15%)

Query: 82  LEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           L+Y    + L +G  D  ++IWD++T    +  +      T       G  + +GS D  
Sbjct: 603 LDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRA 662

Query: 142 IIIWDLVGEVGLCKLR---------SHKDSITGIWFEND-DWLISTSKDGLIKVWDIK-- 189
           + +WD   + G    R          HKDS+  + F  D + ++S S D  +K+W+++  
Sbjct: 663 VRVWD--SDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNV 720

Query: 190 ----------SQQCVETHMAHTTECWSLAIS--DDLVVTANADSELKIWE 227
                     S  C  T+  H     S+A +  D+ +++ + D  +  W+
Sbjct: 721 NHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWD 770

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 65/151 (43%), Gaps = 25/151 (16%)

Query: 34  SPGQ---IITSSLEN-INCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHE 87
           SPG    I   SL+  +  WD  TG L++ L   + +  G  D+ Y        + +  +
Sbjct: 647 SPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYS-------VVFTRD 699

Query: 88  TNLLAAGYADGVIKIWDMQ------------TQTVLIIFNSHTAAITFLKFDPSGTRLIS 135
            N + +G  D  +K+W+++            + T  + +  H   +  +        ++S
Sbjct: 700 GNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILS 759

Query: 136 GSRDSNIIIWDLVGEVGLCKLRSHKDSITGI 166
           GS+D  ++ WD V    L  L+ H++S+  +
Sbjct: 760 GSKDRGVLFWDKVSGNPLLMLQGHRNSVISV 790

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 92/216 (42%), Gaps = 17/216 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   ++S   + D R L++ S DKTV+ W           STD Y S +          
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLW-----------STDTYTSLVNYKGHN---- 524

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
              I  V  SP   + A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 525 -HPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFT 583

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S+DK  ++W +  GD  R    H   + +    P      +  +DGVI  WD      +
Sbjct: 584 GSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRL 643

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +++  H K+ V++L+ S +G   +S   D S+RVW+
Sbjct: 644 KQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWD 679

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 96/216 (44%), Gaps = 9/216 (4%)

Query: 468 DAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEK---ELISSSTDKYNSRLQMVHDTTLE 524
           ++ + SL+ + D R    G  D  +K W+   E    +L S   ++ N+   + H  T  
Sbjct: 427 NSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGT-- 484

Query: 525 LGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLII 584
               + S   SP++R+L  +  D TV+++  D+    ++  GH  P+  +  S       
Sbjct: 485 ----VYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFA 540

Query: 585 TSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDC 644
           T+S D+  ++W  D     R    H + +  V F P     F+   D   + WD    D 
Sbjct: 541 TASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDS 600

Query: 645 IQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           ++  + H + V + A+S DG++  + S D  I VW+
Sbjct: 601 VRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWD 636

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 97/219 (44%), Gaps = 21/219 (9%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +VA+    H     A    D   ++W       L IF  H   +  + F P+GT + +GS
Sbjct: 529 DVAFSPLGH---YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGS 585

Query: 138 RDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVET 196
            D    +WD+     +     H   +T      D  WL + S+DG+I VWDI + + ++ 
Sbjct: 586 SDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQ 645

Query: 197 HMAHTTEC-WSLAISDD--LVVTANADSELKIWELDLER-ENGSKLKEK--GIYEKQSRQ 250
              H     +SL+ S +  ++++  AD  +++W++     E GS+ ++   G     +  
Sbjct: 646 MRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVKKSTAEPGSEPEQPFTGYSGDVTSS 705

Query: 251 RSVDVK-------IVTNPDEVKFFYVQNADKTTEVFRIR 282
            + D+K       IV + D +  FY     K T VF+++
Sbjct: 706 VNQDIKEYGRRRTIVPSSDLIASFYT----KKTPVFKVK 740

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 79/177 (44%), Gaps = 17/177 (9%)

Query: 519 HDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDS--MKFFL-----------SLY 565
           H+T  E+     S++ S + R  A    D+ +K++ LD   +K  L           +L 
Sbjct: 424 HNTNSEM----TSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLV 479

Query: 566 GHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNF 625
           GH   V S   S D++ ++++S DK +++W  D      +   H   I +V F P  H F
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYF 539

Query: 626 FSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEET 682
            +   D   + W       ++    H ++V  ++   +G +  + S D++ R+W+ T
Sbjct: 540 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDIT 596

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/242 (20%), Positives = 83/242 (34%), Gaps = 62/242 (25%)

Query: 57  LKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNS 116
           L+ L  S P   +   +   +E+  LE+  +  L AAG+ D +IKIW +  + +     S
Sbjct: 408 LENLQSSAPSVCMYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPS 467

Query: 117 -------------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSI 163
                        H+  +    F P    L+S S D  + +W       L   + H   I
Sbjct: 468 KQGERTNNETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPI 527

Query: 164 TGIWF-------------------------------------------ENDDWLISTSKD 180
             + F                                            N  ++ + S D
Sbjct: 528 WDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSD 587

Query: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAISDDL--VVTANADSELKIWELDLERENGSKL 238
              ++WDI S   V   + HT    S A+S D   + T + D  + +W++      G +L
Sbjct: 588 KTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIG----TGKRL 643

Query: 239 KE 240
           K+
Sbjct: 644 KQ 645

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/175 (18%), Positives = 70/175 (40%), Gaps = 6/175 (3%)

Query: 359 YYSIPYKNQKPTQVAASKLYTIEL-QGHRTDVRSIDISEDNK-LLAAASNGMLKIWNITT 416
           Y++    +Q     +   +Y + +  GH  DV ++    +   +   +S+   ++W+IT+
Sbjct: 538 YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITS 597

Query: 417 QSCIRTF--DCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSL 474
              +R F             P             + ++D+ +   L+        A++SL
Sbjct: 598 GDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSL 657

Query: 475 DLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDI 529
             + +G  LI+G AD +V+ W+  V+K      ++          D T  + +DI
Sbjct: 658 SYSKEGHVLISGGADHSVRVWD--VKKSTAEPGSEPEQPFTGYSGDVTSSVNQDI 710

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 14/87 (16%)

Query: 27  PTEGSRTSP-GQIITSSLEN--INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLE 83
           P   +  SP G+ +++  E+  IN WDI TG  LK +           +      V  L 
Sbjct: 610 PVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQM-----------RGHGKNAVYSLS 658

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTV 110
           Y  E ++L +G AD  +++WD++  T 
Sbjct: 659 YSKEGHVLISGGADHSVRVWDVKKSTA 685

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 101/230 (43%), Gaps = 21/230 (9%)

Query: 458 IVLENKEAAHDAAIWSLDLTSDGRR--LITGSADKTVKFWNFQVEKELISSSTDKYNSRL 515
           +VL      H+  + SL  TS G+   L++ S DKT+  W    + + +      +    
Sbjct: 7   LVLRGTLEGHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHS 65

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 575
            +V D TL           +P+  +   +  D T++++ + + + F    GHK  V+S+ 
Sbjct: 66  HIVQDVTL-----------TPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVA 114

Query: 576 ISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVP------QSHNFFSCG 629
           I   + +II+ S DK+IK+W +  G C  +L  H D +  V+  P      ++    S G
Sbjct: 115 IDRKASMIISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAG 173

Query: 630 KDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
            D ++K W+  +F      + H   V  +  S DG    S   D  I +W
Sbjct: 174 NDKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLW 223

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 65/141 (46%), Gaps = 10/141 (7%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  +++W++ T      F  H + +  +  D   + +ISGSRD +I +W + G+  L  L
Sbjct: 86  DKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 157 RSHKDSITGIWFENDD-------WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             H D ++ +    +D        +IS   D ++K W++   Q     + H     ++  
Sbjct: 145 LGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITA 204

Query: 210 SDD--LVVTANADSELKIWEL 228
           S D  L+ +A  D E+ +W L
Sbjct: 205 SPDGSLIASAGKDGEIMLWNL 225

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 68/322 (21%), Positives = 131/322 (40%), Gaps = 43/322 (13%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNITTQS-----CIRTFDCGYALCCK-- 432
           L+GH   V S+  S  + N L++A+ +  L  W +T         +R+F  G++   +  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFK-GHSHIVQDV 71

Query: 433 -FLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKT 491
              P             L+L+++A+    + +   H + + S+ +      +I+GS DK+
Sbjct: 72  TLTPDGAYALSASWDKTLRLWEVATGETFQ-RFVGHKSDVMSVAIDRKASMIISGSRDKS 130

Query: 492 VKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDR------FLAVSL 545
           +K W   ++ + ++               T L   + +  V+++P D+       +  + 
Sbjct: 131 IKVWT--IKGQCLA---------------TLLGHNDWVSQVRVAPNDKDDDETVTVISAG 173

Query: 546 LDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRS 605
            D  VK + L+  +      GH   V +I  S D  LI ++  D  I +W L       +
Sbjct: 174 NDKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYT 233

Query: 606 LFAHQDAIMNVKFVPQSHNFFSCGKDGVIKY-------WDGVKFDCIQKLIAHKSEVWAL 658
           L A QD +  + F P  +   +    G+  +        D ++ +      A +    +L
Sbjct: 234 LNA-QDEVFALAFSPNRYWLAAATASGIKVFSLDPQALIDDLRPEFAGYNKAAEPHAVSL 292

Query: 659 ALSSDGQFFVSVSHDRSIRVWE 680
             S+DGQ   +   D  IRVW+
Sbjct: 293 TWSADGQTLFAGYTDNVIRVWQ 314

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 66/157 (42%), Gaps = 15/157 (9%)

Query: 87  ETNLLAAGYADGVIKIW-----DMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           + NLL +   D  +  W     D +    +  F  H+  +  +   P G   +S S D  
Sbjct: 29  QPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLTPDGAYALSASWDKT 88

Query: 142 IIIWDLVGEVGLCKLRSHKDSITGIWFEND-DWLISTSKDGLIKVWDIKSQQCVETHMAH 200
           + +W++       +   HK  +  +  +     +IS S+D  IKVW IK  QC+ T + H
Sbjct: 89  LRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKG-QCLATLLGH 147

Query: 201 TTECWSLAIS----DD----LVVTANADSELKIWELD 229
                 + ++    DD     V++A  D  +K W L+
Sbjct: 148 NDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLN 184

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 50/109 (45%), Gaps = 1/109 (0%)

Query: 87  ETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWD 146
           ET  + +   D ++K W++    +   F  H   +  +   P G+ + S  +D  I++W+
Sbjct: 165 ETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWN 224

Query: 147 LVGEVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
           L  +V +  L +  +     +  N  WL + +  G IKV+ +  Q  ++
Sbjct: 225 LADKVPMYTLNAQDEVFALAFSPNRYWLAAATASG-IKVFSLDPQALID 272

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 106/227 (46%), Gaps = 15/227 (6%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            HD+ +  +  + DG+ L TG  ++T + ++    +  +    D  N+ +        E 
Sbjct: 277 PHDSVVCCVKFSQDGKYLATG-CNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNET 335

Query: 526 GED-----ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDS 580
                   I S+  SP+  FLA    D  ++++ +   K  + L GH+  + S+D   D 
Sbjct: 336 VTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDG 395

Query: 581 KLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK-DGVIKYWDG 639
           + +++ S D++I+IW L  G C  +L + +D +  V   P      + G  D  ++ WD 
Sbjct: 396 QKLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDS 454

Query: 640 VKFDCIQKL-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
                +++L         H+  V+++A + DGQ  VS S DR++++W
Sbjct: 455 STGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLW 501

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 135/315 (42%), Gaps = 83/315 (26%)

Query: 389 VRSIDISEDNKLLA-AASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXX 447
           +RSI  S D + LA  A + +++IWNI  +  +                           
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIV--------------------------- 376

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
                     +VL+     H+  I+SLD   DG++L++GS D++++ W+ +  +  +   
Sbjct: 377 ----------MVLK----GHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSL--- 419

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISP-EDRFLAVSLLDNTVKVFFLDSMKFFL---- 562
                         TL + + + +V +SP E + +A   LD +V+++  DS   FL    
Sbjct: 420 --------------TLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIW--DSSTGFLVERL 463

Query: 563 -----SLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLD-----FGDCHRSLFAHQDA 612
                S  GH+  V S+  + D + +++ S D+ +K+W L       G C  +   H+D 
Sbjct: 464 DSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDF 523

Query: 613 IMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSS----DG---Q 665
           +++V         FS  KD  +  WD    + I  L  H++ V ++A  +    DG   +
Sbjct: 524 VLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNSVISVATVNSNVDDGKNYK 583

Query: 666 FFVSVSHDRSIRVWE 680
            F + S D   R+W+
Sbjct: 584 LFATGSGDCKARIWK 598

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 81/157 (51%), Gaps = 14/157 (8%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +   LA G  D +I+IW+++ + ++++   H   I  L + P G +L+SGS D +I 
Sbjct: 349 FSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIR 408

Query: 144 IWDLVGEVGLCKLR-SHKDSITGIWF-ENDDWLIST-SKDGLIKVWDIKSQQCV------ 194
           IWDL  + G C L  S +D +T +    N+  LI+  S D  +++WD  +   V      
Sbjct: 409 IWDL--KTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSD 466

Query: 195 -ETHMAHTTECWSLAISDD--LVVTANADSELKIWEL 228
            E+   H    +S+A + D   VV+ + D  +K+W L
Sbjct: 467 NESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNL 503

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 102/230 (44%), Gaps = 27/230 (11%)

Query: 382 LQGHRTDVRSIDISEDN-KLLAAASNGMLKIWNITTQSCIRTFDC--GYALCCKFLPXXX 438
           L+GH  D+ S+D   D  KL++ + +  ++IW++ T  C  T     G            
Sbjct: 379 LKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGK 438

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLITGSADKTV 492
                     ++++D ++  ++E  ++       H  +++S+  T DG+ +++GS D+TV
Sbjct: 439 LIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTV 498

Query: 493 KFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKV 552
           K WN           T     + ++   T +   + +LSV  S +D+++     D  V +
Sbjct: 499 KLWNL--------GDTQSGTGKCEV---TYIGHKDFVLSVATSNDDKYIFSGSKDRGVII 547

Query: 553 FFLDSMKFFLSLYGHKLPVLS-------IDISYDSKLIITSSADKNIKIW 595
           +  DS    L L GH+  V+S       +D   + KL  T S D   +IW
Sbjct: 548 WDKDSGNPILMLQGHRNSVISVATVNSNVDDGKNYKLFATGSGDCKARIW 597

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 87/206 (42%), Gaps = 38/206 (18%)

Query: 46  INCWDIKTGNLLKTLS--DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIW 103
           I  WD+KTG    TLS  D +   ++                +E  L+AAG  D  ++IW
Sbjct: 407 IRIWDLKTGQCSLTLSIEDGVTTVAVSP--------------NEGKLIAAGSLDRSVRIW 452

Query: 104 DMQTQTVLIIF-------NSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLV---GEVGL 153
           D  T  ++          N H  ++  + F   G  ++SGS D  + +W+L       G 
Sbjct: 453 DSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGK 512

Query: 154 CKLR--SHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI- 209
           C++    HKD +  +   NDD ++ S SKD  + +WD  S   +     H     S+A  
Sbjct: 513 CEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNSVISVATV 572

Query: 210 ---SDD-----LVVTANADSELKIWE 227
               DD     L  T + D + +IW+
Sbjct: 573 NSNVDDGKNYKLFATGSGDCKARIWK 598

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 58/144 (40%), Gaps = 2/144 (1%)

Query: 541 LAVSLLDNTVK--VFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLD 598
           L V LLD+TV   +    +           L + SI  S D + + T + DK I+IW + 
Sbjct: 312 LYVKLLDDTVNTAIVTTTTENNETVTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIK 371

Query: 599 FGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWAL 658
                  L  H+  I ++ + P      S   D  I+ WD     C   L          
Sbjct: 372 ERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVA 431

Query: 659 ALSSDGQFFVSVSHDRSIRVWEET 682
              ++G+   + S DRS+R+W+ +
Sbjct: 432 VSPNEGKLIAAGSLDRSVRIWDSS 455

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 61/145 (42%), Gaps = 14/145 (9%)

Query: 27  PTEGSRTSPGQIITSSLENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHH 86
           P EG   + G +  S    +  WD  TG L++ L      G  +   +    VA+ +   
Sbjct: 434 PNEGKLIAAGSLDRS----VRIWDSSTGFLVERLDSDNESG--NGHQDSVYSVAFTK--- 484

Query: 87  ETNLLAAGYADGVIKIW---DMQTQT--VLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           +   + +G  D  +K+W   D Q+ T    + +  H   +  +        + SGS+D  
Sbjct: 485 DGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRG 544

Query: 142 IIIWDLVGEVGLCKLRSHKDSITGI 166
           +IIWD      +  L+ H++S+  +
Sbjct: 545 VIIWDKDSGNPILMLQGHRNSVISV 569

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 101/250 (40%), Gaps = 18/250 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   ++S   + D + L++ S DKTV+ W+      L+S     Y      V D     
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVS-----YKGHNHPVWD----- 523

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
                 V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 524 ------VSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFT 577

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S DK  ++W +  GD  R    H   +++    P      +  +DG+I  WD      +
Sbjct: 578 GSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRL 637

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKL 704
           +++  H K+ V++L+ S +G   VS   D S+RVW+          E E+     + +  
Sbjct: 638 KQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLKRSTAEPNTEPEQPFTSYFGDAT 697

Query: 705 LSTLENDASD 714
            S + ND  D
Sbjct: 698 TS-VNNDIKD 706

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 93/210 (44%), Gaps = 9/210 (4%)

Query: 474 LDLTSDGRRLITGSADKTVKFWNF---QVEKELISSSTDKYNSRLQMVHDTTLELGEDIL 530
           L+ + D      G  D  +K W+     ++ +L S   +K N+   + H  T      + 
Sbjct: 427 LEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGT------VY 480

Query: 531 SVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADK 590
           S   SP++++L  +  D TV+++ +D+    +S  GH  PV  +  S       T+S D+
Sbjct: 481 STSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQ 540

Query: 591 NIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIA 650
             ++W  D     R    H + +  V F P     F+   D   + WD    D ++  + 
Sbjct: 541 TARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLG 600

Query: 651 HKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           H + V + A+S DG++  + S D  I VW+
Sbjct: 601 HTAPVISTAVSPDGRWLSTGSEDGIINVWD 630

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 4/142 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A    D   ++W       L IF  H   +  + F P+GT + +GS D    +WD+   
Sbjct: 533 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTG 592

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTEC-WSLA 208
             +     H   +       D  WL + S+DG+I VWDI + + ++    H     +SL+
Sbjct: 593 DSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLS 652

Query: 209 ISDD--LVVTANADSELKIWEL 228
            S +  ++V+  AD  +++W+L
Sbjct: 653 YSKEGTVLVSGGADHSVRVWDL 674

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 65/153 (42%), Gaps = 7/153 (4%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
           L +   D  +++W M T + L+ +  H   +  + F P G    + S D    +W     
Sbjct: 491 LLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHI 550

Query: 151 VGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             L     H + +  + F  N  ++ + S D   ++WDI +   V   + HT    S A+
Sbjct: 551 YPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAV 610

Query: 210 SDD--LVVTANADSELKIWELDLERENGSKLKE 240
           S D   + T + D  + +W++      G +LK+
Sbjct: 611 SPDGRWLSTGSEDGIINVWDIG----TGKRLKQ 639

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +V  + +H     +  G  D   ++WD+ T   + +F  HTA +      P G  L +GS
Sbjct: 562 DVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGS 621

Query: 138 RDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFENDDW-LISTSKDGLIKVWDIK 189
            D  I +WD+     L ++R H K+++  + +  +   L+S   D  ++VWD+K
Sbjct: 622 EDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 11/65 (16%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           IN WDI TG  LK +           +      V  L Y  E  +L +G AD  +++WD+
Sbjct: 626 INVWDIGTGKRLKQM-----------RGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDL 674

Query: 106 QTQTV 110
           +  T 
Sbjct: 675 KRSTA 679

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 94/216 (43%), Gaps = 17/216 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   ++S   + D R L++GS DKTV+ W+      L+S     Y      V D     
Sbjct: 556 GHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVS-----YKGHNHPVWD----- 605

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
                 V+ SP   + A +  D+T +++  D +       GH   V  +    +   + T
Sbjct: 606 ------VEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFT 659

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S+DK  ++W +  GD  R        +M+    P      +  +DGVI  WD      +
Sbjct: 660 GSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRL 719

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +++  H K+ +++L+ + +G   +S   D S+RVW+
Sbjct: 720 KQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWD 755

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 93/217 (42%), Gaps = 4/217 (1%)

Query: 468 DAAIWSLDLTSDGRRLITGSADKTVKFWNFQVE--KELISSSTDKYNSRLQMVHDTTLEL 525
           D  + SL+ + D R    G  D  +K ++         ++ S  K N  L     T+  +
Sbjct: 496 DRDMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLI 555

Query: 526 GED--ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLI 583
           G    + S   SP++R+L     D TV+++ +D+    +S  GH  PV  ++ S      
Sbjct: 556 GHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYF 615

Query: 584 ITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFD 643
            T+S D   ++W  D     R    H + +  V F P     F+   D   + WD    D
Sbjct: 616 ATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGD 675

Query: 644 CIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
            ++  +   + V + ++S DG++  + S D  I VW+
Sbjct: 676 SVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWD 712

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 77/182 (42%), Gaps = 21/182 (11%)

Query: 528 DILSVKISPEDRFLAVSLLDNTVKVFFLDSMKF--------------------FLSLYGH 567
           D+ S++ S + R  A    D+ +K+F LD                          +L GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 568 KLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFS 627
              V S   S D++ +++ S DK +++W +D      S   H   + +V+F P  H F +
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFAT 617

Query: 628 CGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE-ETEDQV 686
              D   + W       ++    H ++V  ++   +G +  + S D++ R+W+  T D V
Sbjct: 618 ASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSV 677

Query: 687 FL 688
            L
Sbjct: 678 RL 679

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 99/219 (45%), Gaps = 26/219 (11%)

Query: 82  LEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           +E+    +  A    D   ++W       L IF  H   +  + F P+G  L +GS D  
Sbjct: 606 VEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKT 665

Query: 142 IIIWDL-VGEVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVETHMAH 200
             +WD+  G+     L      ++     +  WL + S+DG+I VWDI + + ++    H
Sbjct: 666 CRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGH 725

Query: 201 TTEC-WSLAIS--DDLVVTANADSELKIWEL-DLERENGSKLKEKGI------------- 243
                +SL+ +   +++++  AD  +++W+L     E+G++ +E  +             
Sbjct: 726 GKNAIYSLSYNKEGNVLISGGADHSVRVWDLKKATTESGAEPEEPFVGYLGDVTTSINQD 785

Query: 244 YEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIR 282
            ++  R+R+V   I TN D V  FY     K T VF+++
Sbjct: 786 IKEYGRRRTV---IPTN-DLVASFYT----KKTPVFKVK 816

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 66/153 (43%), Gaps = 7/153 (4%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
           L +G  D  +++W M T T L+ +  H   +  ++F P G    + S D    +W     
Sbjct: 573 LVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTARLWSCDHI 632

Query: 151 VGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             L     H + +  + F  N  +L + S D   ++WDI +   V   +  T    S ++
Sbjct: 633 YPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSV 692

Query: 210 SDDL--VVTANADSELKIWELDLERENGSKLKE 240
           S D   + T + D  + +W++      G +LK+
Sbjct: 693 SPDGRWLSTGSEDGVINVWDIG----TGKRLKQ 721

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 60/149 (40%), Gaps = 5/149 (3%)

Query: 384 GHRTDVRSIDISEDN-KLLAAASNGMLKIWNITTQSCIRTFD--CGYALCCKFLPXXXXX 440
           GH  DV  +    +   L   +S+   ++W+ITT   +R F       +     P     
Sbjct: 640 GHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWL 699

Query: 441 XXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVE 500
                   + ++D+ +   L+        AI+SL    +G  LI+G AD +V+ W+ +  
Sbjct: 700 STGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLK-- 757

Query: 501 KELISSSTDKYNSRLQMVHDTTLELGEDI 529
           K    S  +     +  + D T  + +DI
Sbjct: 758 KATTESGAEPEEPFVGYLGDVTTSINQDI 786

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/177 (18%), Positives = 66/177 (37%), Gaps = 29/177 (16%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDM-----------------------QTQTVLIIF 114
           ++  LE+  +  L AAG+ D  IKI+ +                       ++ + LI  
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLI-- 555

Query: 115 NSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN-DDW 173
             H+  +    F P    L+SGS D  + +W +     L   + H   +  + F     +
Sbjct: 556 -GHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHY 614

Query: 174 LISTSKDGLIKVWDIKSQQCVETHMAH--TTECWSLAISDDLVVTANADSELKIWEL 228
             + S D   ++W       +     H    +C S   +   + T ++D   ++W++
Sbjct: 615 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 671

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 22/103 (21%)

Query: 11  RSFFGVIASNSNCVWIPTEGSRTSP-GQIITSSLEN--INCWDIKTGNLLKTLSDSIPPG 67
           R F G+ A        P   +  SP G+ +++  E+  IN WDI TG  LK +       
Sbjct: 678 RLFLGLTA--------PVMSTSVSPDGRWLSTGSEDGVINVWDIGTGKRLKQM------- 722

Query: 68  SIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTV 110
               +      +  L Y+ E N+L +G AD  +++WD++  T 
Sbjct: 723 ----RGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLKKATT 761

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 94/210 (44%), Gaps = 9/210 (4%)

Query: 474 LDLTSDGRRLITGSADKTVKFWNF---QVEKELISSSTDKYNSRLQMVHDTTLELGEDIL 530
           ++ + D R    G  D T+K W      ++  L S + D+ NS   + H         + 
Sbjct: 504 VEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGP------VY 557

Query: 531 SVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADK 590
           SV  SP++R+L  +  D TV+++ LD+    +   GH  PV  +  S      IT+S D+
Sbjct: 558 SVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQ 617

Query: 591 NIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIA 650
             ++W  D     R    H + +    F P     F+   D   + WD    D ++  + 
Sbjct: 618 TARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLG 677

Query: 651 HKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           H S V AL +S DG++  + S D +I VW+
Sbjct: 678 HTSPVTALEVSPDGRWLTTGSEDGTIIVWD 707

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 89/216 (41%), Gaps = 17/216 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   ++S+  + D R L++ S DKTV+ W+      L+      +              
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNH-------------- 596

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
              +  VK SP   +   +  D T +++  D +       GH   V       +   + T
Sbjct: 597 --PVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFT 654

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S+DK  ++W +  GD  R    H   +  ++  P      +  +DG I  WD      I
Sbjct: 655 GSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRI 714

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +++  H K+ ++++  + +G   V+   D+S+RVW+
Sbjct: 715 KQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWD 750

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 59/108 (54%), Gaps = 2/108 (1%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +H     +  G +D   ++WD+QT   + +F  HT+ +T L+  P G  L +GS D  II
Sbjct: 645 FHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTII 704

Query: 144 IWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDIK 189
           +WD+     + +++ H K+ I  I F  + + L++   D  ++VWDIK
Sbjct: 705 VWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 106/266 (39%), Gaps = 65/266 (24%)

Query: 382 LQGHRTDVRSIDISEDNK-LLAAASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXX 440
           L GH   V S+  S DN+ LL+A+ +  +++W++ T +C+        +C K        
Sbjct: 549 LVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCL--------VCYK-------- 592

Query: 441 XXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVE 500
                                     H+  +W +  +  G   IT S D+T + W     
Sbjct: 593 -------------------------GHNHPVWYVKFSPLGHYFITASHDQTARLW----- 622

Query: 501 KELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFL---DS 557
                S    Y  R+   H        D+      P   ++     D T +++ +   DS
Sbjct: 623 -----SCDHIYPLRIFSGH------LNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDS 671

Query: 558 MKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAH-QDAIMNV 616
           ++ FL   GH  PV ++++S D + + T S D  I +W +  G   + +  H ++ I ++
Sbjct: 672 VRLFL---GHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSI 728

Query: 617 KFVPQSHNFFSCGKDGVIKYWDGVKF 642
            F  + +   + G D  ++ WD  +F
Sbjct: 729 TFNKEGNCLVTGGADQSVRVWDIKRF 754

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/277 (19%), Positives = 106/277 (38%), Gaps = 14/277 (5%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
             V  + +  +   L +   D  +++W + T T L+ +  H   + ++KF P G   I+ 
Sbjct: 554 GPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITA 613

Query: 137 SRDSNIIIWDLVGEVGLCKLRSHKDSI-TGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
           S D    +W       L     H + +    +  N  ++ + S D   ++WDI++   V 
Sbjct: 614 SHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVR 673

Query: 196 THMAHTTECWSLAISDD--LVVTANADSELKIWELDLERENGSKLKEKGIYEKQSRQRSV 253
             + HT+   +L +S D   + T + D  + +W++      G ++K+   + K       
Sbjct: 674 LFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIG----TGKRIKQMKGHGKNP----- 724

Query: 254 DVKIVTNPDEVKFFYVQNADKTTEVFRIRTXXXXXXXXXXXXXXXXXXGISEDEIQEKIK 313
            +  +T   E        AD++  V+ I+                   G  E  +   IK
Sbjct: 725 -IYSITFNKEGNCLVTGGADQSVRVWDIK-RFTNEPGMEPEQQFNTYSGDMELSVNNDIK 782

Query: 314 SSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVF 350
                  + P Q + +SF  K  A  +   ++  LV 
Sbjct: 783 EFGRRRAVIPTQDLMASFHTKKTAIHKVKFTRTNLVL 819

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 45/108 (41%), Gaps = 13/108 (12%)

Query: 41  SSLENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVI 100
           SS +    WDI+TG+ ++       P            V  LE   +   L  G  DG I
Sbjct: 656 SSDKTCRMWDIQTGDSVRLFLGHTSP------------VTALEVSPDGRWLTTGSEDGTI 703

Query: 101 KIWDMQTQTVLIIFNSHTA-AITFLKFDPSGTRLISGSRDSNIIIWDL 147
            +WD+ T   +     H    I  + F+  G  L++G  D ++ +WD+
Sbjct: 704 IVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 100/230 (43%), Gaps = 21/230 (9%)

Query: 458 IVLENKEAAHDAAIWSLDLTSDGRR--LITGSADKTVKFWNFQVEKELISSSTDKYNSRL 515
           +VL      H+  + SL  TS G+   L++ S DKT+  W    + +        +    
Sbjct: 7   LVLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHS 65

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 575
            +V D TL           + +  +   +  D T++++ + + + +    GHK  V+S+D
Sbjct: 66  HIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVD 114

Query: 576 ISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQ------SHNFFSCG 629
           I   + +II+ S DK IK+W +  G C  +L  H D +  V+ VP       S    S G
Sbjct: 115 IDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAG 173

Query: 630 KDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
            D ++K W+  +F      I H S +  L  S DG    S   D  I +W
Sbjct: 174 NDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/327 (22%), Positives = 134/327 (40%), Gaps = 53/327 (16%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNIT-------------------TQSCI 420
           L+GH   V S+  S  + N LL+A+ +  L  W +T                    Q C 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
            T D  YAL   +               L+L+D+A+    + +   H + + S+D+    
Sbjct: 73  LTADGAYALSASW------------DKTLRLWDVATGETYQ-RFVGHKSDVMSVDIDKKA 119

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
             +I+GS DKT+K W  + +        + + S++++V +   +  +D +++  +  D+ 
Sbjct: 120 SMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD--DDSVTIISAGNDKM 177

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
                    VK + L+  +      GH   + ++  S D  LI ++  D  I +W L   
Sbjct: 178 ---------VKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAK 228

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKY-------WDGVKFDCIQKLIAHKS 653
               +L A QD + ++ F P  +   +    G+  +        D ++ +      A + 
Sbjct: 229 KAMYTLSA-QDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEP 287

Query: 654 EVWALALSSDGQFFVSVSHDRSIRVWE 680
              +LA S+DGQ   +   D  IRVW+
Sbjct: 288 HAVSLAWSADGQTLFAGYTDNVIRVWQ 314

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (46%), Gaps = 10/145 (6%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  +++WD+ T      F  H + +  +  D   + +ISGSRD  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 157 RSHKDSITGIWF-----ENDD--WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             H D ++ +        +DD   +IS   D ++K W++   Q     + H +   +L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 210 SDD--LVVTANADSELKIWELDLER 232
           S D  L+ +A  D E+ +W L  ++
Sbjct: 205 SPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
           +++AG  D ++K W++    +   F  H + I  L   P GT + S  +D  I++W+L  
Sbjct: 169 IISAGN-DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAA 227

Query: 150 EVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
           +  +  L +  +  +  +  N  WL + +  G IKV+ +  Q  V+
Sbjct: 228 KKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 38.9 bits (89), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 10/125 (8%)

Query: 114 FNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEND-D 172
           F  H+  +        G   +S S D  + +WD+       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 173 WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI-----SDD---LVVTANADSELK 224
            +IS S+D  IKVW IK  QC+ T + H      + +     +DD    +++A  D  +K
Sbjct: 121 MIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 225 IWELD 229
            W L+
Sbjct: 180 AWNLN 184

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 60/136 (44%), Gaps = 12/136 (8%)

Query: 105 MQTQTVLII---FNSHTAAITFLKFDPSGTRLI-SGSRDSNIIIWDLVGE-----VGLCK 155
           M +  VL++      H   +T L        L+ S SRD  +I W L G+     V +  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS 60

Query: 156 LRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISD--D 212
            + H   +       D  + +S S D  +++WD+ + +  +  + H ++  S+ I     
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 213 LVVTANADSELKIWEL 228
           ++++ + D  +K+W +
Sbjct: 121 MIISGSRDKTIKVWTI 136

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 48/243 (19%), Positives = 95/243 (39%), Gaps = 20/243 (8%)

Query: 44  ENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIW 103
           + +  WD+ TG   +                  ++V  ++   + +++ +G  D  IK+W
Sbjct: 87  KTLRLWDVATGETYQRF------------VGHKSDVMSVDIDKKASMIISGSRDKTIKVW 134

Query: 104 DMQTQTVLIIFN-----SHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRS 158
            ++ Q +  +       S    +   K D     +IS   D  +  W+L           
Sbjct: 135 TIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIG 194

Query: 159 HKDSITGIWFENDDWLI-STSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTA 217
           H  +I  +    D  LI S  KDG I +W++ +++ + T ++   E +SLA S +    A
Sbjct: 195 HNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYT-LSAQDEVFSLAFSPNRYWLA 253

Query: 218 NADSE-LKIWELDLERENGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTT 276
            A +  +K++ LD +        E   Y K +   +V +    +   +   Y  N  +  
Sbjct: 254 AATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVW 313

Query: 277 EVF 279
           +V 
Sbjct: 314 QVM 316

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 100/230 (43%), Gaps = 21/230 (9%)

Query: 458 IVLENKEAAHDAAIWSLDLTSDGRR--LITGSADKTVKFWNFQVEKELISSSTDKYNSRL 515
           +VL      H+  + SL  TS G+   L++ S DKT+  W    + +        +    
Sbjct: 7   LVLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHS 65

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 575
            +V D TL           + +  +   +  D T++++ + + + +    GHK  V+S+D
Sbjct: 66  HIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVD 114

Query: 576 ISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQ------SHNFFSCG 629
           I   + +II+ S DK IK+W +  G C  +L  H D +  V+ VP       S    S G
Sbjct: 115 IDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAG 173

Query: 630 KDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
            D ++K W+  +F      I H S +  L  S DG    S   D  I +W
Sbjct: 174 NDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/327 (22%), Positives = 134/327 (40%), Gaps = 53/327 (16%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNIT-------------------TQSCI 420
           L+GH   V S+  S  + N LL+A+ +  L  W +T                    Q C 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
            T D  YAL   +               L+L+D+A+    + +   H + + S+D+    
Sbjct: 73  LTADGAYALSASW------------DKTLRLWDVATGETYQ-RFVGHKSDVMSVDIDKKA 119

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
             +I+GS DKT+K W  + +        + + S++++V +   +  +D +++  +  D+ 
Sbjct: 120 SMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD--DDSVTIISAGNDKM 177

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
                    VK + L+  +      GH   + ++  S D  LI ++  D  I +W L   
Sbjct: 178 ---------VKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAK 228

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKY-------WDGVKFDCIQKLIAHKS 653
               +L A QD + ++ F P  +   +    G+  +        D ++ +      A + 
Sbjct: 229 KAMYTLSA-QDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEP 287

Query: 654 EVWALALSSDGQFFVSVSHDRSIRVWE 680
              +LA S+DGQ   +   D  IRVW+
Sbjct: 288 HAVSLAWSADGQTLFAGYTDNVIRVWQ 314

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (46%), Gaps = 10/145 (6%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  +++WD+ T      F  H + +  +  D   + +ISGSRD  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 157 RSHKDSITGIWF-----ENDD--WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             H D ++ +        +DD   +IS   D ++K W++   Q     + H +   +L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 210 SDD--LVVTANADSELKIWELDLER 232
           S D  L+ +A  D E+ +W L  ++
Sbjct: 205 SPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
           +++AG  D ++K W++    +   F  H + I  L   P GT + S  +D  I++W+L  
Sbjct: 169 IISAGN-DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAA 227

Query: 150 EVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
           +  +  L +  +  +  +  N  WL + +  G IKV+ +  Q  V+
Sbjct: 228 KKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 38.9 bits (89), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 10/125 (8%)

Query: 114 FNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEND-D 172
           F  H+  +        G   +S S D  + +WD+       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 173 WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI-----SDD---LVVTANADSELK 224
            +IS S+D  IKVW IK  QC+ T + H      + +     +DD    +++A  D  +K
Sbjct: 121 MIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 225 IWELD 229
            W L+
Sbjct: 180 AWNLN 184

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 60/136 (44%), Gaps = 12/136 (8%)

Query: 105 MQTQTVLII---FNSHTAAITFLKFDPSGTRLI-SGSRDSNIIIWDLVGE-----VGLCK 155
           M +  VL++      H   +T L        L+ S SRD  +I W L G+     V +  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS 60

Query: 156 LRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISD--D 212
            + H   +       D  + +S S D  +++WD+ + +  +  + H ++  S+ I     
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 213 LVVTANADSELKIWEL 228
           ++++ + D  +K+W +
Sbjct: 121 MIISGSRDKTIKVWTI 136

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 48/243 (19%), Positives = 95/243 (39%), Gaps = 20/243 (8%)

Query: 44  ENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIW 103
           + +  WD+ TG   +                  ++V  ++   + +++ +G  D  IK+W
Sbjct: 87  KTLRLWDVATGETYQRF------------VGHKSDVMSVDIDKKASMIISGSRDKTIKVW 134

Query: 104 DMQTQTVLIIFN-----SHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRS 158
            ++ Q +  +       S    +   K D     +IS   D  +  W+L           
Sbjct: 135 TIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIG 194

Query: 159 HKDSITGIWFENDDWLI-STSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTA 217
           H  +I  +    D  LI S  KDG I +W++ +++ + T ++   E +SLA S +    A
Sbjct: 195 HNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYT-LSAQDEVFSLAFSPNRYWLA 253

Query: 218 NADSE-LKIWELDLERENGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTT 276
            A +  +K++ LD +        E   Y K +   +V +    +   +   Y  N  +  
Sbjct: 254 AATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVW 313

Query: 277 EVF 279
           +V 
Sbjct: 314 QVM 316

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 100/230 (43%), Gaps = 21/230 (9%)

Query: 458 IVLENKEAAHDAAIWSLDLTSDGRR--LITGSADKTVKFWNFQVEKELISSSTDKYNSRL 515
           +VL      H+  + SL  TS G+   L++ S DKT+  W    + +        +    
Sbjct: 7   LVLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHS 65

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 575
            +V D TL           + +  +   +  D T++++ + + + +    GHK  V+S+D
Sbjct: 66  HIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVD 114

Query: 576 ISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQ------SHNFFSCG 629
           I   + +II+ S DK IK+W +  G C  +L  H D +  V+ VP       S    S G
Sbjct: 115 IDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAG 173

Query: 630 KDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
            D ++K W+  +F      I H S +  L  S DG    S   D  I +W
Sbjct: 174 NDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/327 (22%), Positives = 134/327 (40%), Gaps = 53/327 (16%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNIT-------------------TQSCI 420
           L+GH   V S+  S  + N LL+A+ +  L  W +T                    Q C 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
            T D  YAL   +               L+L+D+A+    + +   H + + S+D+    
Sbjct: 73  LTADGAYALSASW------------DKTLRLWDVATGETYQ-RFVGHKSDVMSVDIDKKA 119

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
             +I+GS DKT+K W  + +        + + S++++V +   +  +D +++  +  D+ 
Sbjct: 120 SMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD--DDSVTIISAGNDKM 177

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
                    VK + L+  +      GH   + ++  S D  LI ++  D  I +W L   
Sbjct: 178 ---------VKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAK 228

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKY-------WDGVKFDCIQKLIAHKS 653
               +L A QD + ++ F P  +   +    G+  +        D ++ +      A + 
Sbjct: 229 KAMYTLSA-QDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEP 287

Query: 654 EVWALALSSDGQFFVSVSHDRSIRVWE 680
              +LA S+DGQ   +   D  IRVW+
Sbjct: 288 HAVSLAWSADGQTLFAGYTDNVIRVWQ 314

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (46%), Gaps = 10/145 (6%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  +++WD+ T      F  H + +  +  D   + +ISGSRD  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 157 RSHKDSITGIWF-----ENDD--WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             H D ++ +        +DD   +IS   D ++K W++   Q     + H +   +L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 210 SDD--LVVTANADSELKIWELDLER 232
           S D  L+ +A  D E+ +W L  ++
Sbjct: 205 SPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
           +++AG  D ++K W++    +   F  H + I  L   P GT + S  +D  I++W+L  
Sbjct: 169 IISAGN-DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAA 227

Query: 150 EVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
           +  +  L +  +  +  +  N  WL + +  G IKV+ +  Q  V+
Sbjct: 228 KKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 38.9 bits (89), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 10/125 (8%)

Query: 114 FNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEND-D 172
           F  H+  +        G   +S S D  + +WD+       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 173 WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI-----SDD---LVVTANADSELK 224
            +IS S+D  IKVW IK  QC+ T + H      + +     +DD    +++A  D  +K
Sbjct: 121 MIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 225 IWELD 229
            W L+
Sbjct: 180 AWNLN 184

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 60/136 (44%), Gaps = 12/136 (8%)

Query: 105 MQTQTVLII---FNSHTAAITFLKFDPSGTRLI-SGSRDSNIIIWDLVGE-----VGLCK 155
           M +  VL++      H   +T L        L+ S SRD  +I W L G+     V +  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS 60

Query: 156 LRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISD--D 212
            + H   +       D  + +S S D  +++WD+ + +  +  + H ++  S+ I     
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 213 LVVTANADSELKIWEL 228
           ++++ + D  +K+W +
Sbjct: 121 MIISGSRDKTIKVWTI 136

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 48/243 (19%), Positives = 95/243 (39%), Gaps = 20/243 (8%)

Query: 44  ENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIW 103
           + +  WD+ TG   +                  ++V  ++   + +++ +G  D  IK+W
Sbjct: 87  KTLRLWDVATGETYQRF------------VGHKSDVMSVDIDKKASMIISGSRDKTIKVW 134

Query: 104 DMQTQTVLIIFN-----SHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRS 158
            ++ Q +  +       S    +   K D     +IS   D  +  W+L           
Sbjct: 135 TIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIG 194

Query: 159 HKDSITGIWFENDDWLI-STSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTA 217
           H  +I  +    D  LI S  KDG I +W++ +++ + T ++   E +SLA S +    A
Sbjct: 195 HNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYT-LSAQDEVFSLAFSPNRYWLA 253

Query: 218 NADSE-LKIWELDLERENGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTT 276
            A +  +K++ LD +        E   Y K +   +V +    +   +   Y  N  +  
Sbjct: 254 AATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVW 313

Query: 277 EVF 279
           +V 
Sbjct: 314 QVM 316

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 100/230 (43%), Gaps = 21/230 (9%)

Query: 458 IVLENKEAAHDAAIWSLDLTSDGRR--LITGSADKTVKFWNFQVEKELISSSTDKYNSRL 515
           +VL      H+  + SL  TS G+   L++ S DKT+  W    + +        +    
Sbjct: 7   LVLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHS 65

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 575
            +V D TL           + +  +   +  D T++++ + + + +    GHK  V+S+D
Sbjct: 66  HIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVD 114

Query: 576 ISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQ------SHNFFSCG 629
           I   + +II+ S DK IK+W +  G C  +L  H D +  V+ VP       S    S G
Sbjct: 115 IDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAG 173

Query: 630 KDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
            D ++K W+  +F      I H S +  L  S DG    S   D  I +W
Sbjct: 174 NDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLW 223

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/327 (22%), Positives = 134/327 (40%), Gaps = 53/327 (16%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNIT-------------------TQSCI 420
           L+GH   V S+  S  + N LL+A+ +  L  W +T                    Q C 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
            T D  YAL   +               L+L+D+A+    + +   H + + S+D+    
Sbjct: 73  LTADGAYALSASW------------DKTLRLWDVATGETYQ-RFVGHKSDVMSVDIDKKA 119

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
             +I+GS DKT+K W  + +        + + S++++V +   +  +D +++  +  D+ 
Sbjct: 120 SMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKAD--DDSVTIISAGNDKM 177

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
                    VK + L+  +      GH   + ++  S D  LI ++  D  I +W L   
Sbjct: 178 ---------VKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAK 228

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKY-------WDGVKFDCIQKLIAHKS 653
               +L A QD + ++ F P  +   +    G+  +        D ++ +      A + 
Sbjct: 229 KAMYTLSA-QDEVFSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEP 287

Query: 654 EVWALALSSDGQFFVSVSHDRSIRVWE 680
              +LA S+DGQ   +   D  IRVW+
Sbjct: 288 HAVSLAWSADGQTLFAGYTDNVIRVWQ 314

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 68/145 (46%), Gaps = 10/145 (6%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  +++WD+ T      F  H + +  +  D   + +ISGSRD  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 157 RSHKDSITGIWF-----ENDD--WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             H D ++ +        +DD   +IS   D ++K W++   Q     + H +   +L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 210 SDD--LVVTANADSELKIWELDLER 232
           S D  L+ +A  D E+ +W L  ++
Sbjct: 205 SPDGTLIASAGKDGEIMLWNLAAKK 229

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
           +++AG  D ++K W++    +   F  H + I  L   P GT + S  +D  I++W+L  
Sbjct: 169 IISAGN-DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAA 227

Query: 150 EVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
           +  +  L +  +  +  +  N  WL + +  G IKV+ +  Q  V+
Sbjct: 228 KKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 38.9 bits (89), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 10/125 (8%)

Query: 114 FNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEND-D 172
           F  H+  +        G   +S S D  + +WD+       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 173 WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI-----SDD---LVVTANADSELK 224
            +IS S+D  IKVW IK  QC+ T + H      + +     +DD    +++A  D  +K
Sbjct: 121 MIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 225 IWELD 229
            W L+
Sbjct: 180 AWNLN 184

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 60/136 (44%), Gaps = 12/136 (8%)

Query: 105 MQTQTVLII---FNSHTAAITFLKFDPSGTRLI-SGSRDSNIIIWDLVGE-----VGLCK 155
           M +  VL++      H   +T L        L+ S SRD  +I W L G+     V +  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS 60

Query: 156 LRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISD--D 212
            + H   +       D  + +S S D  +++WD+ + +  +  + H ++  S+ I     
Sbjct: 61  FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 213 LVVTANADSELKIWEL 228
           ++++ + D  +K+W +
Sbjct: 121 MIISGSRDKTIKVWTI 136

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 48/243 (19%), Positives = 95/243 (39%), Gaps = 20/243 (8%)

Query: 44  ENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIW 103
           + +  WD+ TG   +                  ++V  ++   + +++ +G  D  IK+W
Sbjct: 87  KTLRLWDVATGETYQRF------------VGHKSDVMSVDIDKKASMIISGSRDKTIKVW 134

Query: 104 DMQTQTVLIIFN-----SHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRS 158
            ++ Q +  +       S    +   K D     +IS   D  +  W+L           
Sbjct: 135 TIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIG 194

Query: 159 HKDSITGIWFENDDWLI-STSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTA 217
           H  +I  +    D  LI S  KDG I +W++ +++ + T ++   E +SLA S +    A
Sbjct: 195 HNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYT-LSAQDEVFSLAFSPNRYWLA 253

Query: 218 NADSE-LKIWELDLERENGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTT 276
            A +  +K++ LD +        E   Y K +   +V +    +   +   Y  N  +  
Sbjct: 254 AATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRVW 313

Query: 277 EVF 279
           +V 
Sbjct: 314 QVM 316

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 104/247 (42%), Gaps = 22/247 (8%)

Query: 458 IVLENKEAAHDAAIWSLDLTSDGRR--LITGSADKTVKFWNFQVEKELISSSTDKYNSRL 515
           +VL      H+  + SL  TS G+   L++GS DKT+  W    + +        +    
Sbjct: 7   LVLRGTLEGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHS 65

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSL-LDNTVKVFFLDSMKFFLSLYGHKLPVLSI 574
            +V D TL             +D   A+S   D T++++ + + + +    GHK  V+S+
Sbjct: 66  HIVQDCTLT------------QDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV 113

Query: 575 DISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN-----FFSCG 629
            I   + +II+ S DK IK+W +  G C  +L  H D +  V+  P   N       S G
Sbjct: 114 AIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAG 172

Query: 630 KDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLE 689
            D ++K W+  +F      + H   V  +  S DG    S   D  I +W   E +    
Sbjct: 173 NDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYT 232

Query: 690 EEREKEM 696
              + E+
Sbjct: 233 LSAQDEV 239

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  +++WD+ T      F  H + +  +  D   + +ISGSRD  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 157 RSHKDSITGIWF----ENDD--WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAIS 210
             H D ++ +      +NDD   +IS   D ++K W++   Q     + H     ++  S
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTAS 204

Query: 211 DD--LVVTANADSELKIWEL 228
            D  L+ +A  D E+ +W L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 77/340 (22%), Positives = 129/340 (37%), Gaps = 80/340 (23%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNIT-------------------TQSCI 420
           L+GH   V S+  S  + N LL+ + +  L  W +T                    Q C 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
            T D  YAL   +               L+L+D+A+    + +   H + + S+ +    
Sbjct: 73  LTQDGAYALSASW------------DKTLRLWDVATGETYQ-RFVGHKSDVMSVAIDRKA 119

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
             +I+GS DKT+K W     K    ++   +N  +  V     +  +D ++V  +  D+ 
Sbjct: 120 SMIISGSRDKTIKVWTI---KGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKM 176

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
                    VK + L+  +      GH   V ++  S D  LI ++  D  I +W L   
Sbjct: 177 ---------VKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEK 227

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYW------DGVKFDCI--QKLI--- 649
               +L A QD +  + F P              +YW       G+K  C+  Q L+   
Sbjct: 228 KAMYTLSA-QDEVFALAFSPN-------------RYWLAAATASGIKIFCLDPQSLVDDL 273

Query: 650 ---------AHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
                    + +    +LA S+DGQ   +   D  IRVW+
Sbjct: 274 RPEFAGYNKSAEPHAVSLAWSADGQTLFAGYTDSVIRVWQ 313

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 62/136 (45%), Gaps = 12/136 (8%)

Query: 105 MQTQTVLII---FNSHTAAITFLKFDPSGTRLI-SGSRDSNIIIWDLVGE-----VGLCK 155
           M +  VL++      H   +T L        L+ SGSRD  +I W L G+     V +  
Sbjct: 1   MSSNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRS 60

Query: 156 LRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI--SDD 212
            + H   +       D  + +S S D  +++WD+ + +  +  + H ++  S+AI     
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKAS 120

Query: 213 LVVTANADSELKIWEL 228
           ++++ + D  +K+W +
Sbjct: 121 MIISGSRDKTIKVWTI 136

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 65/156 (41%), Gaps = 14/156 (8%)

Query: 87  ETNLLAAGYADGVIKIW-----DMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           + NLL +G  D  +  W     D +    +  F  H+  +        G   +S S D  
Sbjct: 29  QPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKT 88

Query: 142 IIIWDLVGEVGLCKLRSHKDSITGIWFEND-DWLISTSKDGLIKVWDIKSQQCVETHMAH 200
           + +WD+       +   HK  +  +  +     +IS S+D  IKVW IK  QC+ T + H
Sbjct: 89  LRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKG-QCLATLLGH 147

Query: 201 TTECWSLAIS-----DD--LVVTANADSELKIWELD 229
                 + I+     DD   V++A  D  +K W L+
Sbjct: 148 NDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLN 183

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 45/99 (45%), Gaps = 1/99 (1%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D ++K W++    +   F  H   +  +   P GT + S  +D  I++W+L  +  +  L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL 233

Query: 157 RSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
            +  +     +  N  WL + +  G IK++ +  Q  V+
Sbjct: 234 SAQDEVFALAFSPNRYWLAAATASG-IKIFCLDPQSLVD 271

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/219 (19%), Positives = 89/219 (40%), Gaps = 21/219 (9%)

Query: 44  ENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIW 103
           + +  WD+ TG   +                  ++V  +    + +++ +G  D  IK+W
Sbjct: 87  KTLRLWDVATGETYQRF------------VGHKSDVMSVAIDRKASMIISGSRDKTIKVW 134

Query: 104 DMQTQTVLIIFNSHTAAITFLKFDPS-----GTRLISGSRDSNIIIWDLVGEVGLCKLRS 158
            ++ Q +  +   H   ++ ++  P+        +IS   D  +  W+L           
Sbjct: 135 TIKGQCLATLLG-HNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVG 193

Query: 159 HKDSITGIWFENDDWLI-STSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLV-VT 216
           H  ++  +    D  LI S  KDG I +W++  ++ + T ++   E ++LA S +   + 
Sbjct: 194 HNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYT-LSAQDEVFALAFSPNRYWLA 252

Query: 217 ANADSELKIWELDLERENGSKLKEKGIYEKQSRQRSVDV 255
           A   S +KI+ LD +        E   Y K +   +V +
Sbjct: 253 AATASGIKIFCLDPQSLVDDLRPEFAGYNKSAEPHAVSL 291

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 120/293 (40%), Gaps = 24/293 (8%)

Query: 397 DNKLLAAAS-NGMLKIWNITTQSCIRTFDCGY-----ALCCKFLPXXXXXXXXXXXXELQ 450
           DN L A  S  G +KI +  T   I   + G+      L                  ++ 
Sbjct: 197 DNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIH 256

Query: 451 LFDLASSIVLE-NKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTD 509
            FD    I+ E      H   + ++D    GR + + S D T + W+ + E EL      
Sbjct: 257 SFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETEL------ 310

Query: 510 KYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKL 569
               + Q  H      G+++ S+    +   L    LDN   V+ + + K  ++L GH  
Sbjct: 311 ----QFQEGH------GKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAK 360

Query: 570 PVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQS-HNFFSC 628
           P+ S+D S D   I T   D  I IW +        L AH + +  V+F   + H   SC
Sbjct: 361 PIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSC 420

Query: 629 GKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEE 681
           G D  I+ +    +  ++ L  H  ++  + +S D Q  VS   DRS+++W++
Sbjct: 421 GYDKQIRIYSSDNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQ 473

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 76/154 (49%), Gaps = 4/154 (2%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           EV  L + ++  LL +G  D    +WD++T   ++    H   I  + + P G  + +G 
Sbjct: 319 EVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGG 378

Query: 138 RDSNIIIWDLVGEVGLCKLRSHKDSITGIWFE--NDDWLISTSKDGLIKVWDIKSQQCVE 195
            D  I IWD+       +L +H + +TG+ F+      L+S   D  I+++   +   V+
Sbjct: 379 GDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 196 THMAHTTECWSLAISDD--LVVTANADSELKIWE 227
           T   HT +   + IS+D  L+V++  D  LK+W+
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWK 472

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
             V  +++H     +A+   D   ++WD++++T L     H   +  L F   G  L SG
Sbjct: 276 GRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSG 335

Query: 137 SRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLIST-SKDGLIKVWDIKSQQCVE 195
             D+  I+WD+     +  L+ H   I  + +  D + I+T   DG+I +WDI+      
Sbjct: 336 GLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETT 395

Query: 196 THMAHTTECWSLAI---SDDLVVTANADSELKIWELD 229
             +AH      +     +   +V+   D +++I+  D
Sbjct: 396 RLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSD 432

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 98/219 (44%), Gaps = 23/219 (10%)

Query: 382 LQGHRTDVRSIDISEDNKLLAAASNGML-KIWNITTQSCIRTFDCGYA---LCCKFLPXX 437
           LQGH   V ++D     + +A+AS  M  ++W+I +++ ++ F  G+        F    
Sbjct: 271 LQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQ-FQEGHGKEVYSLSFQNDG 329

Query: 438 XXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNF 497
                        ++D+ +   + N +  H   I+S+D + DG  + TG  D  +  W+ 
Sbjct: 330 ALLCSGGLDNAAIVWDVRTGKSIMNLQG-HAKPIYSVDWSPDGYHIATGGGDGVINIWDI 388

Query: 498 QVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSL-LDNTVKVFFLD 556
           +   E          +RL + H+        +  V+         VS   D  ++++  D
Sbjct: 389 RKTTE---------TTRL-LAHNNI------VTGVRFQKSTGHCLVSCGYDKQIRIYSSD 432

Query: 557 SMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIW 595
           +     +L GH   +L +DIS D++LI++S  D+++K+W
Sbjct: 433 NWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 68/159 (42%), Gaps = 7/159 (4%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIW----DMQTQTVLIIFNSHTAAITFLKFDPSGTR 132
            ++  L ++     L +G  D ++KI     D++    L     HT  +  + F PSG  
Sbjct: 230 GKIGGLAWNSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRF 289

Query: 133 LISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLI-STSKDGLIKVWDIKSQ 191
           + S S D    +WD+  E  L     H   +  + F+ND  L+ S   D    VWD+++ 
Sbjct: 290 VASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVWDVRTG 349

Query: 192 QCVETHMAHTTECWSLAISDD--LVVTANADSELKIWEL 228
           + +     H    +S+  S D   + T   D  + IW++
Sbjct: 350 KSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDI 388

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 72/147 (48%), Gaps = 8/147 (5%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLI-IFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLV 148
           L A G   G IKI D +T  V+  I N H   I  L ++ + T L+SG+ D  + I    
Sbjct: 200 LCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFD 259

Query: 149 GEVGLCK----LRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTE 203
            +V + K    L+ H   +  + F  +  ++ S S D   ++WDI+S+  ++    H  E
Sbjct: 260 PDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKE 319

Query: 204 CWSLAISDD--LVVTANADSELKIWEL 228
            +SL+  +D  L+ +   D+   +W++
Sbjct: 320 VYSLSFQNDGALLCSGGLDNAAIVWDV 346

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 93/216 (43%), Gaps = 17/216 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   ++S   + D R L++ S DKTV+ W+      L+S     Y      V D     
Sbjct: 549 GHSGTVYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVS-----YKGHNHPVWD----- 598

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
                 VK SP   + A +  D+T +++  D +       GH   V  +    +   + T
Sbjct: 599 ------VKFSPLGHYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFT 652

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S+DK  ++W +  GDC R        +++    P      +  +DG+I  WD      +
Sbjct: 653 GSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRL 712

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +++  H K+ +++LA   +G   +S   D S+RVW+
Sbjct: 713 KQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWD 748

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 90/210 (42%), Gaps = 7/210 (3%)

Query: 473 SLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGED--IL 530
           SL+ + D R    G  D  +K ++        S   ++Y+  L     +   +G    + 
Sbjct: 501 SLEFSDDCRLAAAGFQDSQIKLFSLDG-----SPLGNRYDPDLPEDATSKTLVGHSGTVY 555

Query: 531 SVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADK 590
           S   SP++R+L  S  D TV+++ LD+    +S  GH  PV  +  S       T+S D 
Sbjct: 556 STSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDH 615

Query: 591 NIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIA 650
             ++W  D     R    H + +  V F P     F+   D   + WD    DC++  + 
Sbjct: 616 TARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLG 675

Query: 651 HKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
             + V +  +S DG++  + S D  I VW+
Sbjct: 676 LTAPVISTCVSPDGRWLSTGSEDGIINVWD 705

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 92/210 (43%), Gaps = 26/210 (12%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLV-G 149
            A    D   ++W       L IF  H   +  + F P+G  L +GS D    +WD+  G
Sbjct: 608 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATG 667

Query: 150 EVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTEC-WSLA 208
           +     L      I+     +  WL + S+DG+I VWDI + + ++    H     +SLA
Sbjct: 668 DCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLA 727

Query: 209 I--SDDLVVTANADSELKIWEL-DLERENGSKLKEKGI-------------YEKQSRQRS 252
                + +++  AD  +++W+L     E+G + ++  +              ++  R+R+
Sbjct: 728 YCKEGNALISGGADHSVRVWDLKKATTESGPEPEQAFVGYLGDVTGSINQDIKEYGRRRT 787

Query: 253 VDVKIVTNPDEVKFFYVQNADKTTEVFRIR 282
           V   I TN D V  FY     K T VF+++
Sbjct: 788 V---IPTN-DLVASFYT----KKTPVFKVK 809

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 65/153 (42%), Gaps = 7/153 (4%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
           L +   D  +++W + T + L+ +  H   +  +KF P G    + S D    +W     
Sbjct: 566 LVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTARLWSCDHI 625

Query: 151 VGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             L     H + +  + F  N  +L + S D   ++WDI +  CV   +  T    S  +
Sbjct: 626 YPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCV 685

Query: 210 SDDL--VVTANADSELKIWELDLERENGSKLKE 240
           S D   + T + D  + +W++      G +LK+
Sbjct: 686 SPDGRWLSTGSEDGIINVWDIG----TGKRLKQ 714

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +V  + +H     L  G +D   ++WD+ T   + +F   TA +      P G  L +GS
Sbjct: 637 DVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGS 696

Query: 138 RDSNIIIWDLVGEVGLCKLRSH-KDSITGIWF-ENDDWLISTSKDGLIKVWDIK 189
            D  I +WD+     L ++R H K++I  + + +  + LIS   D  ++VWD+K
Sbjct: 697 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLK 750

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 62/152 (40%), Gaps = 11/152 (7%)

Query: 384 GHRTDVRSIDISEDN-KLLAAASNGMLKIWNITTQSCIRTFDCGYALCCKFL-----PXX 437
           GH  DV  +    +   L   +S+   ++W+I T  C+R F     L    +     P  
Sbjct: 633 GHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLF---LGLTAPVISTCVSPDG 689

Query: 438 XXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNF 497
                      + ++D+ +   L+        AI+SL    +G  LI+G AD +V+ W+ 
Sbjct: 690 RWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDL 749

Query: 498 QVEKELISSSTDKYNSRLQMVHDTTLELGEDI 529
           +  K    S  +   + +  + D T  + +DI
Sbjct: 750 K--KATTESGPEPEQAFVGYLGDVTGSINQDI 779

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 46/104 (44%), Gaps = 24/104 (23%)

Query: 11  RSFFGVIASN-SNCVWIPTEGSRTSP-GQIITSSLEN--INCWDIKTGNLLKTLSDSIPP 66
           R F G+ A   S CV         SP G+ +++  E+  IN WDI TG  LK +      
Sbjct: 671 RLFLGLTAPVISTCV---------SPDGRWLSTGSEDGIINVWDIGTGKRLKQM------ 715

Query: 67  GSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTV 110
                +      +  L Y  E N L +G AD  +++WD++  T 
Sbjct: 716 -----RGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLKKATT 754

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 91/216 (42%), Gaps = 17/216 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   ++S   + D R L++ S DKTV+ W           STD Y S +          
Sbjct: 480 GHSGTVYSTAFSPDNRYLLSASEDKTVRLW-----------STDTYTSLVSYKGHN---- 524

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
              I  V  SP   + A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 525 -HPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFT 583

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S+DK  ++W +  GD  R    H   +      P      +  +DG+I  WD      +
Sbjct: 584 GSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRL 643

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +++  H K+ V++L+ S +G   VS   D S+RVW+
Sbjct: 644 KQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD 679

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 96/216 (44%), Gaps = 9/216 (4%)

Query: 468 DAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEK---ELISSSTDKYNSRLQMVHDTTLE 524
           ++ + SL+ + D R    G  D  VK W+   E    +L S   ++ N+   + H  T  
Sbjct: 427 NSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGT-- 484

Query: 525 LGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLII 584
               + S   SP++R+L  +  D TV+++  D+    +S  GH  P+  +  S       
Sbjct: 485 ----VYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFA 540

Query: 585 TSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDC 644
           T+S D+  ++W  D     R    H + +  V F P     F+   D   + WD    D 
Sbjct: 541 TASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDS 600

Query: 645 IQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           ++  + H + V A A+S DG++  + S D  I VW+
Sbjct: 601 VRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWD 636

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 95/219 (43%), Gaps = 21/219 (9%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +VA+    H     A    D   ++W       L IF  H   +  + F P+GT + +GS
Sbjct: 529 DVAFSPLGH---YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGS 585

Query: 138 RDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVET 196
            D    +WD+     +     H   +T      D  WL + S+DG+I VWDI + + ++ 
Sbjct: 586 SDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQ 645

Query: 197 HMAHTTEC-WSLAISDD--LVVTANADSELKIWELDLER-ENGSKLKEKGIYEKQSRQRS 252
              H     +SL+ S +  ++V+  AD  L++W++     E GS+ ++           S
Sbjct: 646 MRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVKKSTAEPGSEPEQPFTSFSGDVTTS 705

Query: 253 V--DVK-------IVTNPDEVKFFYVQNADKTTEVFRIR 282
           V  D+K       IV   D V  FY     K T VF+++
Sbjct: 706 VNQDIKEYGRRRTIVPTSDLVASFYT----KKTPVFKVK 740

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 91/218 (41%), Gaps = 21/218 (9%)

Query: 382 LQGHRTDVRSIDISEDNK-LLAAASNGMLKIWNITTQSCIRTFDCGYALC--CKFLPXXX 438
           L GH   V S   S DN+ LL+A+ +  +++W+  T + + ++           F P   
Sbjct: 478 LVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGH 537

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQ 498
                      +L+     I      A H   + ++    +G  + TGS+DKT + W+  
Sbjct: 538 YFATASHDQTARLWS-CDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMS 596

Query: 499 VEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSM 558
               +          RL + H         + +  +SP+ R+L+    D  + V+ + + 
Sbjct: 597 TGDSV----------RLFLGHTAP------VTATAVSPDGRWLSTGSEDGIINVWDIGTG 640

Query: 559 KFFLSLYGH-KLPVLSIDISYDSKLIITSSADKNIKIW 595
           K    + GH K  V S+  S +  ++++  AD ++++W
Sbjct: 641 KRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVW 678

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/242 (18%), Positives = 82/242 (33%), Gaps = 62/242 (25%)

Query: 57  LKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNS 116
           L  L  S P   +   +   +E+  LE+  +  L +AG+ D ++KIW +  + +     S
Sbjct: 408 LDNLQSSAPSVCMYTFHNTNSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPS 467

Query: 117 -------------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSI 163
                        H+  +    F P    L+S S D  + +W       L   + H   I
Sbjct: 468 KQDERSNNATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPI 527

Query: 164 TGIWF-------------------------------------------ENDDWLISTSKD 180
             + F                                            N  ++ + S D
Sbjct: 528 WDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSD 587

Query: 181 GLIKVWDIKSQQCVETHMAHTTECWSLAISDDL--VVTANADSELKIWELDLERENGSKL 238
              ++WD+ +   V   + HT    + A+S D   + T + D  + +W++      G +L
Sbjct: 588 KTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIG----TGKRL 643

Query: 239 KE 240
           K+
Sbjct: 644 KQ 645

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 14/87 (16%)

Query: 27  PTEGSRTSP-GQIITSSLEN--INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLE 83
           P   +  SP G+ +++  E+  IN WDI TG  LK +           +      V  L 
Sbjct: 610 PVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQM-----------RGHGKNAVYSLS 658

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTV 110
           Y  E ++L +G AD  +++WD++  T 
Sbjct: 659 YSKEGHVLVSGGADHSLRVWDVKKSTA 685

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 93/216 (43%), Gaps = 17/216 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   +++   + D + L++GS DKTV+ W+      L+S     Y      V D     
Sbjct: 525 GHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVS-----YKGHNHPVWD----- 574

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
                 V  SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 575 ------VNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 628

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S+DK  ++W +  GD  R    H   ++ +   P      +  +DG+I  WD      +
Sbjct: 629 GSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRL 688

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +++  H K+ +++L+ S +G   +S   D S+RVW+
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 92/212 (43%), Gaps = 5/212 (2%)

Query: 474 LDLTSDGRRLITGSADKTVKFWNFQVEK-ELISSSTDKYNSRLQMVHDTTLE--LGED-- 528
           LD + D R    G  D  +K W+         +   +  NS  +   D T +  +G    
Sbjct: 470 LDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDHKDADDPTCKTLVGHSGT 529

Query: 529 ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSA 588
           + +   SP++++L     D TV+++ +D+    +S  GH  PV  ++ S       T+S 
Sbjct: 530 VYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASH 589

Query: 589 DKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKL 648
           D+  ++W  D     R    H + +  V F P     F+   D   + WD    D ++  
Sbjct: 590 DQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLF 649

Query: 649 IAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           + H + V  +A+S DG++  + S D  I +W+
Sbjct: 650 LGHTAPVICIAVSPDGRWLSTGSEDGIINIWD 681

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 66/153 (43%), Gaps = 7/153 (4%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
           L +G  D  +++W M T T L+ +  H   +  + F P G    + S D    +W     
Sbjct: 542 LLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWSCDHI 601

Query: 151 VGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             L     H + +  + F  N  ++ + S D   ++WD+ +   V   + HT     +A+
Sbjct: 602 YPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAV 661

Query: 210 SDDL--VVTANADSELKIWELDLERENGSKLKE 240
           S D   + T + D  + IW++      G +LK+
Sbjct: 662 SPDGRWLSTGSEDGIINIWDIG----TGKRLKQ 690

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 87/206 (42%), Gaps = 18/206 (8%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A    D   ++W       L IF  H   +  + F P+G  + +GS D    +WD+   
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 643

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTEC-WSLA 208
             +     H   +  I    D  WL + S+DG+I +WDI + + ++    H     +SL+
Sbjct: 644 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 209 IS--DDLVVTANADSELKIWELDLERENGSKLKEK---GIYEKQSRQRSVDVK------- 256
            S   +++++  AD  +++W+L       S   E+   G     +   + D+K       
Sbjct: 704 YSKEGNVLISGGADHSVRVWDLKKATTEPSAEPEEPFIGYLGDVTASINQDIKEYGRRRT 763

Query: 257 IVTNPDEVKFFYVQNADKTTEVFRIR 282
           ++   D V  FY     K T VF+++
Sbjct: 764 VIPTSDLVASFYT----KKTPVFKVK 785

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 2/114 (1%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +V  + +H     +  G +D   ++WD+ T   + +F  HTA +  +   P G  L +GS
Sbjct: 613 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGS 672

Query: 138 RDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFEND-DWLISTSKDGLIKVWDIK 189
            D  I IWD+     L ++R H K++I  + +  + + LIS   D  ++VWD+K
Sbjct: 673 EDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/175 (19%), Positives = 72/175 (41%), Gaps = 6/175 (3%)

Query: 359 YYSIPYKNQKPTQVAASKLYTIEL-QGHRTDVRSIDISEDN-KLLAAASNGMLKIWNITT 416
           Y++    +Q     +   +Y + +  GH  DV  +    +   +   +S+   ++W+++T
Sbjct: 583 YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVST 642

Query: 417 QSCIRTF--DCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSL 474
              +R F       +C    P             + ++D+ +   L+        AI+SL
Sbjct: 643 GDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSL 702

Query: 475 DLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDI 529
             + +G  LI+G AD +V+ W+ +  K     S +     +  + D T  + +DI
Sbjct: 703 SYSKEGNVLISGGADHSVRVWDLK--KATTEPSAEPEEPFIGYLGDVTASINQDI 755

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/175 (17%), Positives = 64/175 (36%), Gaps = 24/175 (13%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLI---------------------IFNS 116
           +++ L++  +  + AAG+ D  IKIW +   ++                           
Sbjct: 466 DMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDHKDADDPTCKTLVG 525

Query: 117 HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN-DDWLI 175
           H+  +    F P    L+SGS D  + +W +     L   + H   +  + F     +  
Sbjct: 526 HSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFA 585

Query: 176 STSKDGLIKVWDIKSQQCVETHMAHTT--ECWSLAISDDLVVTANADSELKIWEL 228
           + S D   ++W       +     H    +C S   +   V T ++D   ++W++
Sbjct: 586 TASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 640

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           IN WDI TG  LK +           +      +  L Y  E N+L +G AD  +++WD+
Sbjct: 677 INIWDIGTGKRLKQM-----------RGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

Query: 106 QTQTV 110
           +  T 
Sbjct: 726 KKATT 730

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 114/245 (46%), Gaps = 30/245 (12%)

Query: 462 NKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDT 521
           +K   H + +  +  ++DG+ L TG  +KT + +N     ELI+  +D   S +    ++
Sbjct: 346 HKSLDHTSVVCCVRFSNDGKFLATG-CNKTTQVYNV-ASGELIARLSDDSASHITPGQNS 403

Query: 522 T-LELGED------------------ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFL 562
              E GE+                  I SV  SP+ +FLA    D  ++++ +   K  +
Sbjct: 404 KDSEGGEENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIM 463

Query: 563 SLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQS 622
            L GH+  + S+D     + +++ S D+ ++IW L  G C  +L + +D +  V   P+ 
Sbjct: 464 VLQGHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPED 522

Query: 623 HNFFSCGK-DGVIKYWDGVKFDCIQKL-------IAHKSEVWALALSSDGQFFVSVSHDR 674
             + + G  D  ++ WD      +++L         HK  V+++  + DG   VS S DR
Sbjct: 523 GKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDR 582

Query: 675 SIRVW 679
           S+++W
Sbjct: 583 SVKLW 587

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 133/320 (41%), Gaps = 88/320 (27%)

Query: 389 VRSIDISEDNKLLA-AASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXX 447
           +RS+  S D K LA  A + +++IW+I  +  I                           
Sbjct: 430 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKII--------------------------- 462

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
                     +VL+     H+  I+SLD    G +L++GS D+TV+ W+ +  +  +   
Sbjct: 463 ----------MVLQ----GHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSL--- 505

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISPED-RFLAVSLLDNTVKVFFLDSMKFFLS--- 563
                         TL + + + +V +SPED +++A   LD  V+V+  DS   FL    
Sbjct: 506 --------------TLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVW--DSETGFLVERL 549

Query: 564 ------LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLD-----------FGDCHRSL 606
                   GHK  V S+  + D   +++ S D+++K+W L+            G C  + 
Sbjct: 550 DSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNVPGTCEVTY 609

Query: 607 FAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA------L 660
             H+D +++V          S  KD  + +WD    + +  L  H++ V ++A      L
Sbjct: 610 TGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGHPL 669

Query: 661 SSDGQFFVSVSHDRSIRVWE 680
            ++   F + S D   R+W+
Sbjct: 670 GTEYGVFATGSGDCKARIWK 689

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 77/152 (50%), Gaps = 14/152 (9%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
            LA G  D +I+IWD+  + ++++   H   I  L + PSG +L+SGS D  + IWDL  
Sbjct: 441 FLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDL-- 498

Query: 150 EVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCVET-------HMA 199
             G C L  S +D +T +    +D  ++ + S D  ++VWD ++   VE           
Sbjct: 499 RTGQCSLTLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTG 558

Query: 200 HTTECWSLAISDDL--VVTANADSELKIWELD 229
           H    +S+  + D   VV+ + D  +K+W L+
Sbjct: 559 HKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLN 590

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 98/242 (40%), Gaps = 30/242 (12%)

Query: 374 ASKLYTIELQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALC 430
           A K   + LQGH  D+ S+D      KL++ + +  ++IW++ T  C  T     G    
Sbjct: 457 AQKKIIMVLQGHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTV 516

Query: 431 CKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLI 484
                             ++++D  +  ++E  ++       H  +++S+  T DG  ++
Sbjct: 517 AVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVV 576

Query: 485 TGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELG-----EDILSVKISPEDR 539
           +GS D++VK WN            D  N  L+     T E+      + +LSV  +  D 
Sbjct: 577 SGSLDRSVKLWNL----------NDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDE 626

Query: 540 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIK 593
           ++     D  V  +   S    L L GH+  V+S+ ++    L        T S D   +
Sbjct: 627 YILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKAR 686

Query: 594 IW 595
           IW
Sbjct: 687 IW 688

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/214 (22%), Positives = 92/214 (42%), Gaps = 49/214 (22%)

Query: 46  INCWDIKTGNLLKTLS--DSIPPGSI---DAKYEKPAEVAYLEYHHETNLLAAGYADGVI 100
           +  WD++TG    TLS  D +   ++   D KY                 +AAG  D  +
Sbjct: 493 VRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGKY-----------------IAAGSLDRAV 535

Query: 101 KIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDL------ 147
           ++WD +T  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L      
Sbjct: 536 RVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNK 595

Query: 148 ---VGEVGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETHMAHT 201
                  G C++    HKD +  +   + D++++S SKD  +  WD KS   +     H 
Sbjct: 596 DLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPLLMLQGHR 655

Query: 202 TECWSLAISD--------DLVVTANADSELKIWE 227
               S+A+++         +  T + D + +IW+
Sbjct: 656 NSVISVAVANGHPLGTEYGVFATGSGDCKARIWK 689

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/151 (20%), Positives = 62/151 (41%), Gaps = 21/151 (13%)

Query: 38  IITSSLEN-INCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAG 94
           I   SL+  +  WD +TG L++ L   + +  G  D+ Y        + +  + N + +G
Sbjct: 526 IAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYS-------VVFTRDGNNVVSG 578

Query: 95  YADGVIKIWDMQ-----------TQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
             D  +K+W++              T  + +  H   +  +        ++SGS+D  ++
Sbjct: 579 SLDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVL 638

Query: 144 IWDLVGEVGLCKLRSHKDSITGIWFENDDWL 174
            WD      L  L+ H++S+  +   N   L
Sbjct: 639 FWDTKSGNPLLMLQGHRNSVISVAVANGHPL 669

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 91/216 (42%), Gaps = 17/216 (7%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H  A++S   + D R L++GS DKTV+ W+      L+S     Y      V D     
Sbjct: 547 GHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVS-----YKGHNHPVWD----- 596

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
                 V+ SP   + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 597 ------VQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFT 650

Query: 586 SSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCI 645
            S+DK  ++W +  GD  R    H   ++     P      +  +DG+I  WD      +
Sbjct: 651 GSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRL 710

Query: 646 QKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           + +  H K+ + +L+   +G   VS   D S+RVW+
Sbjct: 711 KVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWD 746

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 101/239 (42%), Gaps = 15/239 (6%)

Query: 457 SIVLENKEAA-----------HDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVE--KEL 503
           SI L+N +AA            +  + SL  + D R +  G  D  +K W+      K++
Sbjct: 465 SIKLDNLQAALPSVCMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQI 524

Query: 504 ISSSTDKYNSRLQMVHDTTLELGED--ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFF 561
              S D  N+     + +T  +G    + S   SP++R+L     D TV+++  D+    
Sbjct: 525 QEKSADSINTGDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSL 584

Query: 562 LSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQ 621
           +S  GH  PV  +  S       T+S D+  ++W  D     R    H   +  V F P 
Sbjct: 585 VSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPN 644

Query: 622 SHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
               F+   D   + WD    D ++  + H + V   A+S DG++  + S D  I +W+
Sbjct: 645 GCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWD 703

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 86/206 (41%), Gaps = 18/206 (8%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
            A    D   ++W       L IF  H + +  + F P+G  + +GS D    +WD+   
Sbjct: 606 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTG 665

Query: 151 VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDI---KSQQCVETHMAHTTECWS 206
             +     H   +       D  WL + S+DG+I +WDI   K  + +  H  +     S
Sbjct: 666 DSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLS 725

Query: 207 LAISDDLVVTANADSELKIWELDLER-ENGSKLKEK--GIYEKQSRQRSVDVK------- 256
                +++V+  AD  +++W+L     E G + +E+  G     +   + D+K       
Sbjct: 726 YCKEGNVLVSGGADHSVRVWDLKKSTAEPGPEPEEQFVGYIGNLTASINQDIKDFGRRRT 785

Query: 257 IVTNPDEVKFFYVQNADKTTEVFRIR 282
           I+ + D V  FY     K T +F ++
Sbjct: 786 IIPSNDLVASFYT----KKTPIFNVK 807

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
           ++V  + +H     +  G +D   ++WD+ T   + +F  HTA +      P G  L +G
Sbjct: 634 SDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATG 693

Query: 137 SRDSNIIIWDLVGEVGLCKLRSH-KDSITGIWF-ENDDWLISTSKDGLIKVWDIK 189
           S D  I +WD+     L  +R H K++I  + + +  + L+S   D  ++VWD+K
Sbjct: 694 SEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 59/141 (41%), Gaps = 3/141 (2%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE 150
           L +G  D  +++W   T T L+ +  H   +  ++F P G    + S D    +W     
Sbjct: 564 LLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHI 623

Query: 151 VGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             L     H   +  + F  N  ++ + S D   ++WDI +   V   + HT      A+
Sbjct: 624 YPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAV 683

Query: 210 SDDL--VVTANADSELKIWEL 228
           S D   + T + D  + +W++
Sbjct: 684 SPDGRWLATGSEDGIINLWDI 704

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 66/173 (38%), Gaps = 29/173 (16%)

Query: 82  LEYHHETNLLAAGYADGVIKIWDM-----------------------QTQTVLIIFNSHT 118
           L++  ++ L+AAG+ D  IK+W +                        T T LI    H+
Sbjct: 493 LQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLI---GHS 549

Query: 119 AAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN-DDWLIST 177
            A+    F P    L+SGS D  + +W       L   + H   +  + F     +  + 
Sbjct: 550 GAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATA 609

Query: 178 SKDGLIKVWDIKSQQCVETHMAHTT--ECWSLAISDDLVVTANADSELKIWEL 228
           S D   ++W       +     H +  +C S   +   V T ++D   ++W++
Sbjct: 610 SHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDI 662

 Score = 35.4 bits (80), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 11/65 (16%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           IN WDI T   LK +           +      +  L Y  E N+L +G AD  +++WD+
Sbjct: 699 INLWDIGTAKRLKVM-----------RGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDL 747

Query: 106 QTQTV 110
           +  T 
Sbjct: 748 KKSTA 752

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 98/217 (45%), Gaps = 18/217 (8%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   ++S   ++    L++ S DKTV+ W+ Q +K L+S     Y    + V D     
Sbjct: 572 GHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVS-----YKGHEKPVWD----- 621

Query: 526 GEDILSVKISPE-DRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLII 584
                 V+ SP  +   A +  D T +++  D +     + GH   V  +    + + I 
Sbjct: 622 ------VEFSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIF 675

Query: 585 TSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDC 644
           T S+DK +++W ++ GD  R    H   + ++   P      +   DG+I  WD      
Sbjct: 676 TGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRK 735

Query: 645 IQKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           ++ +  H KS + +L+ + +G   VS   D+S+RVW+
Sbjct: 736 LKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWD 772

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 98/209 (46%), Gaps = 3/209 (1%)

Query: 473 SLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSV 532
           SL+ +++ +   +G  D  +K W+  ++   +S + +  N+ +     T +     + S 
Sbjct: 523 SLEFSNNYKLAASGFQDSYIKIWS--LDGYPLSENDEMPNNPISSTCKTFIGHSGTVYST 580

Query: 533 KISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYD-SKLIITSSADKN 591
             S  D +L  +  D TV+++ +   K  +S  GH+ PV  ++ S   + L  T+S D+ 
Sbjct: 581 SFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQT 640

Query: 592 IKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAH 651
            ++W  D     R +  H + +  V F       F+   D  ++ WD    D ++  + H
Sbjct: 641 ARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGH 700

Query: 652 KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
            S V +L++S DG++  + S D  I +W+
Sbjct: 701 NSTVTSLSVSPDGKWISTGSDDGIITIWD 729

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 90/207 (43%), Gaps = 35/207 (16%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +V  + +H     +  G +D  +++WD+ T   + +F  H + +T L   P G  + +GS
Sbjct: 661 DVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGKWISTGS 720

Query: 138 RDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVE 195
            D  I IWD+     L  +R H K SI  + +  +   L+S   D  ++VWD+ ++   E
Sbjct: 721 DDGIITIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL-NKGTFE 779

Query: 196 THMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLKEKGIYEKQSRQRSVDV 255
             +    E +   + +D V + N D                 +KE G      R+R+V  
Sbjct: 780 PSLT-PEEVYQGPMGNDNVSSMNQD-----------------IKEYG------RRRTV-- 813

Query: 256 KIVTNPDEVKFFYVQNADKTTEVFRIR 282
            I TN     FF      K T VF+++
Sbjct: 814 -IATNDLLASFFT-----KKTPVFKVK 834

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 68/145 (46%), Gaps = 4/145 (2%)

Query: 89  NLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLV 148
           NL A    D   ++W       L +   H   +  + F  +G  + +GS D  + +WD+ 
Sbjct: 630 NLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSSDKTVRMWDIN 689

Query: 149 GEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAH-TTECWS 206
               +     H  ++T +    D  W+ + S DG+I +WDI S + ++    H  +   S
Sbjct: 690 TGDSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIHS 749

Query: 207 LAISDD--LVVTANADSELKIWELD 229
           L+ + +  L+V+  AD  +++W+L+
Sbjct: 750 LSYNPEGTLLVSGGADQSVRVWDLN 774

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/261 (20%), Positives = 114/261 (43%), Gaps = 34/261 (13%)

Query: 356 TIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISE-DNKLLAAASNGMLKIWNI 414
           +++ Y +   ++ P    +S   T    GH   V S   S  D  LL+A+ +  +++W++
Sbjct: 546 SLDGYPLSENDEMPNNPISSTCKT--FIGHSGTVYSTSFSAGDEYLLSASEDKTVRLWSV 603

Query: 415 TTQSCIRTF--------DCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAA 466
                + ++        D  ++  C  L              L   D    + +    A 
Sbjct: 604 QDDKPLVSYKGHEKPVWDVEFSPSCNNL---FATASNDQTARLWSCDRVYPLRVM---AG 657

Query: 467 HDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELG 526
           H   +  +   S+GR + TGS+DKTV+ W+      +          RL M H++T    
Sbjct: 658 HLNDVDCVSFHSNGRYIFTGSSDKTVRMWDINTGDSV----------RLFMGHNST---- 703

Query: 527 EDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSIDISYDSKLIIT 585
             + S+ +SP+ ++++    D  + ++ + S +   ++ GH K  + S+  + +  L+++
Sbjct: 704 --VTSLSVSPDGKWISTGSDDGIITIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVS 761

Query: 586 SSADKNIKIWGLDFGDCHRSL 606
             AD+++++W L+ G    SL
Sbjct: 762 GGADQSVRVWDLNKGTFEPSL 782

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/252 (19%), Positives = 87/252 (34%), Gaps = 64/252 (25%)

Query: 57  LKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM----------- 105
           +  L  S+P  SI   +     +  LE+ +   L A+G+ D  IKIW +           
Sbjct: 499 MDNLQVSLPSVSIYTFHNTQKNMTSLEFSNNYKLAASGFQDSYIKIWSLDGYPLSENDEM 558

Query: 106 ---QTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHK-- 160
                 +    F  H+  +    F      L+S S D  + +W +  +  L   + H+  
Sbjct: 559 PNNPISSTCKTFIGHSGTVYSTSFSAGDEYLLSASEDKTVRLWSVQDDKPLVSYKGHEKP 618

Query: 161 -------------------DSITGIW-----------------------FENDDWLISTS 178
                              D    +W                         N  ++ + S
Sbjct: 619 VWDVEFSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYIFTGS 678

Query: 179 KDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDL--VVTANADSELKIWELDLERENGS 236
            D  +++WDI +   V   M H +   SL++S D   + T + D  + IW++     +G 
Sbjct: 679 SDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIG----SGR 734

Query: 237 KLKEKGIYEKQS 248
           KLK    + K S
Sbjct: 735 KLKNMRGHGKSS 746

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 13/108 (12%)

Query: 41  SSLENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVI 100
           SS + +  WDI TG+ ++                  + V  L    +   ++ G  DG+I
Sbjct: 678 SSDKTVRMWDINTGDSVRLF------------MGHNSTVTSLSVSPDGKWISTGSDDGII 725

Query: 101 KIWDMQTQTVLIIFNSH-TAAITFLKFDPSGTRLISGSRDSNIIIWDL 147
            IWD+ +   L     H  ++I  L ++P GT L+SG  D ++ +WDL
Sbjct: 726 TIWDIGSGRKLKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 11/64 (17%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDM 105
           I  WDI +G  LK +           +    + +  L Y+ E  LL +G AD  +++WD+
Sbjct: 725 ITIWDIGSGRKLKNM-----------RGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

Query: 106 QTQT 109
              T
Sbjct: 774 NKGT 777

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/147 (19%), Positives = 59/147 (40%), Gaps = 34/147 (23%)

Query: 548 NTVKVFFLDSMKFFL------SLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGD 601
           N    F +D+++  L      + +  +  + S++ S + KL  +   D  IKIW LD   
Sbjct: 492 NATSSFSMDNLQVSLPSVSIYTFHNTQKNMTSLEFSNNYKLAASGFQDSYIKIWSLD--- 548

Query: 602 CHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALS 661
                 +  D + N                      + +   C +  I H   V++ + S
Sbjct: 549 --GYPLSENDEMPN----------------------NPISSTC-KTFIGHSGTVYSTSFS 583

Query: 662 SDGQFFVSVSHDRSIRVWEETEDQVFL 688
           +  ++ +S S D+++R+W   +D+  +
Sbjct: 584 AGDEYLLSASEDKTVRLWSVQDDKPLV 610

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 110/243 (45%), Gaps = 47/243 (19%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H+  I+SLD    G +L++GS D+TV+ W+ +  +  +                 TL +
Sbjct: 483 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSI 525

Query: 526 GEDILSVKISPED-RFLAVSLLDNTVKVFFLDSMKFFL---------SLYGHKLPVLSID 575
            + + +V +SP D +++A   LD  V+V+  DS   FL         S  GHK  V S+ 
Sbjct: 526 EDGVTTVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVV 583

Query: 576 ISYDSKLIITSSADKNIKIWGL------------DFGDCHRSLFAHQDAIMNVKFVPQSH 623
            + D + +++ S D+++K+W L            + G C  +   H+D +++V       
Sbjct: 584 FTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDE 643

Query: 624 NFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQF------FVSVSHDRSIR 677
              S  KD  + +WD    + +  L  H++ V ++A+++          F + S D   R
Sbjct: 644 YILSGSKDRGVLFWDKTSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKAR 703

Query: 678 VWE 680
           +W+
Sbjct: 704 IWK 706

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 81/159 (50%), Gaps = 9/159 (5%)

Query: 529 ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSA 588
           I SV  SP+ +FLA    D  ++++ +++ K  + L GH+  + S+D       +++ S 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 589 DKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK-DGVIKYWDGVKFDCIQK 647
           D+ ++IW L  G C  +L + +D +  V   P    + + G  D  ++ WD      +++
Sbjct: 506 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 564

Query: 648 L-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
           L         HK  V+++  + DGQ  VS S DRS+++W
Sbjct: 565 LDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLW 603

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 84/169 (49%), Gaps = 15/169 (8%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
            LA G  D +I+IWD++ + +++I   H   I  L + PSG +L+SGS D  + IWDL  
Sbjct: 457 FLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL-- 514

Query: 150 EVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCV-------ETHMA 199
             G C L  S +D +T +     D  ++ + S D  ++VWD ++   V       E+   
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTG 574

Query: 200 HTTECWSLAISDD--LVVTANADSELKIWEL-DLERENGSKLKEKGIYE 245
           H    +S+  + D   VV+ + D  +K+W L +   ++ SK    G  E
Sbjct: 575 HKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 623

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 99/229 (43%), Gaps = 19/229 (8%)

Query: 382 LQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALCCKFLPXXX 438
           LQGH  D+ S+D     +KL++ + +  ++IW++ T  C  T     G            
Sbjct: 481 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 540

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLITGSADKTV 492
                     ++++D  +  ++E  ++       H  +++S+  T DG+ +++GS D++V
Sbjct: 541 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV 600

Query: 493 KFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKV 552
           K WN Q       S T   NS    V  T +   + +LSV  +  D ++     D  V  
Sbjct: 601 KLWNLQNANNKSDSKTP--NSGTCEV--TYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 656

Query: 553 FFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIKIW 595
           +   S    L L GH+  V+S+ ++  S L        T S D   +IW
Sbjct: 657 WDKTSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 93/217 (42%), Gaps = 54/217 (24%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD++TG    TLS        ++ PG  D KY                 +AAG  D 
Sbjct: 509 VRIWDLRTGQCSLTLSIEDGVTTVAVSPG--DGKY-----------------IAAGSLDR 549

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDL---- 147
            +++WD +T  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L    
Sbjct: 550 AVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNAN 609

Query: 148 ------VGEVGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETHM 198
                     G C++    HKD +  +   +ND++++S SKD  +  WD  S   +    
Sbjct: 610 NKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNPLLMLQ 669

Query: 199 AHTTECWSLAISD--------DLVVTANADSELKIWE 227
            H     S+A+++        ++  T + D + +IW+
Sbjct: 670 GHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 64/128 (50%), Gaps = 14/128 (10%)

Query: 126 FDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGI-WFENDDWLISTSKDGLIK 184
           F P G  L +G+ D  I IWD+     +  L+ H+  I  + +F + D L+S S D  ++
Sbjct: 451 FSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 510

Query: 185 VWDIKSQQCVETHMAHTTECWSLAISDD---LVVTANADSELKIWE---------LDLER 232
           +WD+++ QC  T ++      ++A+S      +   + D  +++W+         LD E 
Sbjct: 511 IWDLRTGQCSLT-LSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSEN 569

Query: 233 ENGSKLKE 240
           E+G+  K+
Sbjct: 570 ESGTGHKD 577

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 74/174 (42%), Gaps = 26/174 (14%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           ++  L+Y    + L +G  D  ++IWD++T    +  +      T       G  + +GS
Sbjct: 487 DIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 138 RDSNIIIWDLVGEVGLCKLR---------SHKDSITGIWFENDDW-LISTSKDGLIKVWD 187
            D  + +WD   E G    R          HKDS+  + F  D   ++S S D  +K+W+
Sbjct: 547 LDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 188 IK------------SQQCVETHMAHTTECWSLAIS--DDLVVTANADSELKIWE 227
           ++            S  C  T++ H     S+A +  D+ +++ + D  +  W+
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 658

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 54/127 (42%), Gaps = 2/127 (1%)

Query: 569 LPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSC 628
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 629 GKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFL 688
             D  ++ WD     C   L              DG++  + S DR++RVW+   +  FL
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD--SETGFL 561

Query: 689 EEEREKE 695
            E  + E
Sbjct: 562 VERLDSE 568

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 66/159 (41%), Gaps = 25/159 (15%)

Query: 34  SPGQ---IITSSLEN-INCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHE 87
           SPG    I   SL+  +  WD +TG L++ L   +    G  D+ Y        + +  +
Sbjct: 535 SPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYS-------VVFTRD 587

Query: 88  TNLLAAGYADGVIKIWDMQ------------TQTVLIIFNSHTAAITFLKFDPSGTRLIS 135
              + +G  D  +K+W++Q            + T  + +  H   +  +    +   ++S
Sbjct: 588 GQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILS 647

Query: 136 GSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWL 174
           GS+D  ++ WD      L  L+ H++S+  +   N   L
Sbjct: 648 GSKDRGVLFWDKTSGNPLLMLQGHRNSVISVAVANGSPL 686

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/332 (21%), Positives = 134/332 (40%), Gaps = 80/332 (24%)

Query: 389 VRSIDISEDNKLLA-AASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXX 447
           +RS+  S D K LA  A + +++IW++ T+  + T                         
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTL------------------------ 444

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
                              H+  I+SLD    G +L++GS D+TV+ W+       +   
Sbjct: 445 -----------------KGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSL--- 484

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISP-EDRFLAVSLLDNTVKVFFLDSMKFFLSL-- 564
                         TL + + + +V +SP E +F+A   LD TV+V+  D+      L  
Sbjct: 485 --------------TLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDS 530

Query: 565 -----YGHKLPVLSIDISYDSKLIITSSADKNIKIWGLD-------FGDCHRSLFAHQDA 612
                 GH+  V S+  + D K +++ S D+++K+W L+         +C  +   H+D 
Sbjct: 531 ENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDF 590

Query: 613 IMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWAL------ALSSDGQF 666
           +++V          S  KD  + +WD    + +  L  H++ V ++       L  +   
Sbjct: 591 VLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGV 650

Query: 667 FVSVSHDRSIRVWEETEDQVFLEEEREKEMDE 698
           F + S D   R+W+ ++        + KE+ E
Sbjct: 651 FATGSGDCKARIWKYSKKNSQQNSTQIKEIKE 682

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 76/152 (50%), Gaps = 14/152 (9%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
            LA G  D +I+IWD++T+ +++    H   I  L + PSG +L+SGS D  + IWDL  
Sbjct: 420 FLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLT- 478

Query: 150 EVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCVET-------HMA 199
             G C L  S +D +T +     +  ++ + S D  ++VWD  +   VE           
Sbjct: 479 -TGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTG 537

Query: 200 HTTECWSLAISDD--LVVTANADSELKIWELD 229
           H    +S+  + D   VV+ + D  +K+W L+
Sbjct: 538 HRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 103/236 (43%), Gaps = 24/236 (10%)

Query: 375 SKLYTIELQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALCC 431
           +K   + L+GH  D+ S+D     NKL++ + +  ++IW++TT +C  T     G     
Sbjct: 437 TKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVA 496

Query: 432 KFLPXXXXXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLIT 485
                            ++++D  +  ++E  ++       H  +++S+  T DG+ +++
Sbjct: 497 VSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVS 556

Query: 486 GSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSL 545
           GS D++VK WN      L   S  K ++  ++ +    +    +LSV  +  D ++    
Sbjct: 557 GSLDRSVKLWN------LNGLSGQKSHAECEVTYTGHKDF---VLSVATTQNDEYILSGS 607

Query: 546 LDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIKIW 595
            D  V  +   S    L L GH+  V+S+ ++    L        T S D   +IW
Sbjct: 608 KDRGVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 100/222 (45%), Gaps = 41/222 (18%)

Query: 46  INCWDIKTGNLLKTLS--DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIW 103
           +  WD+ TG    TLS  D +   ++      P E  ++         AAG  D  +++W
Sbjct: 472 VRIWDLTTGTCSLTLSIEDGVTTVAV-----SPGEGKFI---------AAGSLDRTVRVW 517

Query: 104 DMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGL--- 153
           D  T  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L G  G    
Sbjct: 518 DSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSH 577

Query: 154 --CKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLA 208
             C++    HKD +  +   +ND++++S SKD  +  WD KS   +     H     S+ 
Sbjct: 578 AECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVT 637

Query: 209 ISD--------DLVVTANADSELKIWELDLE--RENGSKLKE 240
           +++         +  T + D + +IW+   +  ++N +++KE
Sbjct: 638 VANGHPLGPEYGVFATGSGDCKARIWKYSKKNSQQNSTQIKE 679

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 63/142 (44%), Gaps = 4/142 (2%)

Query: 569 LPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSC 628
           L + S+  S D K + T + DK I+IW L+      +L  H+  I ++ + P  +   S 
Sbjct: 407 LYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSG 466

Query: 629 GKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFL 688
             D  ++ WD     C   L              +G+F  + S DR++RVW+   D  FL
Sbjct: 467 SGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWD--SDTGFL 524

Query: 689 EE--EREKEMDEQYEEKLLSTL 708
            E  + E E+   + + + S +
Sbjct: 525 VERLDSENELGTGHRDSVYSVV 546

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 91/213 (42%), Gaps = 35/213 (16%)

Query: 36  GQIITSSLEN--INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAA 93
           G+ + +  E+  I  WD++T  ++ TL            +E+  ++  L+Y    N L +
Sbjct: 418 GKFLATGAEDKLIRIWDLETKKIVMTLKG----------HEQ--DIYSLDYFPSGNKLVS 465

Query: 94  GYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGL 153
           G  D  ++IWD+ T T  +  +      T       G  + +GS D  + +WD   + G 
Sbjct: 466 GSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWD--SDTGF 523

Query: 154 CKLR---------SHKDSITGIWFENDD-WLISTSKDGLIKVWDIKS-------QQCVET 196
              R          H+DS+  + F  D   ++S S D  +K+W++          +C  T
Sbjct: 524 LVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVT 583

Query: 197 HMAHTTECWSLAIS--DDLVVTANADSELKIWE 227
           +  H     S+A +  D+ +++ + D  +  W+
Sbjct: 584 YTGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 616

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 55/108 (50%), Gaps = 5/108 (4%)

Query: 126 FDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGI-WFENDDWLISTSKDGLIK 184
           F P G  L +G+ D  I IWDL  +  +  L+ H+  I  + +F + + L+S S D  ++
Sbjct: 414 FSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVR 473

Query: 185 VWDIKSQQCVETHMAHTTECWSLAISDD---LVVTANADSELKIWELD 229
           +WD+ +  C  T ++      ++A+S      +   + D  +++W+ D
Sbjct: 474 IWDLTTGTCSLT-LSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSD 520

 Score = 35.4 bits (80), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 32/154 (20%), Positives = 65/154 (42%), Gaps = 20/154 (12%)

Query: 34  SPGQ---IITSSLE-NINCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHE 87
           SPG+   I   SL+  +  WD  TG L++ L   + +  G  D+ Y        + +  +
Sbjct: 498 SPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYS-------VVFTRD 550

Query: 88  TNLLAAGYADGVIKIWDMQTQT-------VLIIFNSHTAAITFLKFDPSGTRLISGSRDS 140
              + +G  D  +K+W++   +         + +  H   +  +    +   ++SGS+D 
Sbjct: 551 GKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDR 610

Query: 141 NIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWL 174
            ++ WD      L  L+ H++S+  +   N   L
Sbjct: 611 GVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPL 644

>Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa]
           {ON} similar to Ashbya gossypii AFR199C
          Length = 318

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 99/228 (43%), Gaps = 18/228 (7%)

Query: 458 IVLENKEAAHDAAIWSLDLT-SDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQ 516
           +VL      H+  + SL  + +    L++ S DKT+  W    E +        +     
Sbjct: 7   LVLRGTLEGHNGWVTSLATSPAQPNMLLSASRDKTLITWRLTGEDQQYGVPVKSFKGHSH 66

Query: 517 MVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDI 576
           ++ D T           ++ + ++   +  D T++++ L S +  +   GHK  V+S+ I
Sbjct: 67  IIQDCT-----------VTNDGKYALSASWDKTLRLWDLASGESLIRFVGHKSDVMSVSI 115

Query: 577 SYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSH-----NFFSCGKD 631
              +  I+++S DK +K+W    G+C  +L  H D + +V+  P+ +        S G D
Sbjct: 116 DAGATQIVSASRDKTVKVWNT-VGECVVTLLGHNDWVSHVRIAPKDNADDPVTVISAGMD 174

Query: 632 GVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
            V+K WD   F      I H + V  +  S DG  F S   D  I +W
Sbjct: 175 KVVKVWDLQSFTIEADFIGHNNYVNTVTPSPDGSIFASAGKDGQIMLW 222

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 68/141 (48%), Gaps = 9/141 (6%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  +++WD+ +   LI F  H + +  +  D   T+++S SRD  + +W+ VGE  +  L
Sbjct: 86  DKTLRLWDLASGESLIRFVGHKSDVMSVSIDAGATQIVSASRDKTVKVWNTVGEC-VVTL 144

Query: 157 RSHKDSITGIWFENDD------WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAIS 210
             H D ++ +     D       +IS   D ++KVWD++S       + H     ++  S
Sbjct: 145 LGHNDWVSHVRIAPKDNADDPVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVNTVTPS 204

Query: 211 DD--LVVTANADSELKIWELD 229
            D  +  +A  D ++ +W L+
Sbjct: 205 PDGSIFASAGKDGQIMLWNLN 225

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 59/107 (55%), Gaps = 4/107 (3%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
           +++AG  D V+K+WD+Q+ T+   F  H   +  +   P G+   S  +D  I++W+L  
Sbjct: 168 VISAGM-DKVVKVWDLQSFTIEADFIGHNNYVNTVTPSPDGSIFASAGKDGQIMLWNLNA 226

Query: 150 EVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVE 195
           ++ L  L + KD +  + F  N  WL + +  G IK++D++ +  V+
Sbjct: 227 KIALYSLDA-KDEVFAVAFSPNRYWLTAATASG-IKIFDLEQRLPVD 271

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 563 SLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQS 622
           S  GH   +    ++ D K  +++S DK +++W L  G+       H+  +M+V     +
Sbjct: 60  SFKGHSHIIQDCTVTNDGKYALSASWDKTLRLWDLASGESLIRFVGHKSDVMSVSIDAGA 119

Query: 623 HNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSS-----DGQFFVSVSHDRSIR 677
               S  +D  +K W+ V  +C+  L+ H   V  + ++      D    +S   D+ ++
Sbjct: 120 TQIVSASRDKTVKVWNTVG-ECVVTLLGHNDWVSHVRIAPKDNADDPVTVISAGMDKVVK 178

Query: 678 VWE 680
           VW+
Sbjct: 179 VWD 181

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 65/155 (41%), Gaps = 14/155 (9%)

Query: 87  ETNLLAAGYADGVIKIW-----DMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           + N+L +   D  +  W     D Q    +  F  H+  I        G   +S S D  
Sbjct: 29  QPNMLLSASRDKTLITWRLTGEDQQYGVPVKSFKGHSHIIQDCTVTNDGKYALSASWDKT 88

Query: 142 IIIWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAH 200
           + +WDL     L +   HK  +  +  +     ++S S+D  +KVW+    +CV T + H
Sbjct: 89  LRLWDLASGESLIRFVGHKSDVMSVSIDAGATQIVSASRDKTVKVWNTVG-ECVVTLLGH 147

Query: 201 TTECWSLAI-----SDD--LVVTANADSELKIWEL 228
                 + I     +DD   V++A  D  +K+W+L
Sbjct: 148 NDWVSHVRIAPKDNADDPVTVISAGMDKVVKVWDL 182

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 54/129 (41%), Gaps = 12/129 (9%)

Query: 378 YTIELQ--GHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYALCCKFL 434
           +TIE    GH   V ++  S D  + A+A  +G + +WN+  +  + + D    +     
Sbjct: 185 FTIEADFIGHNNYVNTVTPSPDGSIFASAGKDGQIMLWNLNAKIALYSLDAKDEVFAVAF 244

Query: 435 PXXXXXXXXXXXXELQLFDLASSIVLEN--------KEAAHDAAIWSLDLTSDGRRLITG 486
                         +++FDL   + +++         +A    AI SL  ++DG+ L  G
Sbjct: 245 SPNRYWLTAATASGIKIFDLEQRLPVDDLKPEFAGYAKAQEPHAI-SLAWSADGQTLFAG 303

Query: 487 SADKTVKFW 495
             D  ++ W
Sbjct: 304 YTDNVIRVW 312

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 97/221 (43%), Gaps = 13/221 (5%)

Query: 459 VLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMV 518
           V+ + + AHD  I  +  +SD + L TG AD  VK WN Q +    +S        +   
Sbjct: 216 VVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRV------VLRG 269

Query: 519 HDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISY 578
           H+        +  VK  P DRF+A +  D T +++ ++         GH   V  +D   
Sbjct: 270 HEAR------VSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQC 323

Query: 579 DSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWD 638
           D  L+ ++  D    +W +  G     L  H   I  V + P  H+  +   DG ++ WD
Sbjct: 324 DGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWD 383

Query: 639 GVKFDCIQKLIAHKSEVWALALSSD-GQFFVSVSHDRSIRV 678
             K +    ++AH S V  +    + G F VS S+DR+I V
Sbjct: 384 IRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGV 424

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 123/288 (42%), Gaps = 42/288 (14%)

Query: 322 QPFQVVRS-----SFKFKSAAWTRCSLSKLELVFTTSNNTIEYYSIPYKNQKPTQVAASK 376
           Q  +VVRS       K    AW+  S S+L L    ++N ++ ++       P   + S+
Sbjct: 212 QSLEVVRSLDGAHDDKIGGVAWS--SDSQL-LATGGADNLVKIWN-------PQAQSHSE 261

Query: 377 LYTIELQGHRTDVRSIDISEDNKLLAAASNGML-KIWNITTQSCIRTFDCGYA---LCCK 432
              + L+GH   V  +     ++ +A+AS  M  ++W++  ++ ++    G+A    C  
Sbjct: 262 ASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQ-LQEGHAKEVYCLD 320

Query: 433 FLPXXXXXXXXXXXXELQLFDLASS---IVLENKEAAHDAAIWSLDLTSDGRRLITGSAD 489
           F                 ++D+ +    +VLE     H   I+ +  + +G  + TGS D
Sbjct: 321 FQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLE----GHAKPIYGVSWSPNGHHVATGSGD 376

Query: 490 KTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNT 549
            TV+ W+  + K    SS   +NS   +V +   E               FL  S  D T
Sbjct: 377 GTVQVWD--IRKANKPSSILAHNS---IVSEVNFE----------KENGNFLVSSSYDRT 421

Query: 550 VKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL 597
           + VF   S     SL GH   +LS+DIS     + +S  D+++KIW L
Sbjct: 422 IGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 78/157 (49%), Gaps = 4/157 (2%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           EV  L++  + +LL +   D V  +WDM+T   L++   H   I  + + P+G  + +GS
Sbjct: 315 EVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGS 374

Query: 138 RDSNIIIWDLVGEVGLCKLRSHKDSITGIWF--ENDDWLISTSKDGLIKVWDIKSQQCVE 195
            D  + +WD+        + +H   ++ + F  EN ++L+S+S D  I V+   S   + 
Sbjct: 375 GDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLA 434

Query: 196 THMAHTTECWSLAISDDL--VVTANADSELKIWELDL 230
           +   HT +  S+ IS     + ++  D  +KIW L +
Sbjct: 435 SLQGHTDKILSVDISRGGANLWSSGWDRSVKIWALGV 471

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 82/168 (48%), Gaps = 9/168 (5%)

Query: 68  SIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQT----VLIIFNSHTAAITF 123
           S+D  ++   ++  + +  ++ LLA G AD ++KIW+ Q Q+      ++   H A ++ 
Sbjct: 219 SLDGAHDD--KIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSK 276

Query: 124 LKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLI-STSKDGL 182
           +KF PS   + S S D    +WD+  E  L     H   +  + F+ D  L+ S   D +
Sbjct: 277 VKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSV 336

Query: 183 IKVWDIKSQQCVETHMAHTTECWSLAISDD--LVVTANADSELKIWEL 228
             VWD+++ + +     H    + ++ S +   V T + D  +++W++
Sbjct: 337 GHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDI 384

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 1/127 (0%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
           A V+ +++H     +A+   D   ++WD++ +T L +   H   +  L F   G+ L S 
Sbjct: 272 ARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSA 331

Query: 137 SRDSNIIIWDLVGEVGLCKLRSHKDSITGI-WFENDDWLISTSKDGLIKVWDIKSQQCVE 195
             DS   +WD+     L  L  H   I G+ W  N   + + S DG ++VWDI+      
Sbjct: 332 GLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPS 391

Query: 196 THMAHTT 202
           + +AH +
Sbjct: 392 SILAHNS 398

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 67/168 (39%), Gaps = 5/168 (2%)

Query: 518 VHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYG-HKLPVLSIDI 576
           +H + +     +  V  SP+   LA    +  VK+    S++   SL G H   +  +  
Sbjct: 174 LHGSQVVFSRPVSQVARSPDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAW 233

Query: 577 SYDSKLIITSSADKNIKIW---GLDFGDCHRS-LFAHQDAIMNVKFVPQSHNFFSCGKDG 632
           S DS+L+ T  AD  +KIW        +  R  L  H+  +  VKF P      S   D 
Sbjct: 234 SSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDM 293

Query: 633 VIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
             + WD  +   +Q    H  EV+ L    DG    S   D    VW+
Sbjct: 294 TWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWD 341

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 100/262 (38%), Gaps = 27/262 (10%)

Query: 385 HRTDVRSIDISEDNKLLA-AASNGMLKIWNITTQS---CIRTFDCGYALCC---KFLPXX 437
           H   +  +  S D++LLA   ++ ++KIWN   QS     R    G+       KF P  
Sbjct: 224 HDDKIGGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSD 283

Query: 438 XXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNF 497
                       +L+D+     L+ +E  H   ++ LD   DG  L +   D     W+ 
Sbjct: 284 RFVASASFDMTWRLWDVERETELQLQEG-HAKEVYCLDFQCDGSLLCSAGLDSVGHVWDM 342

Query: 498 QVEKELISSSTDKYNSRLQMVHDTTLE-LGEDILSVKISPEDRFLAVSLLDNTVKVFFLD 556
           +  + L+                  LE   + I  V  SP    +A    D TV+V+ + 
Sbjct: 343 RTGRSLM-----------------VLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIR 385

Query: 557 SMKFFLSLYGHKLPVLSIDISYD-SKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMN 615
                 S+  H   V  ++   +    +++SS D+ I ++         SL  H D I++
Sbjct: 386 KANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQGHTDKILS 445

Query: 616 VKFVPQSHNFFSCGKDGVIKYW 637
           V       N +S G D  +K W
Sbjct: 446 VDISRGGANLWSSGWDRSVKIW 467

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 103/247 (41%), Gaps = 22/247 (8%)

Query: 458 IVLENKEAAHDAAIWSLDLTSDGRR--LITGSADKTVKFWNFQVEKELISSSTDKYNSRL 515
           +VL      H+  + SL  TS G+   L++ S DKT+  W    + +        +    
Sbjct: 7   LVLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHS 65

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSL-LDNTVKVFFLDSMKFFLSLYGHKLPVLSI 574
            +V D TL             +D   A+S   D T++++ + + + +    GHK  V+S+
Sbjct: 66  HIVQDCTLT------------QDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV 113

Query: 575 DISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN-----FFSCG 629
            I   + +II+ S DK IK+W +  G C  +L  H D +  V+  P   N       S G
Sbjct: 114 AIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAG 172

Query: 630 KDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLE 689
            D ++K W+  +F      + H   V A+  S DG    S   D  I +W   E      
Sbjct: 173 NDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYT 232

Query: 690 EEREKEM 696
              + E+
Sbjct: 233 LSAQDEV 239

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  +++WD+ T      F  H + +  +  D   + +ISGSRD  I +W + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 157 RSHKDSITGIWF----ENDD--WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAIS 210
             H D ++ +      +NDD   +IS   D ++K W++   Q     + H     ++  S
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 211 DD--LVVTANADSELKIWEL 228
            D  L+ +A  D E+ +W L
Sbjct: 205 PDGSLIASAGKDGEIMLWNL 224

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 74/327 (22%), Positives = 127/327 (38%), Gaps = 54/327 (16%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNIT-------------------TQSCI 420
           L+GH   V S+  S  + N LL+A+ +  L  W +T                    Q C 
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
            T D  YAL   +               L+L+D+A+    + +   H + + S+ +    
Sbjct: 73  LTQDGAYALSASW------------DKTLRLWDVATGETYQ-RFVGHKSDVMSVAIDRKA 119

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
             +I+GS DKT+K W     K    ++   +N  +  V     +  +D ++V  +  D+ 
Sbjct: 120 SMIISGSRDKTIKVWTI---KGQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKM 176

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
                    VK + L+  +      GH   V ++  S D  LI ++  D  I +W L   
Sbjct: 177 ---------VKAWNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEK 227

Query: 601 DCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKY-------WDGVKFDCIQKLIAHKS 653
               +L A QD +  + F P  +   +    GV  +        D ++ +      A + 
Sbjct: 228 TAMYTLSA-QDEVFALAFSPNRYWLAAATASGVKIFSLDPQSLIDDLRPEFAGYNKAAEP 286

Query: 654 EVWALALSSDGQFFVSVSHDRSIRVWE 680
              +L  S+DGQ   +   D  IRVW+
Sbjct: 287 HAVSLTWSADGQTLFAGYTDNVIRVWQ 313

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 53/124 (42%), Gaps = 9/124 (7%)

Query: 114 FNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEND-D 172
           F  H+  +        G   +S S D  + +WD+       +   HK  +  +  +    
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKAS 120

Query: 173 WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAIS-----DD--LVVTANADSELKI 225
            +IS S+D  IKVW IK  QC+ T + H      + I+     DD   V++A  D  +K 
Sbjct: 121 MIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKA 179

Query: 226 WELD 229
           W L+
Sbjct: 180 WNLN 183

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 61/136 (44%), Gaps = 12/136 (8%)

Query: 105 MQTQTVLII---FNSHTAAITFLKFDPSGTRLI-SGSRDSNIIIWDLVGE-----VGLCK 155
           M +  VL++      H   +T L        L+ S SRD  +I W L G+     V +  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS 60

Query: 156 LRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI--SDD 212
            + H   +       D  + +S S D  +++WD+ + +  +  + H ++  S+AI     
Sbjct: 61  FKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKAS 120

Query: 213 LVVTANADSELKIWEL 228
           ++++ + D  +K+W +
Sbjct: 121 MIISGSRDKTIKVWTI 136

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 70/159 (44%), Gaps = 10/159 (6%)

Query: 38  IITSSLE-NINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYA 96
           II+ S +  I  W IK G  L TL      G  D  +     +A  + + +T  + +   
Sbjct: 122 IISGSRDKTIKVWTIK-GQCLATL-----LGHND--WVSQVRIAPTDQNDDTVTVISAGN 173

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D ++K W++    +   F  H   +  +   P G+ + S  +D  I++W+L+ +  +  L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTL 233

Query: 157 RSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
            +  +     +  N  WL + +  G +K++ +  Q  ++
Sbjct: 234 SAQDEVFALAFSPNRYWLAAATASG-VKIFSLDPQSLID 271

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 46/243 (18%), Positives = 95/243 (39%), Gaps = 21/243 (8%)

Query: 44  ENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIW 103
           + +  WD+ TG   +                  ++V  +    + +++ +G  D  IK+W
Sbjct: 87  KTLRLWDVATGETYQRF------------VGHKSDVMSVAIDRKASMIISGSRDKTIKVW 134

Query: 104 DMQTQTVLIIFNSHTAAITFLKFDPS-----GTRLISGSRDSNIIIWDLVGEVGLCKLRS 158
            ++ Q +  +   H   ++ ++  P+        +IS   D  +  W+L           
Sbjct: 135 TIKGQCLATLLG-HNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVG 193

Query: 159 HKDSITGIWFENDDWLI-STSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLV-VT 216
           H  ++  +    D  LI S  KDG I +W++  +  + T ++   E ++LA S +   + 
Sbjct: 194 HNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYT-LSAQDEVFALAFSPNRYWLA 252

Query: 217 ANADSELKIWELDLERENGSKLKEKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTT 276
           A   S +KI+ LD +        E   Y K +   +V +    +   +   Y  N  +  
Sbjct: 253 AATASGVKIFSLDPQSLIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRVW 312

Query: 277 EVF 279
           +V 
Sbjct: 313 QVM 315

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 94/219 (42%), Gaps = 17/219 (7%)

Query: 463 KEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTT 522
           K   H  A++S   + D + LI+GS DKTV+ W    +  L+S     Y      V D  
Sbjct: 558 KLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVS-----YKGHNHPVWD-- 610

Query: 523 LELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKL 582
                    V  SP   + A +  D T +++  D +       GH   V  +    +   
Sbjct: 611 ---------VAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCY 661

Query: 583 IITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKF 642
           + T S+DK  ++W +  G+  R    H   ++++   P      S  +DG+I  WD    
Sbjct: 662 VFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSG 721

Query: 643 DCIQKLIAH-KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
             ++++  H ++ V ++  S +G   +S   D S+RVW+
Sbjct: 722 KRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWD 760

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 91/227 (40%), Gaps = 17/227 (7%)

Query: 471 IWSLDLTSDGRRLITGSADKTVKFWNFQ---------------VEKELISSSTDKYNSRL 515
           + SLD + D R    G  D  +K W+                  +K    ++        
Sbjct: 491 MLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFTKKNTADNNLHSKKKHQ 550

Query: 516 QMVHDTTLELGED--ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLS 573
           + V+  T  +G    + S   SP+++ L     D TV+++ +D+    +S  GH  PV  
Sbjct: 551 EHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWD 610

Query: 574 IDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGV 633
           +  S       T+S D+  ++W  D     R    H   +  V F P     F+   D  
Sbjct: 611 VAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKT 670

Query: 634 IKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
            + WD    + ++  + H + V +L +S DG++  S S D  I VW+
Sbjct: 671 CRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWD 717

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 71/160 (44%), Gaps = 7/160 (4%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +  LL +G  D  +++W M TQ+ L+ +  H   +  + F P G    + S D    
Sbjct: 571 FSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTAR 630

Query: 144 IWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTT 202
           +W       L     H   +  + F  N  ++ + S D   ++WD+ + + V   + HT 
Sbjct: 631 LWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTA 690

Query: 203 ECWSLAISDDL--VVTANADSELKIWELDLERENGSKLKE 240
              SL +S D   + + + D  + +W++     +G +LK+
Sbjct: 691 PVVSLGVSPDGRWLASGSEDGLINVWDIG----SGKRLKQ 726

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 58/114 (50%), Gaps = 2/114 (1%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
           ++V  + +H     +  G +D   ++WD+ T   + +F  HTA +  L   P G  L SG
Sbjct: 648 SDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASG 707

Query: 137 SRDSNIIIWDLVGEVGLCKLRSH-KDSITGIWFENDDW-LISTSKDGLIKVWDI 188
           S D  I +WD+     L ++R H ++++  I F  +   +IS   D  ++VWD+
Sbjct: 708 SEDGLINVWDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 69/155 (44%), Gaps = 7/155 (4%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           +VA+    H     A    D   ++W       L IF  H + +  + F P+G  + +GS
Sbjct: 610 DVAFSPMGH---YFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGS 666

Query: 138 RDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVET 196
            D    +WD+     +     H   +  +    D  WL S S+DGLI VWDI S + ++ 
Sbjct: 667 SDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRLKQ 726

Query: 197 HMAHTTECW-SLAISDD--LVVTANADSELKIWEL 228
              H      S+  S +  ++++   D+ +++W++
Sbjct: 727 MRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 68/155 (43%), Gaps = 12/155 (7%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           E+  L++  +  L AAG+ D  IKIW +   ++  +  + T    F K + +   L S  
Sbjct: 490 EMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTL--TSTNNTHFTKKNTADNNLHSKK 547

Query: 138 RDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVET 196
           +    +  +        KL  H  ++    F  D+  LIS S+D  +++W + +Q  + +
Sbjct: 548 KHQEHVNTN-------TKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVS 600

Query: 197 HMAHTTECWSLAIS--DDLVVTANADSELKIWELD 229
           +  H    W +A S       TA+ D   ++W  D
Sbjct: 601 YKGHNHPVWDVAFSPMGHYFATASHDQTARLWSCD 635

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/143 (16%), Positives = 59/143 (41%), Gaps = 4/143 (2%)

Query: 359 YYSIPYKNQKPTQVAASKLYTIEL-QGHRTDVRSIDISEDN-KLLAAASNGMLKIWNITT 416
           Y++    +Q     +   +Y++ +  GH +DV  +    +   +   +S+   ++W+++T
Sbjct: 619 YFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVST 678

Query: 417 QSCIRTF--DCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSL 474
              +R F       +     P             + ++D+ S   L+        A+ S+
Sbjct: 679 GETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSI 738

Query: 475 DLTSDGRRLITGSADKTVKFWNF 497
             + +G  +I+G  D +V+ W+ 
Sbjct: 739 VFSQEGTVIISGGTDNSVRVWDM 761

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 110/243 (45%), Gaps = 47/243 (19%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H+  I+SLD    G +L++GS D+TV+ W+ +  +  +                 TL +
Sbjct: 483 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSI 525

Query: 526 GEDILSVKISPED-RFLAVSLLDNTVKVFFLDSMKFFL---------SLYGHKLPVLSID 575
            + + +V +SP D +++A   LD  V+V+  DS   FL         S  GHK  V S+ 
Sbjct: 526 EDGVTTVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVV 583

Query: 576 ISYDSKLIITSSADKNIKIWGL------------DFGDCHRSLFAHQDAIMNVKFVPQSH 623
            + D + +++ S D+++K+W L            + G C  +   H+D +++V       
Sbjct: 584 FTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDE 643

Query: 624 NFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQF------FVSVSHDRSIR 677
              S  KD  + +WD    + +  L  H++ V ++A+++          F + S D   R
Sbjct: 644 YILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKAR 703

Query: 678 VWE 680
           +W+
Sbjct: 704 IWK 706

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 81/159 (50%), Gaps = 9/159 (5%)

Query: 529 ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSA 588
           I SV  SP+ +FLA    D  ++++ +++ K  + L GH+  + S+D       +++ S 
Sbjct: 446 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 505

Query: 589 DKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK-DGVIKYWDGVKFDCIQK 647
           D+ ++IW L  G C  +L + +D +  V   P    + + G  D  ++ WD      +++
Sbjct: 506 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 564

Query: 648 L-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
           L         HK  V+++  + DGQ  VS S DRS+++W
Sbjct: 565 LDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLW 603

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 84/169 (49%), Gaps = 15/169 (8%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
            LA G  D +I+IWD++ + +++I   H   I  L + PSG +L+SGS D  + IWDL  
Sbjct: 457 FLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL-- 514

Query: 150 EVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCV-------ETHMA 199
             G C L  S +D +T +     D  ++ + S D  ++VWD ++   V       E+   
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTG 574

Query: 200 HTTECWSLAISDD--LVVTANADSELKIWEL-DLERENGSKLKEKGIYE 245
           H    +S+  + D   VV+ + D  +K+W L +   ++ SK    G  E
Sbjct: 575 HKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 623

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 99/229 (43%), Gaps = 19/229 (8%)

Query: 382 LQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALCCKFLPXXX 438
           LQGH  D+ S+D     +KL++ + +  ++IW++ T  C  T     G            
Sbjct: 481 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 540

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLITGSADKTV 492
                     ++++D  +  ++E  ++       H  +++S+  T DG+ +++GS D++V
Sbjct: 541 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV 600

Query: 493 KFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKV 552
           K WN Q       S T   NS    V  T +   + +LSV  +  D ++     D  V  
Sbjct: 601 KLWNLQNANNKSDSKTP--NSGTCEV--TYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 656

Query: 553 FFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIKIW 595
           +   S    L L GH+  V+S+ ++  S L        T S D   +IW
Sbjct: 657 WDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 94/217 (43%), Gaps = 54/217 (24%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD++TG    TLS        ++ PG  D KY                 +AAG  D 
Sbjct: 509 VRIWDLRTGQCSLTLSIEDGVTTVAVSPG--DGKY-----------------IAAGSLDR 549

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDL---- 147
            +++WD +T  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L    
Sbjct: 550 AVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNAN 609

Query: 148 ------VGEVGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETHM 198
                     G C++    HKD +  +   +ND++++S SKD  +  WD KS   +    
Sbjct: 610 NKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQ 669

Query: 199 AHTTECWSLAISD--------DLVVTANADSELKIWE 227
            H     S+A+++        ++  T + D + +IW+
Sbjct: 670 GHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 64/128 (50%), Gaps = 14/128 (10%)

Query: 126 FDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGI-WFENDDWLISTSKDGLIK 184
           F P G  L +G+ D  I IWD+     +  L+ H+  I  + +F + D L+S S D  ++
Sbjct: 451 FSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 510

Query: 185 VWDIKSQQCVETHMAHTTECWSLAISDD---LVVTANADSELKIWE---------LDLER 232
           +WD+++ QC  T ++      ++A+S      +   + D  +++W+         LD E 
Sbjct: 511 IWDLRTGQCSLT-LSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSEN 569

Query: 233 ENGSKLKE 240
           E+G+  K+
Sbjct: 570 ESGTGHKD 577

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 74/174 (42%), Gaps = 26/174 (14%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           ++  L+Y    + L +G  D  ++IWD++T    +  +      T       G  + +GS
Sbjct: 487 DIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 138 RDSNIIIWDLVGEVGLCKLR---------SHKDSITGIWFENDDW-LISTSKDGLIKVWD 187
            D  + +WD   E G    R          HKDS+  + F  D   ++S S D  +K+W+
Sbjct: 547 LDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 188 IK------------SQQCVETHMAHTTECWSLAIS--DDLVVTANADSELKIWE 227
           ++            S  C  T++ H     S+A +  D+ +++ + D  +  W+
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 658

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 54/127 (42%), Gaps = 2/127 (1%)

Query: 569 LPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSC 628
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 629 GKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFL 688
             D  ++ WD     C   L              DG++  + S DR++RVW+   +  FL
Sbjct: 504 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD--SETGFL 561

Query: 689 EEEREKE 695
            E  + E
Sbjct: 562 VERLDSE 568

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 71/179 (39%), Gaps = 28/179 (15%)

Query: 34  SPGQ---IITSSLEN-INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETN 89
           SPG    I   SL+  +  WD +TG L++ L      G+          V  + +  +  
Sbjct: 535 SPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKD-----SVYSVVFTRDGQ 589

Query: 90  LLAAGYADGVIKIWDMQ------------TQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
            + +G  D  +K+W++Q            + T  + +  H   +  +    +   ++SGS
Sbjct: 590 SVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGS 649

Query: 138 RDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWL-------ISTSKDGLIKVWDIK 189
           +D  ++ WD      L  L+ H++S+  +   N   L        + S D   ++W  K
Sbjct: 650 KDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYK 708

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 109/243 (44%), Gaps = 47/243 (19%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H+  I+SLD    G +L++GS D+TV+ W+ +  +  +                 TL +
Sbjct: 479 GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSI 521

Query: 526 GEDILSVKISPED-RFLAVSLLDNTVKVFFLDSMKFFL---------SLYGHKLPVLSID 575
            + + +V +SP D +++A   LD  V+V+  DS   FL         S  GHK  V S+ 
Sbjct: 522 EDGVTTVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVV 579

Query: 576 ISYDSKLIITSSADKNIKIWGL------------DFGDCHRSLFAHQDAIMNVKFVPQSH 623
            + D   +++ S D+++K+W L            + G C  +   H+D +++V       
Sbjct: 580 FTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDE 639

Query: 624 NFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQF------FVSVSHDRSIR 677
              S  KD  + +WD    + +  L  H++ V ++A+++          F + S D   R
Sbjct: 640 YILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKAR 699

Query: 678 VWE 680
           +W+
Sbjct: 700 IWK 702

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 79/159 (49%), Gaps = 9/159 (5%)

Query: 529 ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSA 588
           I SV  SP+ +FLA    D  ++++ ++  K  + L GH+  + S+D       +++ S 
Sbjct: 442 IRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 501

Query: 589 DKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK-DGVIKYWDGVKFDCIQK 647
           D+ ++IW L  G C  +L + +D +  V   P    + + G  D  ++ WD      +++
Sbjct: 502 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 560

Query: 648 L-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
           L         HK  V+++  + DG   VS S DRS+++W
Sbjct: 561 LDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLW 599

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 84/169 (49%), Gaps = 15/169 (8%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
            LA G  D +I+IWD++ + +++I   H   I  L + PSG +L+SGS D  + IWDL  
Sbjct: 453 FLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDL-- 510

Query: 150 EVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCV-------ETHMA 199
             G C L  S +D +T +     D  ++ + S D  ++VWD ++   V       E+   
Sbjct: 511 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTG 570

Query: 200 HTTECWSLAISDD--LVVTANADSELKIWEL-DLERENGSKLKEKGIYE 245
           H    +S+  + D   VV+ + D  +K+W L +   ++ SK    G  E
Sbjct: 571 HKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCE 619

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 98/229 (42%), Gaps = 19/229 (8%)

Query: 382 LQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALCCKFLPXXX 438
           LQGH  D+ S+D     +KL++ + +  ++IW++ T  C  T     G            
Sbjct: 477 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 536

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLITGSADKTV 492
                     ++++D  +  ++E  ++       H  +++S+  T DG  +++GS D++V
Sbjct: 537 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSV 596

Query: 493 KFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKV 552
           K WN Q       S +   NS    V  T +   + +LSV  +  D ++     D  V  
Sbjct: 597 KLWNLQNANN--KSDSKAPNSGTCEV--TYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 652

Query: 553 FFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIKIW 595
           +   S    L L GH+  V+S+ ++  S L        T S D   +IW
Sbjct: 653 WDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 701

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 94/217 (43%), Gaps = 54/217 (24%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD++TG    TLS        ++ PG  D KY                 +AAG  D 
Sbjct: 505 VRIWDLRTGQCSLTLSIEDGVTTVAVSPG--DGKY-----------------IAAGSLDR 545

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDL---- 147
            +++WD +T  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L    
Sbjct: 546 AVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNAN 605

Query: 148 ------VGEVGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETHM 198
                     G C++    HKD +  +   +ND++++S SKD  +  WD KS   +    
Sbjct: 606 NKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQ 665

Query: 199 AHTTECWSLAISD--------DLVVTANADSELKIWE 227
            H     S+A+++        ++  T + D + +IW+
Sbjct: 666 GHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 702

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 64/128 (50%), Gaps = 14/128 (10%)

Query: 126 FDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGI-WFENDDWLISTSKDGLIK 184
           F P G  L +G+ D  I IWD+     +  L+ H+  I  + +F + D L+S S D  ++
Sbjct: 447 FSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 506

Query: 185 VWDIKSQQCVETHMAHTTECWSLAISDD---LVVTANADSELKIWE---------LDLER 232
           +WD+++ QC  T ++      ++A+S      +   + D  +++W+         LD E 
Sbjct: 507 IWDLRTGQCSLT-LSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSEN 565

Query: 233 ENGSKLKE 240
           E+G+  K+
Sbjct: 566 ESGTGHKD 573

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 74/174 (42%), Gaps = 26/174 (14%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           ++  L+Y    + L +G  D  ++IWD++T    +  +      T       G  + +GS
Sbjct: 483 DIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGS 542

Query: 138 RDSNIIIWDLVGEVGLCKLR---------SHKDSITGIWFENDDW-LISTSKDGLIKVWD 187
            D  + +WD   E G    R          HKDS+  + F  D   ++S S D  +K+W+
Sbjct: 543 LDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWN 600

Query: 188 IK------------SQQCVETHMAHTTECWSLAIS--DDLVVTANADSELKIWE 227
           ++            S  C  T++ H     S+A +  D+ +++ + D  +  W+
Sbjct: 601 LQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 654

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 54/127 (42%), Gaps = 2/127 (1%)

Query: 569 LPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSC 628
           L + S+  S D K + T + D+ I+IW ++       L  H+  I ++ + P      S 
Sbjct: 440 LYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 629 GKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFL 688
             D  ++ WD     C   L              DG++  + S DR++RVW+   +  FL
Sbjct: 500 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD--SETGFL 557

Query: 689 EEEREKE 695
            E  + E
Sbjct: 558 VERLDSE 564

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 73/181 (40%), Gaps = 32/181 (17%)

Query: 34  SPGQ---IITSSLEN-INCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHE 87
           SPG    I   SL+  +  WD +TG L++ L   +    G  D+ Y     V +    H 
Sbjct: 531 SPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYS----VVFTRDGHS 586

Query: 88  TNLLAAGYADGVIKIWDMQ------------TQTVLIIFNSHTAAITFLKFDPSGTRLIS 135
              + +G  D  +K+W++Q            + T  + +  H   +  +    +   ++S
Sbjct: 587 ---VVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILS 643

Query: 136 GSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWL-------ISTSKDGLIKVWDI 188
           GS+D  ++ WD      L  L+ H++S+  +   N   L        + S D   ++W  
Sbjct: 644 GSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKY 703

Query: 189 K 189
           K
Sbjct: 704 K 704

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 112/242 (46%), Gaps = 31/242 (12%)

Query: 467 HDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQ------MVHD 520
           H + +  +  ++DG  L TG  +KT + +      EL++  +D   S +       +  +
Sbjct: 292 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVST-GELVARLSDDSVSGINNESSSVVAGN 349

Query: 521 TTLELGED--------------ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYG 566
              E G++              I SV  SP+ ++LA    D  ++++ L S K  ++L G
Sbjct: 350 GATEKGDESSATIQPGSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQG 409

Query: 567 HKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFF 626
           H+  + S+D       +++ S D+ ++IW L  G C  +L + +D +  V   P    + 
Sbjct: 410 HEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYI 468

Query: 627 SCGK-DGVIKYWDGVKFDCIQKL-------IAHKSEVWALALSSDGQFFVSVSHDRSIRV 678
           + G  D  ++ WD      +++L         HK  V+++  + DG+  VS S DRS+++
Sbjct: 469 AAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKL 528

Query: 679 WE 680
           W+
Sbjct: 529 WD 530

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 118/267 (44%), Gaps = 50/267 (18%)

Query: 465 AAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELIS--------SSTDKYNSRLQ 516
           ++ D  I S+  + DG+ L TG+ DK ++ W+   +K L++         S D + +  +
Sbjct: 366 SSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDK 425

Query: 517 MVHDT-----------------TLELGEDILSVKISPED-RFLAVSLLDNTVKVFFLDSM 558
           +V  +                 TL + + + +V +SP D +++A   LD TV+V+  DS 
Sbjct: 426 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVW--DSE 483

Query: 559 KFFLS---------LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL-------DFGDC 602
             FL            GHK  V S+  + D + +++ S D+++K+W L           C
Sbjct: 484 TGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSHATC 543

Query: 603 HRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA--- 659
             +   H+D +++V          S  KD  + +WD    + +  L  H++ V ++A   
Sbjct: 544 EVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVN 603

Query: 660 ---LSSDGQFFVSVSHDRSIRVWEETE 683
              L  D   F + S D   R+W+ T+
Sbjct: 604 GFPLGPDIGVFATGSGDCKARIWKYTK 630

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 90/189 (47%), Gaps = 21/189 (11%)

Query: 61  SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAA 120
           S +I PGS    Y     +  + +  +   LA G  D +I+IWD+ ++ +L+    H   
Sbjct: 359 SATIQPGSSSDLY-----IRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQD 413

Query: 121 ITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLR-SHKDSITGIWFENDD--WLIST 177
           I  L + P+G +L+SGS D  + IWDL    G C L  S +D +T +     D  ++ + 
Sbjct: 414 IYSLDYFPAGDKLVSGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAG 471

Query: 178 SKDGLIKVWDIKSQQCVET-------HMAHTTECWSLAISDD--LVVTANADSELKIWEL 228
           S D  ++VWD ++   VE           H    +S+  + D   VV+ + D  +K+W  
Sbjct: 472 SLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLW-- 529

Query: 229 DLERENGSK 237
           DL   NG K
Sbjct: 530 DLRGLNGQK 538

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 124/284 (43%), Gaps = 45/284 (15%)

Query: 389 VRSIDISEDNKLLA-AASNGMLKIWNITTQSCIRTFDCG----YALCCKFLPXXXXXXXX 443
           +RS+  S D K LA  A + +++IW+++++  + T        Y+L   + P        
Sbjct: 372 IRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSL--DYFPAGDKLVSG 429

Query: 444 XXXXELQLFDLAS---SIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVE 500
                ++++DL +   S+ L  ++     A+       DG+ +  GS D+TV+ W+    
Sbjct: 430 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSP----GDGKYIAAGSLDRTVRVWD---- 481

Query: 501 KELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKF 560
                S T     RL   ++ +    + + SV  + + R +    LD +VK++ L  +  
Sbjct: 482 -----SETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNG 536

Query: 561 F-------LSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAI 613
                   ++  GHK  VLS+  + D + I++ S D+ +  W    G+    L  H++++
Sbjct: 537 QKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSV 596

Query: 614 MNVKFVPQSHNFFSCGKD-GVIKYWDGVKFDCIQKLIAHKSEVW 656
           ++V  V    N F  G D GV     G   DC       K+ +W
Sbjct: 597 ISVAVV----NGFPLGPDIGVFATGSG---DC-------KARIW 626

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 103/237 (43%), Gaps = 24/237 (10%)

Query: 374 ASKLYTIELQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALC 430
           +SK   + LQGH  D+ S+D     +KL++ + +  ++IW++ T  C  T     G    
Sbjct: 399 SSKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTV 458

Query: 431 CKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLI 484
                             ++++D  +  ++E  ++       H  +++S+  T DGR ++
Sbjct: 459 AVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVV 518

Query: 485 TGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVS 544
           +GS D++VK W      +L   +  K ++  ++ +    +    +LSV  + +D ++   
Sbjct: 519 SGSLDRSVKLW------DLRGLNGQKSHATCEVTYTGHKDF---VLSVATTQDDEYILSG 569

Query: 545 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDI------SYDSKLIITSSADKNIKIW 595
             D  V  +   S    L L GH+  V+S+ +        D  +  T S D   +IW
Sbjct: 570 SKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIW 626

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 90/212 (42%), Gaps = 49/212 (23%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD++TG    TLS        ++ PG  D KY                 +AAG  D 
Sbjct: 435 VRIWDLRTGQCSLTLSIEDGVTTVAVSPG--DGKY-----------------IAAGSLDR 475

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEV 151
            +++WD +T  ++   +S       H  ++  + F   G  ++SGS D ++ +WDL G  
Sbjct: 476 TVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLN 535

Query: 152 G-----LCKLR--SHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTE 203
           G      C++    HKD +  +    DD +++S SKD  +  WD  S   +     H   
Sbjct: 536 GQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNS 595

Query: 204 CWSLAISD--------DLVVTANADSELKIWE 227
             S+A+ +         +  T + D + +IW+
Sbjct: 596 VISVAVVNGFPLGPDIGVFATGSGDCKARIWK 627

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 58/138 (42%)

Query: 571 VLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK 630
           + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S   
Sbjct: 372 IRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 431

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEE 690
           D  ++ WD     C   L              DG++  + S DR++RVW+     +    
Sbjct: 432 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERL 491

Query: 691 EREKEMDEQYEEKLLSTL 708
           + E E+   +++ + S +
Sbjct: 492 DSENELSTGHKDSVYSVV 509

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 64/150 (42%), Gaps = 20/150 (13%)

Query: 34  SPGQ---IITSSLE-NINCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHE 87
           SPG    I   SL+  +  WD +TG L++ L   + +  G  D+ Y        + +  +
Sbjct: 461 SPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYS-------VVFTRD 513

Query: 88  TNLLAAGYADGVIKIWDMQT-------QTVLIIFNSHTAAITFLKFDPSGTRLISGSRDS 140
              + +G  D  +K+WD++         T  + +  H   +  +        ++SGS+D 
Sbjct: 514 GRSVVSGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDR 573

Query: 141 NIIIWDLVGEVGLCKLRSHKDSITGIWFEN 170
            ++ WD      L  L+ H++S+  +   N
Sbjct: 574 GVLFWDTASGNPLLMLQGHRNSVISVAVVN 603

>TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [954
           bp, 317 aa] {ON} Anc_2.431 YMR116C
          Length = 317

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 104/247 (42%), Gaps = 21/247 (8%)

Query: 458 IVLENKEAAHDAAIWSLDLTSDGRR--LITGSADKTVKFWNFQVEKELISSSTDKYNSRL 515
           +VL      H+  + SL  TS G+   L++ S DKT+  W    + +        +    
Sbjct: 5   LVLRGTLEGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHS 63

Query: 516 QMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 575
            +V D  L           + +  +   +  D T++++ + + + F    GHK  V+S+ 
Sbjct: 64  HIVQDCAL-----------TADGAYALSASWDKTIRLWDVSTGETFQRFVGHKGDVMSVA 112

Query: 576 ISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQ------SHNFFSCG 629
           I   + +II+ S DK IK+W +  G+C  ++  H D +  V+  P       +    S G
Sbjct: 113 IDRKASMIISGSRDKTIKVWSIK-GECLATMLGHNDWVSQVRVAPNDKPEDDTVTVISAG 171

Query: 630 KDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLE 689
            D V+K W+  +F      I H + + A+  S DG    S   D  I +W+  + +    
Sbjct: 172 SDKVVKSWNVNQFQIDADFIGHNNYINAIVASPDGSLIASAGKDGEIMMWDLAQKRALYT 231

Query: 690 EEREKEM 696
                E+
Sbjct: 232 LSAHDEV 238

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 66/145 (45%), Gaps = 10/145 (6%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  I++WD+ T      F  H   +  +  D   + +ISGSRD  I +W + GE  L  +
Sbjct: 84  DKTIRLWDVSTGETFQRFVGHKGDVMSVAIDRKASMIISGSRDKTIKVWSIKGEC-LATM 142

Query: 157 RSHKDSITGIWFENDD-------WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             H D ++ +    +D        +IS   D ++K W++   Q     + H     ++  
Sbjct: 143 LGHNDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSWNVNQFQIDADFIGHNNYINAIVA 202

Query: 210 SDD--LVVTANADSELKIWELDLER 232
           S D  L+ +A  D E+ +W+L  +R
Sbjct: 203 SPDGSLIASAGKDGEIMMWDLAQKR 227

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 74/330 (22%), Positives = 131/330 (39%), Gaps = 59/330 (17%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNIT-------------------TQSCI 420
           L+GH   V S+  S  + N LL+A+ +  L  W +T                    Q C 
Sbjct: 11  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIVQDCA 70

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
            T D  YAL   +               ++L+D+++    + +   H   + S+ +    
Sbjct: 71  LTADGAYALSASW------------DKTIRLWDVSTGETFQ-RFVGHKGDVMSVAIDRKA 117

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
             +I+GS DKT+K W+ + E        + + S++++  +   E  +D ++V  +  D+ 
Sbjct: 118 SMIISGSRDKTIKVWSIKGECLATMLGHNDWVSQVRVAPNDKPE--DDTVTVISAGSDK- 174

Query: 541 LAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFG 600
                    VK + ++  +      GH   + +I  S D  LI ++  D  I +W L   
Sbjct: 175 --------VVKSWNVNQFQIDADFIGHNNYINAIVASPDGSLIASAGKDGEIMMWDLAQK 226

Query: 601 DCHRSLFAHQDAIMNVKFVPQSH----------NFFSCGKDGVIKYWDGVKFDCIQKLIA 650
               +L AH D +  + F P  +            FS    G+I   D +  +      A
Sbjct: 227 RALYTLSAH-DEVFALAFSPNRYWLAAATSSGIKIFSLEPQGII---DNLNPEFAGYTKA 282

Query: 651 HKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
            +    +LA S+DGQ   +   D  IRVW+
Sbjct: 283 AEPHPLSLAWSADGQTLFAGYTDNVIRVWQ 312

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 53/106 (50%), Gaps = 2/106 (1%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
           +++AG +D V+K W++    +   F  H   I  +   P G+ + S  +D  I++WDL  
Sbjct: 167 VISAG-SDKVVKSWNVNQFQIDADFIGHNNYINAIVASPDGSLIASAGKDGEIMMWDLAQ 225

Query: 150 EVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
           +  L  L +H +     +  N  WL + +  G IK++ ++ Q  ++
Sbjct: 226 KRALYTLSAHDEVFALAFSPNRYWLAAATSSG-IKIFSLEPQGIID 270

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 65/157 (41%), Gaps = 15/157 (9%)

Query: 87  ETNLLAAGYADGVIKIW-----DMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           + NLL +   D  +  W     D Q    +  F  H+  +        G   +S S D  
Sbjct: 27  QPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKT 86

Query: 142 IIIWDLVGEVGLCKLRSHKDSITGIWFEND-DWLISTSKDGLIKVWDIKSQQCVETHMAH 200
           I +WD+       +   HK  +  +  +     +IS S+D  IKVW IK  +C+ T + H
Sbjct: 87  IRLWDVSTGETFQRFVGHKGDVMSVAIDRKASMIISGSRDKTIKVWSIKG-ECLATMLGH 145

Query: 201 TTECWSLAIS------DD--LVVTANADSELKIWELD 229
                 + ++      DD   V++A +D  +K W ++
Sbjct: 146 NDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSWNVN 182

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 51/107 (47%), Gaps = 8/107 (7%)

Query: 133 LISGSRDSNIIIWDLVGE-----VGLCKLRSHKDSITGIWFENDD-WLISTSKDGLIKVW 186
           L+S SRD  +I W L G+     V +   + H   +       D  + +S S D  I++W
Sbjct: 31  LLSASRDKTLISWKLTGDDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTIRLW 90

Query: 187 DIKSQQCVETHMAHTTECWSLAI--SDDLVVTANADSELKIWELDLE 231
           D+ + +  +  + H  +  S+AI     ++++ + D  +K+W +  E
Sbjct: 91  DVSTGETFQRFVGHKGDVMSVAIDRKASMIISGSRDKTIKVWSIKGE 137

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 104/233 (44%), Gaps = 16/233 (6%)

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
           ++ +F+  +   +      H   I  +D +SD R L++G  D  VK +NF      +++S
Sbjct: 204 DISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATS 263

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGH 567
              +++R              + +VK  P  +++  +  D T +++ + +    L   GH
Sbjct: 264 FIGHDAR--------------VTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGH 309

Query: 568 KLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFS 627
              + S+    D  LI T+ ADK   IW L  G    SL  H   I    +    +    
Sbjct: 310 SKEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXX 369

Query: 628 CGKDGVIKYWDGVKFDCIQKLIAHKSEVWALAL-SSDGQFFVSVSHDRSIRVW 679
            G DG IK WD  K D ++ ++AHK+ V  L     + +F +S S+D+ I V+
Sbjct: 370 SG-DGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVF 421

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 107/245 (43%), Gaps = 32/245 (13%)

Query: 385 HRTDVRSIDISEDNK-LLAAASNGMLKIWNITTQSC-IRTFDCGY---ALCCKFLPXXXX 439
           H   +  ID S D++ L++   +G++K++N  + S  + T   G+       KF P    
Sbjct: 223 HSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKY 282

Query: 440 XXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQV 499
                     +L+D+ ++  L  +E  H   I+SL   +DG  + T  ADK    W+ + 
Sbjct: 283 IGSASFDTTWRLWDIVTNSELLLQEG-HSKEIYSLSFQTDGSLIATAGADKVGIIWDLRS 341

Query: 500 EKELISS------------STDKYNSR-----------LQMVHD--TTLELGEDILSVKI 534
            K ++S             S + Y              L+ V D  T L     +  +K 
Sbjct: 342 GKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILAHKNVVTDLKF 401

Query: 535 SPED-RFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIK 593
             E+ +FL  S  D  + VF  DS     +L GH   +LSIDIS D + I++   D+++K
Sbjct: 402 EKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKILSIDISSDYQTIVSGGWDRSVK 461

Query: 594 IWGLD 598
           +W ++
Sbjct: 462 LWSME 466

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 82/164 (50%), Gaps = 4/164 (2%)

Query: 69  IDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLII--FNSHTAAITFLKF 126
           I ++     +++ +++  ++  L +G  DG++K+++  + ++ +   F  H A +T +KF
Sbjct: 217 ITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKF 276

Query: 127 DPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTS-KDGLIKV 185
            PS   + S S D+   +WD+V    L     H   I  + F+ D  LI+T+  D +  +
Sbjct: 277 HPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGII 336

Query: 186 WDIKSQQCVETHMAHTTECWSLAISDD-LVVTANADSELKIWEL 228
           WD++S + + + + H    +    S +      + D  +KIW+L
Sbjct: 337 WDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDL 380

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 57/124 (45%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
           A V  +++H     + +   D   ++WD+ T + L++   H+  I  L F   G+ + + 
Sbjct: 269 ARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATA 328

Query: 137 SRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVET 196
             D   IIWDL     +  L  H   I    +  + +    S DG IK+WD++    VET
Sbjct: 329 GADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVET 388

Query: 197 HMAH 200
            +AH
Sbjct: 389 ILAH 392

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 75/156 (48%), Gaps = 5/156 (3%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           E+  L +  + +L+A   AD V  IWD+++   ++    H   I    +  +G +    S
Sbjct: 312 EIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXX-S 370

Query: 138 RDSNIIIWDLVGEVGLCKLRSHKDSITGIWFE--NDDWLISTSKDGLIKVWDIKSQQCVE 195
            D  I IWDL     +  + +HK+ +T + FE  N  +LIS+S D  I V+   S   + 
Sbjct: 371 GDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIH 430

Query: 196 THMAHTTECWSLAISDDL--VVTANADSELKIWELD 229
           T   H  +  S+ IS D   +V+   D  +K+W ++
Sbjct: 431 TLQGHNDKILSIDISSDYQTIVSGGWDRSVKLWSME 466

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 69/170 (40%), Gaps = 10/170 (5%)

Query: 521 TTLEL-GEDILSVK------ISPEDRFLAVSLLDNTVKVFFLDSMK-FFLSLYGHKLPVL 572
           TT++L G  ++S +      ISPE    A       + +F   ++     S   H   + 
Sbjct: 169 TTVQLNGSQVISSRPISKICISPEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKIS 228

Query: 573 SIDISYDSKLIITSSADKNIKIWGLDFGDCH--RSLFAHQDAIMNVKFVPQSHNFFSCGK 630
            ID S DS+ +++   D  +K++  D        S   H   + NVKF P      S   
Sbjct: 229 GIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASF 288

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           D   + WD V    +     H  E+++L+  +DG    +   D+   +W+
Sbjct: 289 DTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWD 338

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 3/92 (3%)

Query: 608 AHQDAIMNVKFVPQSHNFFSCGKDGVIKYW--DGVKFDCIQKLIAHKSEVWALALSSDGQ 665
            H   I  + +   S +  S G+DG++K +  D          I H + V  +      +
Sbjct: 222 THSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQK 281

Query: 666 FFVSVSHDRSIRVWE-ETEDQVFLEEEREKEM 696
           +  S S D + R+W+  T  ++ L+E   KE+
Sbjct: 282 YIGSASFDTTWRLWDIVTNSELLLQEGHSKEI 313

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 119/265 (44%), Gaps = 52/265 (19%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H+  ++SLD   +G +L++GS D+TV+ W+ +  +  +                 TL +
Sbjct: 427 GHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSI 469

Query: 526 GEDILSVKISPED-RFLAVSLLDNTVKVFFLDSMKFFLS---------LYGHKLPVLSID 575
              + +V +SP D +F+A   LD  V+V+  DS   FL            GH+  V S+ 
Sbjct: 470 EYGVTTVAVSPNDGKFIAAGSLDRAVRVW--DSTTGFLVERLDSENELGTGHRDSVYSVV 527

Query: 576 ISYDSKLIITSSADKNIKIWGL-----------DFGD----CHRSLFAHQDAIMNVKFVP 620
            + D   +++ S DK +K+W +           D G     C  +   H+D +++V    
Sbjct: 528 FTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQ 587

Query: 621 QSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQF------FVSVSHDR 674
                 S  KD  I +WD    + +  L  H++ V ++A+++          F + S D 
Sbjct: 588 DDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDC 647

Query: 675 SIRVWEETEDQVFLEEEREKEMDEQ 699
             R+W+ +  ++  EEE+ KE+ E+
Sbjct: 648 KARIWKYS--KISGEEEKIKEVQEE 670

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 105/224 (46%), Gaps = 14/224 (6%)

Query: 467 HDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELG 526
           H + +  +  ++DG+ L TG  +KT + +    + ELI+  +D   +       T+    
Sbjct: 327 HSSVVCCVKFSNDGQFLATG-CNKTTQIYRVS-DGELIAKLSDDSVTSPDTSSATSGSTP 384

Query: 527 ED---ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLI 583
                I SV  SP+  FLA    D  ++++ +   K  + L GH+  V S+D   + + +
Sbjct: 385 STDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKL 444

Query: 584 ITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK-DGVIKYWDGVKF 642
           ++ S D+ ++IW L  G C  +L + +  +  V   P    F + G  D  ++ WD    
Sbjct: 445 VSGSGDRTVRIWDLRTGQCSLTL-SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTG 503

Query: 643 DCIQKL-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
             +++L         H+  V+++  + DG   VS S D+++++W
Sbjct: 504 FLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLW 547

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 103/226 (45%), Gaps = 21/226 (9%)

Query: 36  GQIITSSL-ENINCWDIKTGNLLKTLSD---SIPPGSIDAKYEKPAEVAYLE---YHHET 88
           GQ + +   +    + +  G L+  LSD   + P  S       P+   Y+    +  + 
Sbjct: 340 GQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSPDG 399

Query: 89  NLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLV 148
             LA G  D +I+IWD+Q + ++++   H   +  L + P+G +L+SGS D  + IWDL 
Sbjct: 400 EFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDL- 458

Query: 149 GEVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCVET-------HM 198
              G C L  S +  +T +    +D  ++ + S D  ++VWD  +   VE          
Sbjct: 459 -RTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGT 517

Query: 199 AHTTECWSLAISDDL--VVTANADSELKIWELDLERENGSKLKEKG 242
            H    +S+  + D   VV+ + D  +K+W +     + ++  +KG
Sbjct: 518 GHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKG 563

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 104/235 (44%), Gaps = 28/235 (11%)

Query: 382 LQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDCGYALCC--------K 432
           L+GH  DV S+D      KL++ + +  ++IW++ T  C  T    Y +          K
Sbjct: 425 LKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGK 484

Query: 433 FLPXXXXXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLITG 486
           F+              ++++D  +  ++E  ++       H  +++S+  T DG  +++G
Sbjct: 485 FI------AAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSG 538

Query: 487 SADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLL 546
           S DKTVK WN +      + S DK  S       T +   + +LSV  S +D+++     
Sbjct: 539 SLDKTVKLWNMRHSGNSNNESNDK-GSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSK 597

Query: 547 DNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIKIW 595
           D  +  +  +S    L L GH+  V+S+ ++  S L        T S D   +IW
Sbjct: 598 DRGILFWDKESGNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 58/138 (42%)

Query: 571 VLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK 630
           + S+  S D + + T + DK I+IW +        L  H+  + ++ + P      S   
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSG 449

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEE 690
           D  ++ WD     C   L             +DG+F  + S DR++RVW+ T   +    
Sbjct: 450 DRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERL 509

Query: 691 EREKEMDEQYEEKLLSTL 708
           + E E+   + + + S +
Sbjct: 510 DSENELGTGHRDSVYSVV 527

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 91/234 (38%), Gaps = 59/234 (25%)

Query: 46  INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEY--------HHETNLLAAGYAD 97
           +  WD++TG    TLS                    +EY         ++   +AAG  D
Sbjct: 453 VRIWDLRTGQCSLTLS--------------------IEYGVTTVAVSPNDGKFIAAGSLD 492

Query: 98  GVIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDL--- 147
             +++WD  T  ++   +S       H  ++  + F   G  ++SGS D  + +W++   
Sbjct: 493 RAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHS 552

Query: 148 ----------VGEVGLCKLR--SHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCV 194
                           C++    HKD +  +    DD +++S SKD  I  WD +S   +
Sbjct: 553 GNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPL 612

Query: 195 ETHMAHTTECWSLAISD--------DLVVTANADSELKIWELDLERENGSKLKE 240
                H     S+A+++        ++  T + D + +IW+         K+KE
Sbjct: 613 LMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIWKYSKISGEEEKIKE 666

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 63/155 (40%), Gaps = 25/155 (16%)

Query: 38  IITSSLEN-INCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAG 94
           I   SL+  +  WD  TG L++ L   + +  G  D+ Y        + +  + N + +G
Sbjct: 486 IAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYS-------VVFTRDGNEVVSG 538

Query: 95  YADGVIKIWDMQ---------------TQTVLIIFNSHTAAITFLKFDPSGTRLISGSRD 139
             D  +K+W+M+               + T  + +  H   +  +        ++SGS+D
Sbjct: 539 SLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKD 598

Query: 140 SNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWL 174
             I+ WD      L  L+ H++S+  +   N   L
Sbjct: 599 RGILFWDKESGNPLLMLQGHRNSVISVAVANGSAL 633

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 82/160 (51%), Gaps = 9/160 (5%)

Query: 529 ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSA 588
           I SV  SP+ ++LA    D  ++++ L + K  ++L GH+  + S+D       +++ S 
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 414

Query: 589 DKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK-DGVIKYWDGVKFDCIQK 647
           D+ ++IW L  G C  +L + +D +  V   P    + + G  D  ++ WD      +++
Sbjct: 415 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVER 473

Query: 648 L-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           L         HK  V+++  + DGQ  +S S DRS+++W+
Sbjct: 474 LDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWD 513

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 118/267 (44%), Gaps = 50/267 (18%)

Query: 465 AAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELIS--------SSTDKYNSRLQ 516
           ++ D  I S+  + DG+ L TG+ DK ++ W+   +K L++         S D + +  +
Sbjct: 349 SSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDK 408

Query: 517 MVHDT-----------------TLELGEDILSVKISPED-RFLAVSLLDNTVKVFFLDSM 558
           +V  +                 TL + + + +V +SP D +++A   LD TV+V+  DS 
Sbjct: 409 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVW--DSE 466

Query: 559 KFFLS---------LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL-------DFGDC 602
             FL            GHK  V S+  + D + +I+ S D+++K+W L           C
Sbjct: 467 TGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATC 526

Query: 603 HRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA--- 659
             +   H+D +++V          S  KD  + +WD    + +  L  H++ V ++A   
Sbjct: 527 EVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVN 586

Query: 660 ---LSSDGQFFVSVSHDRSIRVWEETE 683
              L  D   F + S D   R+W+ T+
Sbjct: 587 GFPLGPDVGVFATGSGDCKARIWKYTK 613

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 103/235 (43%), Gaps = 39/235 (16%)

Query: 38  IITSSLENINCWDIKTGNLLKTLSD----------SIPP---GSIDAKYEKPAEVA---- 80
           + T   +    + + TG LL  LSD          S  P   G+ D   E  A +     
Sbjct: 291 LATGCNKTTQVYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNGGENSATIQPASS 350

Query: 81  ---YLE---YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLI 134
              Y+    +  +   LA G  D +I+IWD+ T+ +L+    H   I  L + P+G +L+
Sbjct: 351 SDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLV 410

Query: 135 SGSRDSNIIIWDLVGEVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQ 191
           SGS D  + IWDL    G C L  S +D +T +     D  ++ + S D  ++VWD ++ 
Sbjct: 411 SGSGDRTVRIWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 468

Query: 192 QCVET-------HMAHTTECWSLAISDD--LVVTANADSELKIWELDLERENGSK 237
             VE           H    +S+  + D   V++ + D  +K+W  DL   NG K
Sbjct: 469 FLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLW--DLRGLNGQK 521

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 124/284 (43%), Gaps = 45/284 (15%)

Query: 389 VRSIDISEDNKLLA-AASNGMLKIWNITTQSCIRTFDCG----YALCCKFLPXXXXXXXX 443
           +RS+  S D K LA  A + +++IW++TT+  + T        Y+L   + P        
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSL--DYFPAGDKLVSG 412

Query: 444 XXXXELQLFDLAS---SIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVE 500
                ++++DL +   S+ L  ++     A+       DG+ +  GS D+TV+ W+    
Sbjct: 413 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSP----GDGKYIAAGSLDRTVRVWD---- 464

Query: 501 KELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKF 560
                S T     RL   ++ +    + + SV  + + + +    LD +VK++ L  +  
Sbjct: 465 -----SETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNG 519

Query: 561 F-------LSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAI 613
                   ++  GHK  VLS+  + D + I++ S D+ +  W    G+    L  H++++
Sbjct: 520 QKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSV 579

Query: 614 MNVKFVPQSHNFFSCGKD-GVIKYWDGVKFDCIQKLIAHKSEVW 656
           ++V  V    N F  G D GV     G   DC       K+ +W
Sbjct: 580 ISVAVV----NGFPLGPDVGVFATGSG---DC-------KARIW 609

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 97/228 (42%), Gaps = 52/228 (22%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD++TG    TLS        ++ PG  D KY                 +AAG  D 
Sbjct: 418 VRIWDLRTGQCSLTLSIEDGVTTVAVSPG--DGKY-----------------IAAGSLDR 458

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEV 151
            +++WD +T  ++   +S       H  ++  + F   G  +ISGS D ++ +WDL G  
Sbjct: 459 TVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLN 518

Query: 152 G-----LCKLR--SHKDSITGIWFENDD-WLISTSKDGLIKVWDIKSQQCVETHMAHTTE 203
           G      C++    HKD +  +    DD +++S SKD  +  WD  S   +     H   
Sbjct: 519 GQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNS 578

Query: 204 CWSLAISD--------DLVVTANADSELKIWELDLERE---NGSKLKE 240
             S+A+ +         +  T + D + +IW+   +      G+KL+E
Sbjct: 579 VISVAVVNGFPLGPDVGVFATGSGDCKARIWKYTKKSNPTATGAKLQE 626

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 90/213 (42%), Gaps = 35/213 (16%)

Query: 36  GQIITSSLEN--INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAA 93
           G+ + +  E+  I  WD+ T  +L TL            +E+  ++  L+Y    + L +
Sbjct: 364 GKYLATGAEDKLIRIWDLTTKKILMTLQ----------GHEQ--DIYSLDYFPAGDKLVS 411

Query: 94  GYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGL 153
           G  D  ++IWD++T    +  +      T       G  + +GS D  + +WD   E G 
Sbjct: 412 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD--SETGF 469

Query: 154 CKLR---------SHKDSITGIWFENDD-WLISTSKDGLIKVWDIKS-------QQCVET 196
              R          HKDS+  + F  D   +IS S D  +K+WD++          C  T
Sbjct: 470 LVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVT 529

Query: 197 HMAHTTECWSLAIS--DDLVVTANADSELKIWE 227
           +  H     S+A +  D+ +++ + D  +  W+
Sbjct: 530 YTGHKDFVLSVATTQDDEYILSGSKDRGVLFWD 562

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 100/231 (43%), Gaps = 24/231 (10%)

Query: 380 IELQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALCCKFLPX 436
           + LQGH  D+ S+D     +KL++ + +  ++IW++ T  C  T     G          
Sbjct: 388 MTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 447

Query: 437 XXXXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLITGSADK 490
                       ++++D  +  ++E  ++       H  +++S+  T DG+ +I+GS D+
Sbjct: 448 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDR 507

Query: 491 TVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTV 550
           +VK W+ +        +  K ++  ++ +    +    +LSV  + +D ++     D  V
Sbjct: 508 SVKLWDLR------GLNGQKSHATCEVTYTGHKDF---VLSVATTQDDEYILSGSKDRGV 558

Query: 551 KVFFLDSMKFFLSLYGHKLPVLSIDI------SYDSKLIITSSADKNIKIW 595
             +   S    L L GH+  V+S+ +        D  +  T S D   +IW
Sbjct: 559 LFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 58/138 (42%)

Query: 571 VLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK 630
           + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S   
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSG 414

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEE 690
           D  ++ WD     C   L              DG++  + S DR++RVW+     +    
Sbjct: 415 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERL 474

Query: 691 EREKEMDEQYEEKLLSTL 708
           + E E+   +++ + S +
Sbjct: 475 DSENELSTGHKDSVYSVV 492

 Score = 38.5 bits (88), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 64/150 (42%), Gaps = 20/150 (13%)

Query: 34  SPGQ---IITSSLE-NINCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHE 87
           SPG    I   SL+  +  WD +TG L++ L   + +  G  D+ Y        + +  +
Sbjct: 444 SPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYS-------VVFTRD 496

Query: 88  TNLLAAGYADGVIKIWDMQT-------QTVLIIFNSHTAAITFLKFDPSGTRLISGSRDS 140
              + +G  D  +K+WD++         T  + +  H   +  +        ++SGS+D 
Sbjct: 497 GQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDR 556

Query: 141 NIIIWDLVGEVGLCKLRSHKDSITGIWFEN 170
            ++ WD      L  L+ H++S+  +   N
Sbjct: 557 GVLFWDTASGNPLLMLQGHRNSVISVAVVN 586

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/324 (22%), Positives = 135/324 (41%), Gaps = 89/324 (27%)

Query: 389 VRSIDISEDNKLLA-AASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXX 447
           +RS+  S D K LA  A + +++IW+I  +  +                           
Sbjct: 378 IRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIV--------------------------- 410

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
                     +VL+     H+  I+SLD    G +L++GS D+TV+ W+ +  +  +   
Sbjct: 411 ----------MVLQ----GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL--- 453

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISPED-RFLAVSLLDNTVKVFFLDSMKFFLS--- 563
                         TL + + + +V +SP D +F+A   LD  V+V+  DS   FL    
Sbjct: 454 --------------TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW--DSETGFLVERL 497

Query: 564 ------LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDF------------GDCHRS 605
                   GHK  V S+  + D   +++ S D+++K+W L              G C  +
Sbjct: 498 DSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSSSGKPTPGTCEVT 557

Query: 606 LFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSS--- 662
              H+D +++V          S  KD  + +WD    + +  L  H++ V ++A+++   
Sbjct: 558 YTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFP 617

Query: 663 -DGQF--FVSVSHDRSIRVWEETE 683
              Q+  F + S D   R+W+ T+
Sbjct: 618 LGPQYGVFATGSGDCKARIWKYTK 641

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 107/244 (43%), Gaps = 29/244 (11%)

Query: 462 NKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDT 521
           +K   H + +  +  ++DG  L TG  +KT + +    +  LI+  +D   S++     +
Sbjct: 295 HKSLDHTSVVCCVRFSNDGEYLATG-CNKTTQVFRVS-DGALIARLSDDAASQVAAPAGS 352

Query: 522 TLELGED------------------ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLS 563
                E                   I SV  SP+ +FLA    D  ++++ +   +  + 
Sbjct: 353 PANADEPNNDVNSFVTAKSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMV 412

Query: 564 LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSH 623
           L GH+  + S+D       +++ S D+ ++IW L  G C  +L + +D +  V   P   
Sbjct: 413 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDG 471

Query: 624 NFFSCGK-DGVIKYWDGVKFDCIQKL-------IAHKSEVWALALSSDGQFFVSVSHDRS 675
            F + G  D  ++ WD      +++L         HK  V+++  + DG   VS S DRS
Sbjct: 472 KFIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRS 531

Query: 676 IRVW 679
           +++W
Sbjct: 532 VKLW 535

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 82/168 (48%), Gaps = 14/168 (8%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +   LA G  D +I+IWD+  + ++++   H   I  L + PSG +L+SGS D  + 
Sbjct: 383 FSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 442

Query: 144 IWDLVGEVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCVET---- 196
           IWDL    G C L  S +D +T +     D  ++ + S D  ++VWD ++   VE     
Sbjct: 443 IWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSE 500

Query: 197 ---HMAHTTECWSLAISDD--LVVTANADSELKIWELDLERENGSKLK 239
                 H    +S+  + D   VV+ + D  +K+W L  ++ N S  K
Sbjct: 501 NELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSSSGK 548

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 103/233 (44%), Gaps = 57/233 (24%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD++TG    TLS        ++ PG  D K+                 +AAG  D 
Sbjct: 441 VRIWDLRTGQCSLTLSIEDGVTTVAVSPG--DGKF-----------------IAAGSLDR 481

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE- 150
            +++WD +T  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L G+ 
Sbjct: 482 AVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDK 541

Query: 151 ---------VGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETHM 198
                     G C++    HKD +  +   +ND +++S SKD  +  WD +S   +    
Sbjct: 542 NNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLLMLQ 601

Query: 199 AHTTECWSLAISD--------DLVVTANADSELKIWEL---DLERENGSKLKE 240
            H     S+A+++         +  T + D + +IW+    D   ++GSK+KE
Sbjct: 602 GHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWKYTKTDAGIDSGSKIKE 654

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 106/249 (42%), Gaps = 26/249 (10%)

Query: 374 ASKLYTIELQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALC 430
           A K   + LQGH  D+ S+D     +KL++ + +  ++IW++ T  C  T     G    
Sbjct: 405 AKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTV 464

Query: 431 CKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLI 484
                             ++++D  +  ++E  ++       H  +++S+  T DG  ++
Sbjct: 465 AVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVV 524

Query: 485 TGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVS 544
           +GS D++VK WN + +K   SSS        ++ +    +    +LSV  +  D+++   
Sbjct: 525 SGSLDRSVKLWNLRGDKN-NSSSGKPTPGTCEVTYTGHKDF---VLSVATTQNDQYILSG 580

Query: 545 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIKIW--- 595
             D  V  +   S    L L GH+  V+S+ ++    L        T S D   +IW   
Sbjct: 581 SKDRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWKYT 640

Query: 596 ----GLDFG 600
               G+D G
Sbjct: 641 KTDAGIDSG 649

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 64/128 (50%), Gaps = 14/128 (10%)

Query: 126 FDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGI-WFENDDWLISTSKDGLIK 184
           F P G  L +G+ D  I IWD+  +  +  L+ H+  I  + +F + D L+S S D  ++
Sbjct: 383 FSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 442

Query: 185 VWDIKSQQCVETHMAHTTECWSLAISDD---LVVTANADSELKIWE---------LDLER 232
           +WD+++ QC  T ++      ++A+S      +   + D  +++W+         LD E 
Sbjct: 443 IWDLRTGQCSLT-LSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSEN 501

Query: 233 ENGSKLKE 240
           E G+  K+
Sbjct: 502 ELGTGHKD 509

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 57/138 (41%)

Query: 571 VLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK 630
           + S+  S D K + T + D+ I+IW +        L  H+  I ++ + P      S   
Sbjct: 378 IRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 437

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEE 690
           D  ++ WD     C   L              DG+F  + S DR++RVW+     +    
Sbjct: 438 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERL 497

Query: 691 EREKEMDEQYEEKLLSTL 708
           + E E+   +++ + S +
Sbjct: 498 DSENELGTGHKDSVYSVV 515

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 89/218 (40%), Gaps = 40/218 (18%)

Query: 36  GQIITSSLEN--INCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAA 93
           G+ + +  E+  I  WDI    ++  L            +E+  ++  L+Y    + L +
Sbjct: 387 GKFLATGAEDRLIRIWDIAKKQIVMVLQG----------HEQ--DIYSLDYFPSGDKLVS 434

Query: 94  GYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGL 153
           G  D  ++IWD++T    +  +      T       G  + +GS D  + +WD   E G 
Sbjct: 435 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD--SETGF 492

Query: 154 CKLR---------SHKDSITGIWFEND-DWLISTSKDGLIKVWDIKSQQ----------- 192
              R          HKDS+  + F  D + ++S S D  +K+W+++  +           
Sbjct: 493 LVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSSSGKPTPG 552

Query: 193 -CVETHMAHTTECWSLAIS--DDLVVTANADSELKIWE 227
            C  T+  H     S+A +  D  +++ + D  +  W+
Sbjct: 553 TCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWD 590

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 66/155 (42%), Gaps = 25/155 (16%)

Query: 34  SPGQ---IITSSLEN-INCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHE 87
           SPG    I   SL+  +  WD +TG L++ L   + +  G  D+ Y        + +  +
Sbjct: 467 SPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYS-------VVFTRD 519

Query: 88  TNLLAAGYADGVIKIWDMQ------------TQTVLIIFNSHTAAITFLKFDPSGTRLIS 135
            N + +G  D  +K+W+++              T  + +  H   +  +    +   ++S
Sbjct: 520 GNGVVSGSLDRSVKLWNLRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILS 579

Query: 136 GSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN 170
           GS+D  ++ WD      L  L+ H++S+  +   N
Sbjct: 580 GSKDRGVLFWDTQSGNPLLMLQGHRNSVISVAVAN 614

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 132/322 (40%), Gaps = 88/322 (27%)

Query: 389 VRSIDISEDNKLLA-AASNGMLKIWNITTQSCIRTFDCGYALCCKFLPXXXXXXXXXXXX 447
           +RS+  S D K LA  A + +++IW+I  +  +                           
Sbjct: 465 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIV--------------------------- 497

Query: 448 ELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSS 507
                     +VL+     H+  I+SLD    G +L++GS D+TV+ W+ +         
Sbjct: 498 ----------MVLQ----GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR--------- 534

Query: 508 TDKYNSRLQMVHDTTLELGEDILSVKISPED-RFLAVSLLDNTVKVFFLDSMKFFLS--- 563
               N +  +    TL + + + +V +SP D +++A   LD  V+V+  DS   FL    
Sbjct: 535 ----NGQCSL----TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERL 584

Query: 564 ------LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDF-----------GDCHRSL 606
                   GHK  V S+  + D   +++ S D+++K+W L             G C  + 
Sbjct: 585 DSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVKPNVPGTCEVTY 644

Query: 607 FAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA------L 660
             H+D +++V          S  KD  + +WD    + +  L  H++ V ++A      L
Sbjct: 645 TGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGFPL 704

Query: 661 SSDGQFFVSVSHDRSIRVWEET 682
             +   F + S D   R+W+ T
Sbjct: 705 GPNVGVFATGSGDCKARIWKYT 726

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 77/157 (49%), Gaps = 14/157 (8%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +   LA G  D +I+IWD+  + ++++   H   I  L + PSG +L+SGS D  + 
Sbjct: 470 FSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 529

Query: 144 IWDLVGEVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCVET---- 196
           IWDL    G C L  S +D +T +     D  ++ + S D  ++VWD ++   VE     
Sbjct: 530 IWDL--RNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSE 587

Query: 197 ---HMAHTTECWSLAISDDL--VVTANADSELKIWEL 228
                 H    +S+  + D   VV+ + D  +K+W L
Sbjct: 588 NELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNL 624

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 100/233 (42%), Gaps = 57/233 (24%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD++ G    TLS        ++ PG  D KY                 +AAG  D 
Sbjct: 528 VRIWDLRNGQCSLTLSIEDGVTTVAVSPG--DGKY-----------------IAAGSLDR 568

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGE- 150
            +++WD +T  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L G+ 
Sbjct: 569 AVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDN 628

Query: 151 --------VGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETHMA 199
                    G C++    HKD +  +   +ND++++S SKD  +  WD KS   +     
Sbjct: 629 NQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQG 688

Query: 200 HTTECWSLAISD--------DLVVTANADSELKIWELD----LERENGSKLKE 240
           H     S+A+++         +  T + D + +IW+       E  N  K+KE
Sbjct: 689 HRNSVISVAVANGFPLGPNVGVFATGSGDCKARIWKYTRAPATENINDPKIKE 741

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 52/249 (20%), Positives = 102/249 (40%), Gaps = 22/249 (8%)

Query: 374 ASKLYTIELQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALC 430
           A K   + LQGH  D+ S+D     +KL++ + +  ++IW++    C  T     G    
Sbjct: 492 AQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRNGQCSLTLSIEDGVTTV 551

Query: 431 CKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLI 484
                             ++++D  +  ++E  ++       H  +++S+  T DG  ++
Sbjct: 552 AVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVV 611

Query: 485 TGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGED-ILSVKISPEDRFLAV 543
           +GS D++VK WN      L   +       +    + T    +D +LSV  +  D ++  
Sbjct: 612 SGSLDRSVKLWN------LRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILS 665

Query: 544 SLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCH 603
              D  V  +   S    L L GH+  V+S+ ++    L        N+ ++    GDC 
Sbjct: 666 GSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGFPL------GPNVGVFATGSGDCK 719

Query: 604 RSLFAHQDA 612
             ++ +  A
Sbjct: 720 ARIWKYTRA 728

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 64/128 (50%), Gaps = 14/128 (10%)

Query: 126 FDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGI-WFENDDWLISTSKDGLIK 184
           F P G  L +G+ D  I IWD+  +  +  L+ H+  I  + +F + D L+S S D  ++
Sbjct: 470 FSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 529

Query: 185 VWDIKSQQCVETHMAHTTECWSLAISDD---LVVTANADSELKIWE---------LDLER 232
           +WD+++ QC  T ++      ++A+S      +   + D  +++W+         LD E 
Sbjct: 530 IWDLRNGQCSLT-LSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSEN 588

Query: 233 ENGSKLKE 240
           E G+  K+
Sbjct: 589 ELGTGHKD 596

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 57/138 (41%)

Query: 571 VLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK 630
           + S+  S D K + T + D+ I+IW +        L  H+  I ++ + P      S   
Sbjct: 465 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 524

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEE 690
           D  ++ WD     C   L              DG++  + S DR++RVW+     +    
Sbjct: 525 DRTVRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERL 584

Query: 691 EREKEMDEQYEEKLLSTL 708
           + E E+   +++ + S +
Sbjct: 585 DSENELGTGHKDSVYSVV 602

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 70/169 (41%), Gaps = 25/169 (14%)

Query: 82  LEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           L+Y    + L +G  D  ++IWD++     +  +      T       G  + +GS D  
Sbjct: 510 LDYFPSGDKLVSGSGDRTVRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRA 569

Query: 142 IIIWDLVGEVGLCKLR---------SHKDSITGIWFEND-DWLISTSKDGLIKVWDIKSQ 191
           + +WD   E G    R          HKDS+  + F  D + ++S S D  +K+W+++  
Sbjct: 570 VRVWD--SETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGD 627

Query: 192 Q-----------CVETHMAHTTECWSLAIS--DDLVVTANADSELKIWE 227
                       C  T+  H     S+A +  D+ +++ + D  +  W+
Sbjct: 628 NNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 676

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 66/154 (42%), Gaps = 24/154 (15%)

Query: 34  SPGQ---IITSSLEN-INCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHE 87
           SPG    I   SL+  +  WD +TG L++ L   + +  G  D+ Y        + +  +
Sbjct: 554 SPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYS-------VVFTRD 606

Query: 88  TNLLAAGYADGVIKIWDMQ-----------TQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
            N + +G  D  +K+W+++             T  + +  H   +  +    +   ++SG
Sbjct: 607 GNNVVSGSLDRSVKLWNLRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSG 666

Query: 137 SRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN 170
           S+D  ++ WD      L  L+ H++S+  +   N
Sbjct: 667 SKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVAN 700

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 92/219 (42%), Gaps = 22/219 (10%)

Query: 464 EAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTL 523
           +AAH+  I  LD   DG  L++G  D  VK W+      + S+S ++       V     
Sbjct: 211 DAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWD------MTSNSFEELRGHAGRVS---- 260

Query: 524 ELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLI 583
                   VK+ P  R  A +  D T  ++ L+         GH   V +I    D  L+
Sbjct: 261 -------RVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALL 313

Query: 584 ITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFD 643
            ++  D    IW L  G+    L  H  AI  V + P  +   + G DG ++ WD     
Sbjct: 314 ASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVG 373

Query: 644 CIQKLIAHKSEVWALAL---SSDGQFFVSVSHDRSIRVW 679
               L+AH  +V AL +    ++G F VS  HDR + ++
Sbjct: 374 TESALLAH--QVAALDVKFKKNNGTFLVSCGHDRLVNIF 410

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 83/164 (50%), Gaps = 6/164 (3%)

Query: 68  SIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFD 127
           SIDA +E   ++  L++H + N L +G  D ++K+WDM T         H   ++ +K  
Sbjct: 209 SIDAAHE--GKIGGLDWHPDGNHLLSGGGDNLVKLWDM-TSNSFEELRGHAGRVSRVKVH 265

Query: 128 PSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSK-DGLIKVW 186
           PSG    S S D   I+WDL  +V L     H  ++  I F++D  L++++  D +  +W
Sbjct: 266 PSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIW 325

Query: 187 DIKSQQCVETHMAHTTECWSLAISDD--LVVTANADSELKIWEL 228
           D++S + +     H      +  S +   + TA AD  +++W++
Sbjct: 326 DLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDI 369

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 74/152 (48%), Gaps = 4/152 (2%)

Query: 79  VAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSR 138
           V  + +  +  LLA+   D V  IWD+++   ++    H  AI+ + + P+G +L +   
Sbjct: 301 VYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGA 360

Query: 139 DSNIIIWDLVGEVGLCKLRSHKDSITGIWFE--NDDWLISTSKDGLIKVWDIKSQQCVET 196
           D  + +WD+        L +H+ +   + F+  N  +L+S   D L+ +++  + Q + +
Sbjct: 361 DGTVRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLAS 420

Query: 197 HMAHTTECWSLAISDD--LVVTANADSELKIW 226
              HT   +++ I++D   + +   D  LK W
Sbjct: 421 LEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 89/222 (40%), Gaps = 27/222 (12%)

Query: 381 ELQGHRTDVRSIDISEDNKLLAAASNGMLKI-WNITTQSCIRTFDCGYA---LCCKFLPX 436
           EL+GH   V  + +    +L A+AS  +  I W++  +  ++  + G++       F   
Sbjct: 251 ELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQE-GHSKAVYTIAFQSD 309

Query: 437 XXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFW- 495
                         ++DL S   +   E  H  AI  +D + +G +L T  AD TV+ W 
Sbjct: 310 GALLASAGLDAVCAIWDLRSGEPIMKLEG-HAGAISGVDWSPNGYQLATAGADGTVRVWD 368

Query: 496 --NFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVF 553
             N   E  L++      + + +  + T                  FL     D  V +F
Sbjct: 369 IRNVGTESALLAHQVAALDVKFKKNNGT------------------FLVSCGHDRLVNIF 410

Query: 554 FLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIW 595
             D+ +   SL GH   V ++DI+ D   I +   D+++K W
Sbjct: 411 NADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 58/153 (37%), Gaps = 2/153 (1%)

Query: 529 ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSL-YGHKLPVLSIDISYDSKLIITSS 587
           +  V +  + + LA      ++KV   +++    S+   H+  +  +D   D   +++  
Sbjct: 175 VSQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGG 234

Query: 588 ADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQK 647
            D  +K+W +   +    L  H   +  VK  P      S   D     WD  +   +Q 
Sbjct: 235 GDNLVKLWDM-TSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQL 293

Query: 648 LIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
              H   V+ +A  SDG    S   D    +W+
Sbjct: 294 QEGHSKAVYTIAFQSDGALLASAGLDAVCAIWD 326

>SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963
           bp, 320 aa] {ON} highly similar to with YMR116C
           uniprot|P38011 Saccharomyces cerevisiae YMR116C ASC1 WD
           repeat protein (G- beta like protein) involved in
           translation regulation required for repression of Gcn4p
           activity in the absence of amino-acid starvation core
           component of the ribosome ortholog of mammalian RACK1
          Length = 320

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 98/237 (41%), Gaps = 21/237 (8%)

Query: 455 ASSIVLENKEAAHDAAIWSLDLT-SDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNS 513
           A  +VL      H+  + SL  + +    L++ S DKT+  W    + +        +  
Sbjct: 5   AEVLVLRGTLEGHNGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKG 64

Query: 514 RLQMVHDTTLEL-GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 572
              ++ D T+   GE  LS               D T++++ L + K      GHK  VL
Sbjct: 65  HSHIIQDCTVTADGEYALSAS------------WDKTIRLWELATGKCVKRFVGHKSDVL 112

Query: 573 SIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVP------QSHNFF 626
           S+ I   +  I+++S DK +K+W    G+C  +L  H D +  V+  P      ++    
Sbjct: 113 SVAIDRRATQIVSASRDKTVKVWNT-LGECMVTLLGHNDWVSQVRVAPNEDPEDKTVTVI 171

Query: 627 SCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETE 683
           S G D V+K W+   F      I H + V  +  S DG    S   D  I +W  TE
Sbjct: 172 SAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGSLVASAGKDGQIMLWNLTE 228

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/329 (23%), Positives = 136/329 (41%), Gaps = 57/329 (17%)

Query: 382 LQGHRTDVRSIDIS--EDNKLLAAASNGMLKIWNITT-------------------QSCI 420
           L+GH   V S+  S  + N LL+A+ +  L  W +T                    Q C 
Sbjct: 14  LEGHNGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKGHSHIIQDCT 73

Query: 421 RTFDCGYALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDG 480
            T D  YAL   +               ++L++LA+   ++ +   H + + S+ +    
Sbjct: 74  VTADGEYALSASW------------DKTIRLWELATGKCVK-RFVGHKSDVLSVAIDRRA 120

Query: 481 RRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRF 540
            ++++ S DKTVK WN   E  +     + + S++++  +      ED       PED+ 
Sbjct: 121 TQIVSASRDKTVKVWNTLGECMVTLLGHNDWVSQVRVAPN------ED-------PEDKT 167

Query: 541 LAV--SLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLD 598
           + V  + +D  VKV+ L S +      GH   V ++  S D  L+ ++  D  I +W L 
Sbjct: 168 VTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGSLVASAGKDGQIMLWNLT 227

Query: 599 FGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGV-------IKYWDGVKFDCIQKLIAH 651
                 +L A QD +  + F P  +   +    G+        K  D ++ +      A 
Sbjct: 228 EKTALYTLNA-QDEVFALAFSPNRYWLTAATSSGIKIFNLEERKVVDELRPEFAGYTKAA 286

Query: 652 KSEVWALALSSDGQFFVSVSHDRSIRVWE 680
           +    +L+ S+DGQ   +   D  IRVW+
Sbjct: 287 EPHAISLSWSADGQTLFAGYTDNVIRVWQ 315

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 97  DGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKL 156
           D  I++W++ T   +  F  H + +  +  D   T+++S SRD  + +W+ +GE  +  L
Sbjct: 87  DKTIRLWELATGKCVKRFVGHKSDVLSVAIDRRATQIVSASRDKTVKVWNTLGEC-MVTL 145

Query: 157 RSHKDSITGIWF-ENDD------WLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAI 209
             H D ++ +    N+D       +IS   D ++KVW++ S Q     + H     ++  
Sbjct: 146 LGHNDWVSQVRVAPNEDPEDKTVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTA 205

Query: 210 SDD--LVVTANADSELKIWEL 228
           S D  LV +A  D ++ +W L
Sbjct: 206 SPDGSLVASAGKDGQIMLWNL 226

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 9/122 (7%)

Query: 114 FNSHTAAITFLKFDPSGTRLI-SGSRDSNIIIWDLVGE-----VGLCKLRSHKDSITGIW 167
              H   +T L   P+   L+ S SRD  +I W L G+     V +   + H   I    
Sbjct: 14  LEGHNGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKGHSHIIQDCT 73

Query: 168 FEND-DWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDL--VVTANADSELK 224
              D ++ +S S D  I++W++ + +CV+  + H ++  S+AI      +V+A+ D  +K
Sbjct: 74  VTADGEYALSASWDKTIRLWELATGKCVKRFVGHKSDVLSVAIDRRATQIVSASRDKTVK 133

Query: 225 IW 226
           +W
Sbjct: 134 VW 135

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
           +++AG  D V+K+W++ +  +   F  H   +  +   P G+ + S  +D  I++W+L  
Sbjct: 170 VISAGM-DKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGSLVASAGKDGQIMLWNLTE 228

Query: 150 EVGLCKLRSHKDSITGIWFENDDWLISTSKDGLIKVWDIKSQQCVE 195
           +  L  L +  +     +  N  WL + +  G IK+++++ ++ V+
Sbjct: 229 KTALYTLNAQDEVFALAFSPNRYWLTAATSSG-IKIFNLEERKVVD 273

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 63/156 (40%), Gaps = 15/156 (9%)

Query: 87  ETNLLAAGYADGVIKIW-----DMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSN 141
           + NLL +   D  +  W     D Q    +  F  H+  I        G   +S S D  
Sbjct: 30  QPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKGHSHIIQDCTVTADGEYALSASWDKT 89

Query: 142 IIIWDLVGEVGLCKLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAH 200
           I +W+L     + +   HK  +  +  +     ++S S+D  +KVW+    +C+ T + H
Sbjct: 90  IRLWELATGKCVKRFVGHKSDVLSVAIDRRATQIVSASRDKTVKVWNTLG-ECMVTLLGH 148

Query: 201 TTECWSLAISDD--------LVVTANADSELKIWEL 228
                 + ++ +         V++A  D  +K+W L
Sbjct: 149 NDWVSQVRVAPNEDPEDKTVTVISAGMDKVVKVWNL 184

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 102/217 (47%), Gaps = 18/217 (8%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLEL 525
            H   +  + L   G+ L + S D T + W+ + +KE++          LQ  H      
Sbjct: 273 GHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEIL----------LQEGHS----- 317

Query: 526 GEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIIT 585
            ++I S+    +    A +  D+   ++ L S K  ++L GH  P+ S+D + +   + T
Sbjct: 318 -KEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLAT 376

Query: 586 SSADKNIKIWGLDFGDCH-RSLFAHQDAIMNVKFVPQSHNF-FSCGKDGVIKYWDGVKFD 643
            S D  IKIW L   + +  S+FAH++ + +V++   +  F FS G D +IK  D   ++
Sbjct: 377 GSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHDSKTYE 436

Query: 644 CIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWE 680
            +  L  H  ++  L  S      VS   DR++++W+
Sbjct: 437 SVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWD 473

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 83/157 (52%), Gaps = 5/157 (3%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           E+  L +H + +L A    D +  IWD+++   ++    H   I  L + P+G +L +GS
Sbjct: 319 EIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGS 378

Query: 138 RDSNIIIWDLVGEVGLC-KLRSHKDSITGIWFE--NDDWLISTSKDGLIKVWDIKSQQCV 194
            D  I IWDL  +   C  + +HK+ +T + +E  N  ++ S   D LIK+ D K+ + V
Sbjct: 379 GDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHDSKTYESV 438

Query: 195 ETHMAHTTECWSLAIS--DDLVVTANADSELKIWELD 229
            T   HT +  +L  S   +L+V++  D  +KIW+ D
Sbjct: 439 ATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWDND 475

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 106/237 (44%), Gaps = 25/237 (10%)

Query: 452 FDLASSIV----LENK---EAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELI 504
           +D A SIV    LE K   +AAH   I  ++ ++D   L TG  D  VK + ++ + +L 
Sbjct: 208 WDGAISIVDNMNLERKTHFQAAHVGKIGGIEWSNDEAYLFTGGEDCLVKVFGYE-KNDL- 265

Query: 505 SSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSL 564
            +S D        V D           VK+ P  ++L  S  DNT +++ ++  K  L  
Sbjct: 266 -TSIDTLKGHQGRVSD-----------VKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQ 313

Query: 565 YGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHN 624
            GH   + S+    D  L  T+  D    IW L  G    +L  H   I ++ + P  + 
Sbjct: 314 EGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQ 373

Query: 625 FFSCGKDGVIKYWD--GVKFDCIQKLIAHKSEVWALAL-SSDGQFFVSVSHDRSIRV 678
             +   DG IK WD    + +C   + AHK+ V ++    ++G F  S  +D+ I++
Sbjct: 374 LATGSGDGTIKIWDLRNKESNC-ASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKI 429

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 72/157 (45%), Gaps = 5/157 (3%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQ--TVLIIFNSHTAAITFLKFDPSGTRLI 134
            ++  +E+ ++   L  G  D ++K++  +    T +     H   ++ +K  P G  L 
Sbjct: 232 GKIGGIEWSNDEAYLFTGGEDCLVKVFGYEKNDLTSIDTLKGHQGRVSDVKLHPLGKYLG 291

Query: 135 SGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSK-DGLIKVWDIKSQQC 193
           S S D+   +WD+  +  +     H   I  + F  D  L +T+  D +  +WD++S + 
Sbjct: 292 SSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKN 351

Query: 194 VETHMAHTTECWSL--AISDDLVVTANADSELKIWEL 228
           +   + H    +SL  A +   + T + D  +KIW+L
Sbjct: 352 IMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDL 388

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 92/218 (42%), Gaps = 20/218 (9%)

Query: 382 LQGHRTDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFDCGYA---LCCKFLPXX 437
           L+GH+  V  + +    K L ++S +   ++W+I  +  I     G++       F    
Sbjct: 271 LKGHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEI-LLQEGHSKEIFSLAFHTDG 329

Query: 438 XXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNF 497
                        ++DL S   + N    H   I+SLD   +G +L TGS D T+K W+ 
Sbjct: 330 SLTATAGFDSIGMIWDLRSGKNIMNL-IGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDL 388

Query: 498 QVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDS 557
           +  KE   +S   + + +  V       G             F+  +  D  +K+    +
Sbjct: 389 R-NKESNCASIFAHKNLVTSVQYEKNNGG-------------FVFSAGYDKLIKIHDSKT 434

Query: 558 MKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIW 595
            +   +L GH   +L++D S  S LI++S  D+ +KIW
Sbjct: 435 YESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIW 472

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 74/164 (45%), Gaps = 14/164 (8%)

Query: 74  EKPAEVAYLEYHHETNLLAAGYADGVIKIWD-MQTQTVLIIFNSHTAAITFLKFDPSGTR 132
           E+P  V  L    ++ LLA+G  DG I I D M  +       +H   I  +++      
Sbjct: 188 ERPVSVVKLA--PQSKLLASGSWDGAISIVDNMNLERKTHFQAAHVGKIGGIEWSNDEAY 245

Query: 133 LISGSRDSNIIIW-----DLVGEVGLCKLRSHKDSITGIWFEN-DDWLISTSKDGLIKVW 186
           L +G  D  + ++     DL     +  L+ H+  ++ +       +L S+S D   ++W
Sbjct: 246 LFTGGEDCLVKVFGYEKNDL---TSIDTLKGHQGRVSDVKLHPLGKYLGSSSFDNTWRLW 302

Query: 187 DIKSQQCVETHMAHTTECWSLAISDD--LVVTANADSELKIWEL 228
           DI+ ++ +     H+ E +SLA   D  L  TA  DS   IW+L
Sbjct: 303 DIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDL 346

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 105/235 (44%), Gaps = 25/235 (10%)

Query: 467 HDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELIS--------------SSTDKYN 512
           H + +  +  + DG  L TG  +KT + +      ELI+              +S    N
Sbjct: 399 HSSVVCCVRFSHDGEFLATG-CNKTTQVYKVST-GELIARLSEDASSAPSGADASATSEN 456

Query: 513 SRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVL 572
           ++      T+      I SV  SP+ +FLA    D  ++++ L + +  ++L GH+  + 
Sbjct: 457 AKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIY 516

Query: 573 SIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK-D 631
           S+D       +++ S D+ ++IW L  G C  +L + +D +  V   P      + G  D
Sbjct: 517 SLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKLIAAGSLD 575

Query: 632 GVIKYWDGVKFDCIQKL-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
             ++ WD      +++L         HK  V+++  + DG   VS S DRS+++W
Sbjct: 576 RTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW 630

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 81/170 (47%), Gaps = 16/170 (9%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +   LA G  D +I+IWD+ T+ +++    H   I  L + PSG +L+SGS D  + 
Sbjct: 478 FSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 537

Query: 144 IWDLVGEVGLCKLR-SHKDSITGIWFENDDW--LISTSKDGLIKVWDIKSQQCVET---- 196
           IWDL    G C L  S +D +T +     D   + + S D  +++WD ++   VE     
Sbjct: 538 IWDL--RTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSE 595

Query: 197 ---HMAHTTECWSLAISDD--LVVTANADSELKIWELDLERENGSKLKEK 241
                 H    +S+  + D   VV+ + D  +K+W  +L   NG   + K
Sbjct: 596 NELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW--NLRSANGGTAEGK 643

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/287 (22%), Positives = 124/287 (43%), Gaps = 56/287 (19%)

Query: 465 AAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELIS--------SSTDKYNSRLQ 516
           A+ D  I S+  + DG+ L TG+ DK ++ W+    + +++         S D + S  +
Sbjct: 467 ASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDK 526

Query: 517 MVHDT-----------------TLELGEDILSVKISPED-RFLAVSLLDNTVKVFFLDSM 558
           +V  +                 TL + + + +V +SP D + +A   LD TV+++  DS 
Sbjct: 527 LVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIW--DSE 584

Query: 559 KFFLS---------LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL------------ 597
             FL            GHK  V S+  + D   +++ S D+++K+W L            
Sbjct: 585 TGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKA 644

Query: 598 DFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWA 657
           +      +   H+D +++V          S  KD  + +WD    + +  L  H++ V +
Sbjct: 645 NTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVIS 704

Query: 658 LALSSDGQF------FVSVSHDRSIRVWEETEDQVFLEEEREKEMDE 698
           +A+++D         F + S D   R+W+ ++ Q    E + +E+ E
Sbjct: 705 VAVANDHPLGPEYGVFATGSGDCKARIWKYSK-QTSNAEPKLREVKE 750

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 103/237 (43%), Gaps = 19/237 (8%)

Query: 374 ASKLYTIELQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALC 430
           A++   + LQGH  D+ S+D     +KL++ + +  ++IW++ T  C  T     G    
Sbjct: 500 ATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTV 559

Query: 431 CKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLI 484
                             ++++D  +  ++E  ++       H  +++S+  T DG  ++
Sbjct: 560 AVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVV 619

Query: 485 TGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVS 544
           +GS D++VK WN +       ++  K N+    V  T  +  + +LSV  +  D F+   
Sbjct: 620 SGSLDRSVKLWNLRSANG--GTAEGKANTAASEVTYTGHK--DFVLSVATTQNDEFILSG 675

Query: 545 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIKIW 595
             D  V  +   S    L L GH+  V+S+ ++ D  L        T S D   +IW
Sbjct: 676 SKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 732

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 96/231 (41%), Gaps = 55/231 (23%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD++TG    TLS        ++ PG  D K                 L+AAG  D 
Sbjct: 536 VRIWDLRTGQCSLTLSIEDGVTTVAVSPG--DGK-----------------LIAAGSLDR 576

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEV 151
            ++IWD +T  ++   +S       H  ++  + F   G  ++SGS D ++ +W+L    
Sbjct: 577 TVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSAN 636

Query: 152 GLCK------------LRSHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVETHM 198
           G                  HKD +  +   +ND++++S SKD  +  WD  S   +    
Sbjct: 637 GGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQ 696

Query: 199 AHTTECWSLAISDD--------LVVTANADSELKIWELDLERENG-SKLKE 240
            H     S+A+++D        +  T + D + +IW+   +  N   KL+E
Sbjct: 697 GHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQTSNAEPKLRE 747

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 117/279 (41%), Gaps = 49/279 (17%)

Query: 389 VRSIDISEDNKLLA-AASNGMLKIWNITTQSCIRTFDCG----YALCCKFLPXXXXXXXX 443
           +RS+  S D K LA  A + +++IW++ T+  + T        Y+L   + P        
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSL--DYFPSGDKLVSG 530

Query: 444 XXXXELQLFDLAS---SIVLENKEAAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVE 500
                ++++DL +   S+ L  ++     A+       DG+ +  GS D+TV+ W+    
Sbjct: 531 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSP----GDGKLIAAGSLDRTVRIWD---- 582

Query: 501 KELISSSTDKYNSRLQMVHDTTLELG----EDILSVKISPEDRFLAVSLLDNTVKVFFLD 556
                S T     RL    D+  ELG    + + SV  + +   +    LD +VK++ L 
Sbjct: 583 -----SETGFLVERL----DSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLR 633

Query: 557 SMKFF------------LSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHR 604
           S                ++  GHK  VLS+  + + + I++ S D+ +  W    G+   
Sbjct: 634 SANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLL 693

Query: 605 SLFAHQDAIMNVKFV------PQSHNFFSCGKDGVIKYW 637
            L  H++++++V         P+   F +   D   + W
Sbjct: 694 MLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIW 732

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 57/138 (41%)

Query: 571 VLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK 630
           + S+  S D K + T + DK I+IW L       +L  H+  I ++ + P      S   
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 532

Query: 631 DGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEE 690
           D  ++ WD     C   L              DG+   + S DR++R+W+     +    
Sbjct: 533 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERL 592

Query: 691 EREKEMDEQYEEKLLSTL 708
           + E E+   +++ + S +
Sbjct: 593 DSENELGTGHKDSVYSVV 610

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 75/183 (40%), Gaps = 32/183 (17%)

Query: 34  SPGQ---IITSSLE-NINCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHE 87
           SPG    I   SL+  +  WD +TG L++ L   + +  G  D+ Y        + +  +
Sbjct: 562 SPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYS-------VVFTRD 614

Query: 88  TNLLAAGYADGVIKIWDMQ------------TQTVLIIFNSHTAAITFLKFDPSGTRLIS 135
            + + +G  D  +K+W+++            T    + +  H   +  +    +   ++S
Sbjct: 615 GHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILS 674

Query: 136 GSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWL-------ISTSKDGLIKVWDI 188
           GS+D  ++ WD      L  L+ H++S+  +   ND  L        + S D   ++W  
Sbjct: 675 GSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKY 734

Query: 189 KSQ 191
             Q
Sbjct: 735 SKQ 737

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 77/159 (48%), Gaps = 9/159 (5%)

Query: 529 ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSA 588
           I SV  SP+ +FLA    D  ++++ +   K  + L GH   V S+D       +++ S 
Sbjct: 386 IRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSG 445

Query: 589 DKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK-DGVIKYWDGVKFDCIQK 647
           D+ ++IW L  G C  +L + +D +  V   P    F + G  D  ++ WD      +++
Sbjct: 446 DRTVRIWDLKTGQCSLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVER 504

Query: 648 L-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
           L         HK  V+++  + DG   VS S DRS+++W
Sbjct: 505 LDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLW 543

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 77/151 (50%), Gaps = 14/151 (9%)

Query: 90  LLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
            LA G  D +I+IWD+Q + ++++   H   +  L + PSG +L+SGS D  + IWDL  
Sbjct: 397 FLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDL-- 454

Query: 150 EVGLCKLR-SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQQCVET-------HMA 199
           + G C L  S +D +T +     D  ++ + S D  ++VWD ++   VE           
Sbjct: 455 KTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGTG 514

Query: 200 HTTECWSLAISDD--LVVTANADSELKIWEL 228
           H    +S+  + D   VV+ + D  +K+W L
Sbjct: 515 HKDSVYSVVFTKDGNKVVSGSLDRSVKLWNL 545

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 113/270 (41%), Gaps = 57/270 (21%)

Query: 466 AHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELI--------SSSTDKYNSRLQM 517
           ++D  I S+  + DG+ L TG+ DK ++ W+ Q  K ++          S D + S  ++
Sbjct: 381 SNDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKL 440

Query: 518 VHDT-----------------TLELGEDILSVKISPED-RFLAVSLLDNTVKVFFLDSMK 559
           V  +                 TL + + + +V +SP D +F+A   LD  V+V+  DS  
Sbjct: 441 VSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW--DSET 498

Query: 560 FFLS---------LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGL------------- 597
            FL            GHK  V S+  + D   +++ S D+++K+W L             
Sbjct: 499 GFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNANSSSNNSN 558

Query: 598 -DFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVW 656
                C  +   H+D +++V          S  KD  + +WD    + +  L  H++ V 
Sbjct: 559 KSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVI 618

Query: 657 ALA------LSSDGQFFVSVSHDRSIRVWE 680
           ++A      L    Q F + S D   R+W+
Sbjct: 619 SVAVANRTPLGPKYQVFATGSGDCRARIWK 648

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 103/230 (44%), Gaps = 19/230 (8%)

Query: 382 LQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALCCKFLPXXX 438
           LQGH  DV S+D     +KL++ + +  ++IW++ T  C  T     G            
Sbjct: 421 LQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGK 480

Query: 439 XXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLITGSADKTV 492
                     ++++D  +  ++E  ++       H  +++S+  T DG ++++GS D++V
Sbjct: 481 FIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSV 540

Query: 493 KFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGED-ILSVKISPEDRFLAVSLLDNTVK 551
           K WN    ++  ++S+   +++     D T    +D +LSV  +  D ++     D  V 
Sbjct: 541 KLWNL---RDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVL 597

Query: 552 VFFLDSMKFFLSLYGHKLPVLSIDISYDSKL------IITSSADKNIKIW 595
            +   S    L L GH+  V+S+ ++  + L        T S D   +IW
Sbjct: 598 FWDTKSGNPLLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIW 647

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 90/220 (40%), Gaps = 56/220 (25%)

Query: 46  INCWDIKTGNLLKTLS-------DSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADG 98
           +  WD+KTG    TLS        ++ PG  D K+                 +AAG  D 
Sbjct: 449 VRIWDLKTGQCSLTLSIEDGVTTVAVSPG--DGKF-----------------IAAGSLDR 489

Query: 99  VIKIWDMQTQTVLIIFNS-------HTAAITFLKFDPSGTRLISGSRDSNIIIWDL---- 147
            +++WD +T  ++   +S       H  ++  + F   G +++SGS D ++ +W+L    
Sbjct: 490 AVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNN 549

Query: 148 --------VGEVGLCKLR--SHKDSITGIWF-ENDDWLISTSKDGLIKVWDIKSQQCVET 196
                         C +    HKD +  +    ND++++S SKD  +  WD KS   +  
Sbjct: 550 ANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNPLLM 609

Query: 197 HMAHTTECWSLAISD--------DLVVTANADSELKIWEL 228
              H     S+A+++         +  T + D   +IW+ 
Sbjct: 610 LQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWKF 649

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 57/140 (40%)

Query: 569 LPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSC 628
           L + S+  S D K + T + DK I+IW +        L  H   + ++ + P      S 
Sbjct: 384 LYIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSG 443

Query: 629 GKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQFFVSVSHDRSIRVWEETEDQVFL 688
             D  ++ WD     C   L              DG+F  + S DR++RVW+     +  
Sbjct: 444 SGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVE 503

Query: 689 EEEREKEMDEQYEEKLLSTL 708
             + E E+   +++ + S +
Sbjct: 504 RLDSENELGTGHKDSVYSVV 523

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 66/157 (42%), Gaps = 27/157 (17%)

Query: 34  SPGQ---IITSSLEN-INCWDIKTGNLLKTL--SDSIPPGSIDAKYEKPAEVAYLEYHHE 87
           SPG    I   SL+  +  WD +TG L++ L   + +  G  D+ Y        + +  +
Sbjct: 475 SPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYS-------VVFTKD 527

Query: 88  TNLLAAGYADGVIKIWDMQ--------------TQTVLIIFNSHTAAITFLKFDPSGTRL 133
            N + +G  D  +K+W+++                T  + +  H   +  +    +   +
Sbjct: 528 GNKVVSGSLDRSVKLWNLRDNNANSSSNNSNKSNATCDVTYVGHKDFVLSVTTTANDEYI 587

Query: 134 ISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFEN 170
           +SGS+D  ++ WD      L  L+ H++S+  +   N
Sbjct: 588 LSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVAN 624

>Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AEL269C
          Length = 465

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 138/313 (44%), Gaps = 27/313 (8%)

Query: 376 KLYTIELQGHR----TDVRSIDISEDNKLLAAAS-NGMLKIWNITTQSCIRTFD---CGY 427
           KL T+EL G +      V  + +S+D+  +A+ +  G +K+ N  T   +++FD    G 
Sbjct: 167 KLRTLELAGSQLVAEKPVSEVCVSKDDVYVASGNWGGHIKVLNSDTLDIVKSFDNVHSGK 226

Query: 428 ALCCKFLPXXXXXXXXXXXXELQLFDLASSIVLENKEAAHDAAIWSLDLTSDGRRLITGS 487
                + P             +++ +L      E K+  H   +  +     G+   + S
Sbjct: 227 VCGLDWHPTANSLLSGGADNLVKITNLDQGSCAELKD--HVGRVCKVKFHPSGKFAASAS 284

Query: 488 ADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDRFLAVSLLD 547
            D T   W+  +EK L          +LQ  H        ++ ++    +   LA   LD
Sbjct: 285 FDMTWILWD--LEKALAI--------QLQEGHS------REVFTLGFQTDGSLLASGGLD 328

Query: 548 NTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSLF 607
           +   ++ L S +  ++L GH+ P+  +D S +   + T+S D +IKIW L       +L 
Sbjct: 329 SIGLIWDLRSGEPIMNLVGHQKPIYGLDWSPNGYQVATASGDGSIKIWDLRKQSIVSTLL 388

Query: 608 AHQDAIMNVKF-VPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQF 666
           AH++   ++KF     H   S G D  +K ++   ++ I+ L  H  ++ ++ L SDG  
Sbjct: 389 AHRNVAFDIKFDKANGHFLVSGGYDRELKIFNADNWELIKTLEGHTDKILSVDLVSDGSK 448

Query: 667 FVSVSHDRSIRVW 679
           F S   DR+++ W
Sbjct: 449 FFSTGWDRTVKQW 461

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 72/157 (45%), Gaps = 4/157 (2%)

Query: 77  AEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISG 136
             V  +++H      A+   D    +WD++    + +   H+  +  L F   G+ L SG
Sbjct: 266 GRVCKVKFHPSGKFAASASFDMTWILWDLEKALAIQLQEGHSREVFTLGFQTDGSLLASG 325

Query: 137 SRDSNIIIWDLVGEVGLCKLRSHKDSITGI-WFENDDWLISTSKDGLIKVWDIKSQQCVE 195
             DS  +IWDL     +  L  H+  I G+ W  N   + + S DG IK+WD++ Q  V 
Sbjct: 326 GLDSIGLIWDLRSGEPIMNLVGHQKPIYGLDWSPNGYQVATASGDGSIKIWDLRKQSIVS 385

Query: 196 THMAHTTECWSLAI---SDDLVVTANADSELKIWELD 229
           T +AH    + +     +   +V+   D ELKI+  D
Sbjct: 386 TLLAHRNVAFDIKFDKANGHFLVSGGYDRELKIFNAD 422

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 78/155 (50%), Gaps = 4/155 (2%)

Query: 78  EVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGS 137
           EV  L +  + +LLA+G  D +  IWD+++   ++    H   I  L + P+G ++ + S
Sbjct: 309 EVFTLGFQTDGSLLASGGLDSIGLIWDLRSGEPIMNLVGHQKPIYGLDWSPNGYQVATAS 368

Query: 138 RDSNIIIWDLVGEVGLCKLRSHKDSITGIWFE--NDDWLISTSKDGLIKVWDIKSQQCVE 195
            D +I IWDL  +  +  L +H++    I F+  N  +L+S   D  +K+++  + + ++
Sbjct: 369 GDGSIKIWDLRKQSIVSTLLAHRNVAFDIKFDKANGHFLVSGGYDRELKIFNADNWELIK 428

Query: 196 THMAHTTECWSLAISDD--LVVTANADSELKIWEL 228
           T   HT +  S+ +  D     +   D  +K W L
Sbjct: 429 TLEGHTDKILSVDLVSDGSKFFSTGWDRTVKQWTL 463

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 69/143 (48%), Gaps = 7/143 (4%)

Query: 91  LAAGYADGVIKIWDMQTQTVLIIF-NSHTAAITFLKFDPSGTRLISGSRDSNIIIWDLVG 149
           +A+G   G IK+ +  T  ++  F N H+  +  L + P+   L+SG  D+ + I +L  
Sbjct: 196 VASGNWGGHIKVLNSDTLDIVKSFDNVHSGKVCGLDWHPTANSLLSGGADNLVKITNL-- 253

Query: 150 EVGLC-KLRSHKDSITGIWFE-NDDWLISTSKDGLIKVWDIKSQQCVETHMAHTTECWSL 207
           + G C +L+ H   +  + F  +  +  S S D    +WD++    ++    H+ E ++L
Sbjct: 254 DQGSCAELKDHVGRVCKVKFHPSGKFAASASFDMTWILWDLEKALAIQLQEGHSREVFTL 313

Query: 208 AISDD--LVVTANADSELKIWEL 228
               D  L+ +   DS   IW+L
Sbjct: 314 GFQTDGSLLASGGLDSIGLIWDL 336

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 52/134 (38%), Gaps = 1/134 (0%)

Query: 547 DNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHRSL 606
           DN VK+  LD       L  H   V  +      K   ++S D    +W L+     +  
Sbjct: 245 DNLVKITNLDQGSC-AELKDHVGRVCKVKFHPSGKFAASASFDMTWILWDLEKALAIQLQ 303

Query: 607 FAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALALSSDGQF 666
             H   +  + F        S G D +   WD    + I  L+ H+  ++ L  S +G  
Sbjct: 304 EGHSREVFTLGFQTDGSLLASGGLDSIGLIWDLRSGEPIMNLVGHQKPIYGLDWSPNGYQ 363

Query: 667 FVSVSHDRSIRVWE 680
             + S D SI++W+
Sbjct: 364 VATASGDGSIKIWD 377

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 79/159 (49%), Gaps = 9/159 (5%)

Query: 529 ILSVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSA 588
           I SV  SP+ +FLA    D  ++++ L + +  ++L GH+  + S+D       +++ S 
Sbjct: 451 IRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 510

Query: 589 DKNIKIWGLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGK-DGVIKYWDGVKFDCIQK 647
           D+ ++IW L  G C  +L + +D +  V   P      + G  D  ++ WD      +++
Sbjct: 511 DRTVRIWDLRAGQCSLTL-SIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVER 569

Query: 648 L-------IAHKSEVWALALSSDGQFFVSVSHDRSIRVW 679
           L         HK  V+++  + DG   VS S DRS+++W
Sbjct: 570 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW 608

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 81/170 (47%), Gaps = 16/170 (9%)

Query: 84  YHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSRDSNII 143
           +  +   LA G  D +I+IWD+ T+ +++    H   I  L + PSG +L+SGS D  + 
Sbjct: 456 FSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 515

Query: 144 IWDLVGEVGLCKLR-SHKDSITGIWFENDDW--LISTSKDGLIKVWDIKSQQCVET---- 196
           IWDL    G C L  S +D +T +     D   + + S D  +++WD ++   VE     
Sbjct: 516 IWDL--RAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSE 573

Query: 197 ---HMAHTTECWSLAISDD--LVVTANADSELKIWELDLERENGSKLKEK 241
                 H    +S+  + D   VV+ + D  +K+W  +L   NG   + K
Sbjct: 574 NELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLW--NLRSANGGSTEGK 621

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 61/272 (22%), Positives = 117/272 (43%), Gaps = 55/272 (20%)

Query: 465 AAHDAAIWSLDLTSDGRRLITGSADKTVKFWNFQVEKELIS--------SSTDKYNSRLQ 516
           A+ D  I S+  + DG+ L TG+ DK ++ W+    + +++         S D + S  +
Sbjct: 445 ASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDK 504

Query: 517 MVHDT-----------------TLELGEDILSVKISPED-RFLAVSLLDNTVKVFFLDSM 558
           +V  +                 TL + + + +V +SP D + +A   LD TV+++  DS 
Sbjct: 505 LVSGSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIW--DSE 562

Query: 559 KFFLS---------LYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDFGDCHR----- 604
             FL            GHK  V S+  + D   +++ S D+++K+W L   +        
Sbjct: 563 TGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTEGKA 622

Query: 605 -------SLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWA 657
                  +   H+D +++V          S  KD  + +WD    + +  L  H++ V +
Sbjct: 623 NTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVIS 682

Query: 658 LALSSDGQF------FVSVSHDRSIRVWEETE 683
           +A+++D         F + S D   R+W+ T+
Sbjct: 683 VAVANDHPLGPEYGVFATGSGDCKARIWKYTK 714

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 99/231 (42%), Gaps = 19/231 (8%)

Query: 380 IELQGHRTDVRSID-ISEDNKLLAAASNGMLKIWNITTQSCIRTFDC--GYALCCKFLPX 436
           + LQGH  D+ S+D     +KL++ + +  ++IW++    C  T     G          
Sbjct: 484 MTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGD 543

Query: 437 XXXXXXXXXXXELQLFDLASSIVLENKEA------AHDAAIWSLDLTSDGRRLITGSADK 490
                       ++++D  +  ++E  ++       H  +++S+  T DG  +++GS D+
Sbjct: 544 GKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTR