Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_42538.322ON25825813710.0
AGL194C8.322ON2562577237e-96
SAKL0H15576g8.322ON2822565746e-73
Kwal_56.239148.322ON2652525432e-68
KLLA0D16346g8.322ON3012565113e-63
YLR128W (DCN1)8.322ON2692604885e-60
KLTH0G12320g8.322ON2542444702e-57
TDEL0F044808.322ON2602514571e-55
KAFR0H022708.322ON2682624312e-51
Kpol_1036.688.322ON2562534292e-51
ZYRO0F10362g8.322ON2512504241e-50
TPHA0C008208.322ON2662604233e-50
NDAI0G025908.322ON2862824183e-49
KNAG0G024408.322ON2652564092e-48
CAGL0M04257g8.322ON2732704051e-47
Skud_12.1978.322ON1791803902e-46
Suva_10.2218.322ON1781793883e-46
TBLA0A039308.322ON2662583814e-44
NCAS0C032708.322ON1841813641e-42
Smik_12.1918.322ON1251262364e-24
Suva_1.517.88ON631114860.027
Skud_1.457.88ON62999850.035
YAL016W (TPD3)7.88ON63599830.061
Smik_1.517.88ON63299820.077
TDEL0H036207.88ON609106800.13
TDEL0D03450singletonON19569720.81
KLTH0E14784g3.330ON1082121731.0
KLLA0E17865g3.125ON294118701.8
KAFR0J019402.186ON87995711.8
ABL047W2.464ON43057692.6
NCAS0F015707.88ON606130666.8
ABR108C3.401ON2343114667.0
YBR179C (FZO1)8.573ON855121667.0
Smik_2.3198.573ON8551226510.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4253
         (258 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa] ...   532   0.0  
AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, ...   283   7e-96
SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa] ...   225   6e-73
Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W...   213   2e-68
KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 3...   201   3e-63
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...   192   5e-60
KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315) ...   185   2e-57
TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa...   180   1e-55
KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON...   170   2e-51
Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 ...   169   2e-51
ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 a...   167   1e-50
TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 ...   167   3e-50
NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON...   165   3e-49
KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.32...   162   2e-48
CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} simila...   160   1e-47
Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W...   154   2e-46
Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W...   154   3e-46
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...   151   4e-44
NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON...   144   1e-42
Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W...    96   4e-24
Suva_1.51 Chr1 (101112..103007) [1896 bp, 631 aa] {ON} YAL016W (...    38   0.027
Skud_1.45 Chr1 (100224..102113) [1890 bp, 629 aa] {ON} YAL016W (...    37   0.035
YAL016W Chr1 (124879..126786) [1908 bp, 635 aa] {ON}  TPD3Regula...    37   0.061
Smik_1.51 Chr1 (107810..109708) [1899 bp, 632 aa] {ON} YAL016W (...    36   0.077
TDEL0H03620 Chr8 complement(596794..598623) [1830 bp, 609 aa] {O...    35   0.13 
TDEL0D03450 Chr4 (637245..637832) [588 bp, 195 aa] {ON}                32   0.81 
KLTH0E14784g Chr5 complement(1313245..1316493) [3249 bp, 1082 aa...    33   1.0  
KLLA0E17865g Chr5 (1586485..1587369) [885 bp, 294 aa] {ON} simil...    32   1.8  
KAFR0J01940 Chr10 complement(373125..375764) [2640 bp, 879 aa] {...    32   1.8  
ABL047W Chr2 (308042..309334) [1293 bp, 430 aa] {ON} Syntenic ho...    31   2.6  
NCAS0F01570 Chr6 complement(311148..312968) [1821 bp, 606 aa] {O...    30   6.8  
ABR108C Chr2 complement(581545..588576) [7032 bp, 2343 aa] {ON} ...    30   7.0  
YBR179C Chr2 complement(586547..589114) [2568 bp, 855 aa] {ON}  ...    30   7.0  
Smik_2.319 Chr2 complement(572736..575303) [2568 bp, 855 aa] {ON...    30   10.0 

>Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa]
           {ON} similar to Ashbya gossypii AGL194C 1-intron
          Length = 258

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/258 (100%), Positives = 258/258 (100%)

Query: 1   MQSNARQRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAE 60
           MQSNARQRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAE
Sbjct: 1   MQSNARQRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAE 60

Query: 61  LYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLST 120
           LYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLST
Sbjct: 61  LYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLST 120

Query: 121 WADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTL 180
           WADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTL
Sbjct: 121 WADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTL 180

Query: 181 LFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEM 240
           LFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEM
Sbjct: 181 LFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEM 240

Query: 241 GAWPLIMDEYYGWIKERY 258
           GAWPLIMDEYYGWIKERY
Sbjct: 241 GAWPLIMDEYYGWIKERY 258

>AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, 256
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR128W (DCN1); 1-intron
          Length = 256

 Score =  283 bits (723), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 185/257 (71%), Gaps = 4/257 (1%)

Query: 1   MQSNARQRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAE 60
           MQSNARQR+ I++F+++TS   A AE +L  N WSLD+ALDD YT+       E+ Y AE
Sbjct: 1   MQSNARQRELIREFLAVTSATSAAAETYLERNHWSLDHALDDFYTQSGGGGRAEQ-YSAE 59

Query: 61  LYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLST 120
           L +TF+ YA+  G MDT+ L++YV DLG+QLED  T+CLA+LLKVE LTADI   QFLST
Sbjct: 60  LVATFERYAA-GGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLST 118

Query: 121 WADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTL 180
           W  LGCS+L DM   ++ L+ +L  D  YF+ +Y+YTF + +D   R+LS++TAI+YW+L
Sbjct: 119 WHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSL 178

Query: 181 LFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEM 240
            FLDH++A  +P  RL SWF FLR  + +  V+RDTWDM  +FA +FPDD  LL  Y+E+
Sbjct: 179 FFLDHTYAVTVPAPRLRSWFEFLRAGDHS--VSRDTWDMFPRFAQRFPDDTELLEHYNEL 236

Query: 241 GAWPLIMDEYYGWIKER 257
            +WPL++DEYY W+K R
Sbjct: 237 ASWPLVIDEYYEWVKGR 253

>SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 282

 Score =  225 bits (574), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 110/256 (42%), Positives = 162/256 (63%), Gaps = 2/256 (0%)

Query: 3   SNARQRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLY-TRGTSYLNTERT-YDAE 60
           S A+ ++ I +FMS+T+  + TA K+L+ N W+L YAL++ Y  +   ++N +   Y  E
Sbjct: 22  SMAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFVNKKPVKYSHE 81

Query: 61  LYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLST 120
           L  TF  YA     +  + L+KY+ DLGY LED  TICLA+LLK E +  DI E+QFLS+
Sbjct: 82  LVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSS 141

Query: 121 WADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTL 180
           W + GC N+  M   +  L+ +LH+D  YF  IY+YT+ + V+   R L+IDTA  YW L
Sbjct: 142 WTEHGCKNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYDLIVEESERHLNIDTAAEYWEL 201

Query: 181 LFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEM 240
            F +  +A  I  +RL++W  F  +++  + VT+DTW M  KF +KFPDD++L+  Y EM
Sbjct: 202 FFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEM 261

Query: 241 GAWPLIMDEYYGWIKE 256
            AWPL+ DEYY ++ E
Sbjct: 262 DAWPLVFDEYYEYMDE 277

>Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W -
           Hypothetical ORF [contig 171] FULL
          Length = 265

 Score =  213 bits (543), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 164/252 (65%), Gaps = 5/252 (1%)

Query: 9   KQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLY-TRGTSYLNTERTYDAELYSTFQN 67
           + +++F+++T  ++  A++FL++N W+LDYAL+D Y T    +   +R Y  EL   FQ 
Sbjct: 13  RDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELLKVFQK 72

Query: 68  YASEN-GRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGC 126
           Y SE+   +    L +++ DLG +LEDPVT+CLA+L++  +L  DI  + F+ +W D  C
Sbjct: 73  YKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDRLC 132

Query: 127 SNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFLD-H 185
            N NDM  ++  L+ KL  D  YF++IY+YTF++A++ +++QL ++T+I+YW LLF    
Sbjct: 133 ENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSPAK 192

Query: 186 SFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWPL 245
            +A K+P+ RL+SW ++L    +   V RD W M  KFA+ FPD++ L   YSE  AWPL
Sbjct: 193 PYAIKVPQERLQSWIQYL--SGEVAKVHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPL 250

Query: 246 IMDEYYGWIKER 257
           ++DEYY ++  R
Sbjct: 251 VIDEYYEYLVAR 262

>KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 301
           aa] {ON} similar to uniprot|Q12395 Saccharomyces
           cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 301

 Score =  201 bits (511), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 99/256 (38%), Positives = 156/256 (60%), Gaps = 17/256 (6%)

Query: 12  KQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAELYSTFQNYASE 71
           K+FM++T    + A+++L  N   ++YAL+D Y    +     ++Y+  L + F+ Y+  
Sbjct: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGGMRQSYNPSLVAIFEKYS-- 105

Query: 72  NG----RMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCS 127
           NG      D+  LI+++ DLG  +EDP+T+CL+Q+L +++LT  +  EQFL+ W+DL C 
Sbjct: 106 NGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCD 165

Query: 128 NLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFLDHSF 187
            L  M  Y++TL+ +L  D  YFK+IYSYTF +  D   R L  D AI YW + F D+ +
Sbjct: 166 TLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFFKDNKY 225

Query: 188 ATKIPRTRLESWFRFL-------REQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEM 240
           A KI + RL SW  F+       R+QN    ++ D W M +KF  ++P+D++L   Y EM
Sbjct: 226 ALKISKERLNSWLEFINSDDSDPRKQN----ISNDIWLMFYKFIEQYPNDESLKQNYDEM 281

Query: 241 GAWPLIMDEYYGWIKE 256
            AWPL++DEYY +++E
Sbjct: 282 AAWPLLIDEYYEFLEE 297

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score =  192 bits (488), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 98/260 (37%), Positives = 155/260 (59%), Gaps = 10/260 (3%)

Query: 5   ARQRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTR--GT-----SYLNTERTY 57
           + +++ I+ F S+T  +   + K+L  N W+++YAL+D Y +  GT     S +     Y
Sbjct: 12  SPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVY 71

Query: 58  DAELYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQF 117
             EL   F++Y + N   D D+L+K++ +LGY LED  T+CLA LL  + L   ++ E F
Sbjct: 72  PKELTQVFEHYIN-NNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDF 130

Query: 118 LSTWADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISY 177
           LSTW   GCS ++DM E + TLD KLHED  YF  IY+Y F++ +D  R+ +  D  I Y
Sbjct: 131 LSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQY 190

Query: 178 WTLLFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEY 237
           W  LF    +  ++    LE+WFRFLR++     +++DTW ML  F  ++P  + ++S+Y
Sbjct: 191 WK-LFFQPEYPVRMEPDLLEAWFRFLRDEGKTT-ISKDTWRMLLLFFKRYPTIQKIISDY 248

Query: 238 SEMGAWPLIMDEYYGWIKER 257
            E  AWP I+DE+Y  ++++
Sbjct: 249 DETAAWPFIIDEFYECLQDQ 268

>KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315)
           [765 bp, 254 aa] {ON} similar to uniprot|Q12395
           Saccharomyces cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 254

 Score =  185 bits (470), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 94/244 (38%), Positives = 148/244 (60%), Gaps = 5/244 (2%)

Query: 7   QRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAELYSTFQ 66
           + + I++F+++T  +R+TA  +L++N W+L+YAL+D Y        T R    +L + F 
Sbjct: 2   RNQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGF-TSRPPPPQLLTLFN 60

Query: 67  NYA-SENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLG 125
            Y   E   + TD LI+++ DLG  LEDP T+C+A  +   +L+  + +E F+  W D  
Sbjct: 61  EYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNL 120

Query: 126 CSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLF-LD 184
           C NL  + E +  LD KL  D  YF+ IYS+T+++A++   +QL ++TAI+YW LLF  D
Sbjct: 121 CENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLFPTD 180

Query: 185 HSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWP 244
            ++A +IP+ RL SW  FL    + + +  D W M  KFA  FPD+KTL   Y+E  AWP
Sbjct: 181 GAYAIQIPQKRLCSWTAFL--TRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWP 238

Query: 245 LIMD 248
           +++D
Sbjct: 239 VLID 242

>TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa]
           {ON} Anc_8.322 YLR128W
          Length = 260

 Score =  180 bits (457), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 142/251 (56%), Gaps = 7/251 (2%)

Query: 11  IKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYL----NTERTYDAELYSTFQ 66
           + +F+S+T     TA+ FL  N+W L+YAL+D Y +         +T  TY  EL + + 
Sbjct: 8   VSEFVSLTQCESKTAKDFLRRNQWKLEYALNDYYDQMPGGFIEEPHTPVTYPEELLALYD 67

Query: 67  NYASEN-GRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLG 125
            Y  E+  ++D D +I+ + DL Y+LED VTICLA+LL    L   I ++QFL  W   G
Sbjct: 68  KYVLEDQNKIDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGISKDQFLHNWYMQG 127

Query: 126 CSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFLDH 185
           CS L  M   ++ LDTKLH D  Y   IY+YTF +A+D  +R L  DTA  YW L F   
Sbjct: 128 CSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALDQNKRDLDTDTAAEYWRLFFQPG 187

Query: 186 SFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWPL 245
           + A  +    L SW  FL  +     VTRDTW ML +F  +FP    + + Y+E  AWP 
Sbjct: 188 T-AVHVNPALLNSWLAFLDSEQ-KTVVTRDTWKMLLEFFKQFPSLSAVKTSYNEADAWPY 245

Query: 246 IMDEYYGWIKE 256
           I+DEYY ++++
Sbjct: 246 IIDEYYEYLED 256

>KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON}
           Anc_8.322 YLR128W
          Length = 268

 Score =  170 bits (431), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 143/262 (54%), Gaps = 11/262 (4%)

Query: 5   ARQRKQIKQFMSITSMNRATAEKFLNDNRWSLDYALDDLY-------TRGTSYLNTERTY 57
           + + + I  F+  T    A A K+L+ NRW+++YAL+D Y       T+     N    Y
Sbjct: 4   SMEEEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGFTKEHERSNRRAVY 63

Query: 58  DAELYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQF 117
             EL   F++Y SE+  +D   +IK + D G  +ED  TICLA +L  ENL   I  + F
Sbjct: 64  PKELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDF 123

Query: 118 LSTWADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSI--DTAI 175
           L    + GC  +ND+   +  L+ KL+ DP YF TIY+++F + +D   R  SI  D AI
Sbjct: 124 LQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAI 183

Query: 176 SYWTLLFLDHSF-ATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLL 234
            YW L FL+ S  + +I    L  WF+FL ++     V++D W M+ +F  KF D ++L 
Sbjct: 184 EYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQ-VSKDIWQMILEFFRKFKDLESLK 242

Query: 235 SEYSEMGAWPLIMDEYYGWIKE 256
             Y E   WP ++DE+Y ++++
Sbjct: 243 ESYDENDPWPFVIDEFYEYLQD 264

>Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 aa]
           {ON} (188159..188161,188259..189026) [771 nt, 257 aa]
          Length = 256

 Score =  169 bits (429), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 96/253 (37%), Positives = 149/253 (58%), Gaps = 14/253 (5%)

Query: 12  KQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGT-SYL--NTERTYDAELYSTFQNY 68
           ++F+ +T+ ++  A K+L  N W+L+YAL++ Y +   S+L       Y  EL   F+ Y
Sbjct: 6   EEFIGLTNCDKKVATKYLKRNNWNLNYALNEYYDKEVGSFLVEEEVIEYPEELIQIFKKY 65

Query: 69  ASENGR-MDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCS 127
           +++NG  +DTD  I+ + DL YQLED VTICLA+L+  ++L+  I ++QFLSTW + GCS
Sbjct: 66  SNDNGESIDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQFLSTWYEQGCS 125

Query: 128 NLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFLDHSF 187
            L  M   ++ LD KL  D  Y+  IY Y+F +  D   + +  D AI YW L      F
Sbjct: 126 QLKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLIRDSNEKCIEKDMAIEYWKLF-----F 180

Query: 188 ATKIPRT----RLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAW 243
           ++K P T    +L SW  F+   N+   +TRD W+ L ++  K+P  + L   Y+E+  W
Sbjct: 181 SSKCPITINELQLNSWIEFIN-VNEIESITRDVWERLLEYFKKYPTLEILSKNYNELDPW 239

Query: 244 PLIMDEYYGWIKE 256
           P IMDEYY ++++
Sbjct: 240 PYIMDEYYEFLED 252

>ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 251

 Score =  167 bits (424), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 89/250 (35%), Positives = 141/250 (56%), Gaps = 9/250 (3%)

Query: 11  IKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAELYSTFQNYAS 70
           +  F S+   +  TA  +LN + W ++ AL+D Y    S  + +++Y  EL   F+ YA 
Sbjct: 5   VATFKSLAQCSDRTARDYLNTHNWDVNQALNDYYD---SEHDQDQSYSPELPQLFRKYAV 61

Query: 71  ENGR---MDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCS 127
                  MDTD LI+Y+ DLGY++++  TICLAQLL  + LT  I E QF   W   GC+
Sbjct: 62  VTPHGFIMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGITEGQFSYNWQQNGCT 121

Query: 128 NLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFLDHSF 187
           +L+ M + +  LD KL  D  Y   IY+YTF +A+D   + L   TA+ YWTL F    +
Sbjct: 122 SLHQMGKLVQRLDHKLRTDQDYTAQIYNYTFELALDPGAKTLETHTAVQYWTLFFATGQY 181

Query: 188 ATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWPLIM 247
              + +   + W  F++++     ++RDTW MLF F  +F + +++   Y+E  AWP I+
Sbjct: 182 PVIVEQQFFQLWISFVQQEQS---ISRDTWRMLFPFFNRFSNLQSVRDNYNEADAWPYII 238

Query: 248 DEYYGWIKER 257
           DE+Y ++ ++
Sbjct: 239 DEFYEYLADK 248

>TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 bp,
           266 aa] {ON} Anc_8.322 YLR128W
          Length = 266

 Score =  167 bits (423), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 141/260 (54%), Gaps = 15/260 (5%)

Query: 11  IKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTR--GTSYLNTERTYDAELYSTFQNY 68
           +++F  +TS +   A K+L+ N W+L+YAL++ Y +  G    +  R Y AEL   F+ Y
Sbjct: 5   VREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGFVHDVPREYPAELIELFERY 64

Query: 69  AS-----------ENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQF 117
            +           E+  +D D LI+++ DLGY+LED  T+CLA ++   NLT  I   QF
Sbjct: 65  NNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQF 124

Query: 118 LSTWADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISY 177
           L  W +  CSN+ D+ + + T+   L  D  YF  IY+Y+F +  +   + + IDTA  Y
Sbjct: 125 LEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKEY 184

Query: 178 WTLLFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEY 237
           W L F D +    I + +L++W +FL        +T+D W M+ +F  KFP       EY
Sbjct: 185 WKLFFGDGT-PLHIEKEQLDNWNKFLTISGKKT-ITKDEWKMILEFFKKFPTVTEFKDEY 242

Query: 238 SEMGAWPLIMDEYYGWIKER 257
             M  WP IMDEY+ +++E 
Sbjct: 243 DPMDPWPYIMDEYHEYLEEN 262

>NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON}
           Anc_8.322 YLR128W
          Length = 286

 Score =  165 bits (418), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 143/282 (50%), Gaps = 51/282 (18%)

Query: 25  AEKFLNDNRWSLDYALDDLYTR--------------GTSYLNTERTYDAELYSTFQNYAS 70
           A+K+L+ N W L+YAL++ Y +                + L     Y  EL + F+ Y+S
Sbjct: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFIGDDDDDDGCKTILPDLNKYPQELIALFKKYSS 61

Query: 71  ENGR-----MDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLG 125
           +N       +D D LI Y+ DL Y LED VTICLA+LL  ENL   I ++QFLS W   G
Sbjct: 62  KNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQG 121

Query: 126 CSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDG--------------------- 164
           CS L  M   +N LD KLH+D  YF  IY+YTF + +D                      
Sbjct: 122 CSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSND 181

Query: 165 ---------KRRQLSIDTAISYWTLLF-LDHSFATKIPRTRLESWFRFLREQNDANFVTR 214
                    K   L ++TAI+YW + F ++  +  K+ +  L  WF+FL E+     +T+
Sbjct: 182 TSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKE-ITK 240

Query: 215 DTWDMLFKFALKFPDDKTLLSEYSEMGAWPLIMDEYYGWIKE 256
           D W ML +F  KF + + +   Y E  AWP ++DE+Y ++++
Sbjct: 241 DQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQD 282

>KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.322
           YLR128W
          Length = 265

 Score =  162 bits (409), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 144/256 (56%), Gaps = 11/256 (4%)

Query: 11  IKQFMSITSM-NRATAEKFLNDNRWSLDYALDDLYTRGTS-YLNTER-------TYDAEL 61
           I  F+ +T   +R  AE++L ++ W+++YAL+D Y +    + +T +        Y  EL
Sbjct: 6   IHDFIELTQCRDRKKAERYLRESHWNVNYALNDFYDKEVGNFFSTYKDVPQDNVVYPPEL 65

Query: 62  YSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTW 121
              F  Y SE G +  + +I Y+ DL   ++D VTICLAQLL  ENL A I  EQFL+ W
Sbjct: 66  IHVFDQY-SEAGVITFEGMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITREQFLAQW 124

Query: 122 ADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLL 181
              GCS +N+M   +  L+ KL +D  YFK IY YTF + V+  + +L   + I YW L 
Sbjct: 125 FLQGCSTINEMKTVLADLNGKLEKDRGYFKEIYMYTFPLLVEPDQNKLDAASTIEYWKLF 184

Query: 182 F-LDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEM 240
           F  +  +   I +  L+ WF +L EQ++   VT D W M+++F  +F     +   Y EM
Sbjct: 185 FDQEKKYPMIIDQELLDPWFVYLGEQSENMSVTEDIWKMVYQFFNRFRSLGDVKQGYDEM 244

Query: 241 GAWPLIMDEYYGWIKE 256
            AWP+++DE+  ++++
Sbjct: 245 AAWPILIDEFIEYLQD 260

>CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} similar
           to uniprot|Q12395 Saccharomyces cerevisiae YLR128w
          Length = 273

 Score =  160 bits (405), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 150/270 (55%), Gaps = 19/270 (7%)

Query: 5   ARQRKQI-KQFMSITSM-NRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTER------T 56
           +R  K++ K F S+TS  +   A+++L+ N W+++YAL++ Y +       +        
Sbjct: 3   SRHEKELMKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYDKEVGGFTEDHMIRHQFK 62

Query: 57  YDAELYSTFQNYAS---ENG--RMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTAD 111
           Y  EL S F +YA+   E+G   +  D LI Y+ DLGY LED VTI LA  L+ +NL   
Sbjct: 63  YPDELVSLFGHYAALIEEDGTQSITPDGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENP 122

Query: 112 IEEEQFLSTWADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSI 171
           I E+QFL  W + GC  L  M  Y+   + KL  D  YF TIY+Y+F +    K+  +  
Sbjct: 123 ITEKQFLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTTIYNYSFDLNA-SKQGVVET 181

Query: 172 DTAISYWTLLFLDH----SFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKF 227
           D AI YW L F ++    S   K+ +  L+ W +FL++++    + +DTW ML  F  KF
Sbjct: 182 DIAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKFLQDEH-KKLIHKDTWQMLLLFFKKF 240

Query: 228 PDDKTLLSEYSEMGAWPLIMDEYYGWIKER 257
           P    + +EY+E  AWP  +DE+Y +++ER
Sbjct: 241 PSLDAIKTEYNEADAWPYTIDEFYEYLEER 270

>Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W
           (REAL)
          Length = 179

 Score =  154 bits (390), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/180 (41%), Positives = 108/180 (60%), Gaps = 2/180 (1%)

Query: 78  DTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCSNLNDMSEYMN 137
           D+L+K++ DLGY LED  T+CL  LL  +NL   ++ E FLSTW   GCS L DM   + 
Sbjct: 2   DSLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRETFLSTWFMQGCSTLPDMQGCIK 61

Query: 138 TLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFLDHSFATKIPRTRLE 197
            LD KLHED  Y+  +Y Y F + +D  R+ + ID AI YWT LF    +   I    LE
Sbjct: 62  RLDVKLHEDLQYYTQVYDYAFRLILDSNRKNIDIDDAIQYWT-LFFQPVYPVHIESNLLE 120

Query: 198 SWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWPLIMDEYYGWIKER 257
           SWF FLR++     +++DTW ML  F  ++   ++++  Y E  AWP I+DE+Y ++++ 
Sbjct: 121 SWFHFLRDEG-KTLISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIIDEFYEYLQDH 179

>Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W
           (REAL)
          Length = 178

 Score =  154 bits (388), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 110/179 (61%), Gaps = 2/179 (1%)

Query: 78  DTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCSNLNDMSEYMN 137
           D+LIK++ DLGY LED  T+CL  LL  + L   ++ E FLS W   GCS L +M + + 
Sbjct: 2   DSLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRETFLSAWFMQGCSTLPNMKKCVK 61

Query: 138 TLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFLDHSFATKIPRTRLE 197
            LD KLHED  YF  IY YTF + +D  R+ +  + AI YWTLLF    +   +    LE
Sbjct: 62  GLDAKLHEDLQYFTEIYDYTFHLILDTNRKDIDTEEAIQYWTLLF-QPEYPIHMEPGLLE 120

Query: 198 SWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWPLIMDEYYGWIKE 256
           +WFRFL ++     +T+D W ML +F  ++P  ++++ +Y E  AWP I+DE+Y ++++
Sbjct: 121 AWFRFLHDEGKRT-ITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIIDEFYEFLRD 178

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score =  151 bits (381), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 138/258 (53%), Gaps = 15/258 (5%)

Query: 11  IKQFMSITSMNRATAEKFLNDNRWSLDYALDDLY------------TRGTSYLNTERTYD 58
           +K+FMS+ + + +TA+K+L  N+W L+YAL+D Y             R    L  E  Y 
Sbjct: 8   LKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIE--YV 65

Query: 59  AELYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFL 118
             L   + +YA ++G + T+ L+K V DLGY ++  VT+CLA+L+   + T  I    F+
Sbjct: 66  RPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFI 125

Query: 119 STWADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYW 178
            +     C +L D+   +N  D KL  +  Y+  IY   F++ ++  ++ +  +TA  YW
Sbjct: 126 DSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYW 185

Query: 179 TLLFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYS 238
            L F   ++  K+   + + WF++L   N    +T+D W ML +F  KFP    L  +YS
Sbjct: 186 DLFFACQNYPIKVQSDQYQQWFKYLSNANIKE-ITKDQWAMLLRFFKKFPSLSELQRKYS 244

Query: 239 EMGAWPLIMDEYYGWIKE 256
           E  AWP I DEYY ++++
Sbjct: 245 EDSAWPYIFDEYYEYLED 262

>NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON}
           Anc_8.322 YLR128W
          Length = 184

 Score =  144 bits (364), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 107/181 (59%), Gaps = 4/181 (2%)

Query: 78  DTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCSNLNDMSEYMN 137
           D L+ Y++DLG  LED VTICL  LL  +N+  DI  +QFL  W   GCS++  M + + 
Sbjct: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61

Query: 138 TLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFL--DHSFATKIPRTR 195
            L+ KLH D  YF  IY+YTF +  D   + L ++TA++YW L     +  F  ++  T 
Sbjct: 62  DLNDKLHSDKQYFIDIYNYTFGLITD-PDKDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120

Query: 196 LESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWPLIMDEYYGWIK 255
           L  WF+FL E+N   F+T+D W ML  F  KFP+   +   Y E  AWP I+DEYY +++
Sbjct: 121 LNLWFQFLDEEN-KKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQ 179

Query: 256 E 256
           +
Sbjct: 180 D 180

>Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W
           (REAL)
          Length = 125

 Score = 95.5 bits (236), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 73/126 (57%), Gaps = 2/126 (1%)

Query: 132 MSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFLDHSFATKI 191
           M E M  LD KL ++  YF  IY+YTF + +D  R+ + I+  I YW  LF    +   I
Sbjct: 1   MQECMKRLDIKLRQNLQYFTLIYNYTFHLLLDSYRKDIDINECIQYWK-LFFRPEYPVSI 59

Query: 192 PRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWPLIMDEYY 251
            +  LE+WFRFL ++     + +DTW ML  F  K+   + ++ +Y E  AWP I+DE+Y
Sbjct: 60  EQNLLEAWFRFLHDEGKM-MINKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIIDEFY 118

Query: 252 GWIKER 257
            +++++
Sbjct: 119 EYLQDQ 124

>Suva_1.51 Chr1 (101112..103007) [1896 bp, 631 aa] {ON} YAL016W
           (REAL)
          Length = 631

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 47/114 (41%), Gaps = 5/114 (4%)

Query: 24  TAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAELYSTFQNYASENGRMDTDTLIKY 83
           +A K + D  W + Y   D ++   S   + + Y  EL   F N   +N     + + K 
Sbjct: 280 SAVKLIGDEAWRVRYMAADRFSELASQFTSNQAYIDELIQPFLNLCEDNEGDVREAVAKQ 339

Query: 84  VTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCSNLNDMSEYMN 137
           V+     L DP  I    L  V+NL+ D E E   S  A    S + D+   +N
Sbjct: 340 VSGFAKFLNDPSVILSKILPAVQNLSMD-ESETVRSALA----SKITDIVLLLN 388

>Skud_1.45 Chr1 (100224..102113) [1890 bp, 629 aa] {ON} YAL016W
           (REAL)
          Length = 629

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 1/99 (1%)

Query: 24  TAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAELYSTFQNYASENGRMDTDTLIKY 83
           +A K + D  W + Y   D ++   +   + + Y  EL   F N   +N     + + K 
Sbjct: 278 SAVKLIGDEAWRVRYMAADRFSELAAQFISSQAYIDELIQPFLNLCEDNEGDVREAVAKQ 337

Query: 84  VTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWA 122
           V+     L DP TI    L  V+NL+ D E E   S  A
Sbjct: 338 VSGFAKFLNDPSTILSKILPAVQNLSMD-ESETVRSALA 375

>YAL016W Chr1 (124879..126786) [1908 bp, 635 aa] {ON}
           TPD3Regulatory subunit A of the heterotrimeric protein
           phosphatase 2A (PP2A), which also contains regulatory
           subunit Cdc55p and either catalytic subunit Pph21p or
           Pph22p; required for cell morphogenesis and
           transcription by RNA polymerase III
          Length = 635

 Score = 36.6 bits (83), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 1/99 (1%)

Query: 24  TAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAELYSTFQNYASENGRMDTDTLIKY 83
           +A K + D  W + Y   D ++   S  ++ + Y  EL   F N   +N     + + K 
Sbjct: 284 SAVKLIGDEAWRVRYMAADRFSDLASQFSSNQAYIDELVQPFLNLCEDNEGDVREAVAKQ 343

Query: 84  VTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWA 122
           V+     L DP  I    L  V+NL+ D E E   S  A
Sbjct: 344 VSGFAKFLNDPSIILNKILPAVQNLSMD-ESETVRSALA 381

>Smik_1.51 Chr1 (107810..109708) [1899 bp, 632 aa] {ON} YAL016W
           (REAL)
          Length = 632

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 1/99 (1%)

Query: 24  TAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAELYSTFQNYASENGRMDTDTLIKY 83
           +A K + D  W + Y   D ++   S  ++ + Y  EL   F N   +N     + + K 
Sbjct: 281 SAVKLIGDEAWRVRYMAADRFSDLASQFSSNQAYIDELIQPFLNLCEDNEGDVREAVAKQ 340

Query: 84  VTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWA 122
           V+     L DP  I    L  V+NL+ D E E   S  A
Sbjct: 341 VSGFAKFLNDPSIILNKILPAVQNLSMD-ESETVRSALA 378

>TDEL0H03620 Chr8 complement(596794..598623) [1830 bp, 609 aa] {ON}
           Anc_7.88 YAL016W
          Length = 609

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 44/106 (41%), Gaps = 2/106 (1%)

Query: 24  TAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAELYSTFQNYASENGRMDTDTLIKY 83
           +A K + D  W + Y   D +    +  +    Y AEL   F N   +N       + K 
Sbjct: 259 SATKLIGDEAWRVRYMAADKFEELAAQFSDNEAYMAELIQPFLNLCEDNESDVRKAIAKQ 318

Query: 84  VTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCSNL 129
           V      L+DP  +    L  V++L+ D E E   ++ A L  +NL
Sbjct: 319 VAGFAKLLQDPSDVLTKVLPAVQSLSMD-ESEAVRASLA-LTVTNL 362

>TDEL0D03450 Chr4 (637245..637832) [588 bp, 195 aa] {ON} 
          Length = 195

 Score = 32.3 bits (72), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 29/69 (42%), Gaps = 2/69 (2%)

Query: 85  TDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCSNLNDMSEYMNTLDTKLH 144
           T LG +   PV     +LL V N+  + +EE  L+TW  L CS        M      L 
Sbjct: 118 TQLGLKSSFPVRAPRKRLLDVRNIPVEYDEE--LNTWCTLNCSTAKGRKSAMGIPRLGLP 175

Query: 145 EDPVYFKTI 153
           +  V   TI
Sbjct: 176 QQTVQSGTI 184

>KLTH0E14784g Chr5 complement(1313245..1316493) [3249 bp, 1082 aa]
           {ON} similar to uniprot|Q12527 Saccharomyces cerevisiae
           YPR049C ATG11 Peripheral membrane protein required for
           delivery of aminopeptidase I (Lap4p) to the vacuole in
           the cytoplasm-to-vacuole targeting pathway also required
           for peroxisomal degradation (pexophagy)
          Length = 1082

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 57/121 (47%), Gaps = 15/121 (12%)

Query: 11  IKQFMSITSMNRATAEKFLNDNRWSLDYALDDLYTRGTSYLNTER--------TYDAELY 62
           I+ F+ +  + R T+++F+             +  +  S+LN  R         +D  L+
Sbjct: 21  IRLFLGVEDLQRFTSQQFMIPIDQCFILLPYGVKLKKASFLNCRRQPERAEFYVFDRRLF 80

Query: 63  STFQNYASENGRMDT---DTLIKYVT-DLGYQLEDPVTICLAQLLKVENLTADIEEEQFL 118
           S  Q+ +S  GR+D+   +TL+  VT      L  P+T   + LL+V N+T +++  +  
Sbjct: 81  SFAQDPSSGEGRVDSQELETLLDSVTRSCNVTLIKPIT---SPLLEVANMTNNLDHRKIT 137

Query: 119 S 119
           S
Sbjct: 138 S 138

>KLLA0E17865g Chr5 (1586485..1587369) [885 bp, 294 aa] {ON} similar
           to uniprot|Q08237 Saccharomyces cerevisiae YOL080C REX4
           Putative RNA exonuclease possibly involved in pre-rRNA
           processing and ribosome assembly
          Length = 294

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 15/118 (12%)

Query: 110 ADIEEEQFLSTWADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYT------------ 157
           A +E+E+  +T AD    N  D   + + L  KL+ED V  K++                
Sbjct: 70  AKVEQERTKNTHADGQMINSED--RFESVLKQKLNED-VAKKSLSRTNGVGKYVSMDCEF 126

Query: 158 FSIAVDGKRRQLSIDTAISYWTLLFLDHSFATKIPRTRLESWFRFLREQNDANFVTRD 215
             +  DGK   L+  + ++Y+  + LD     K P T   +W   ++  + AN VT++
Sbjct: 127 VGVGPDGKDSALARVSIVNYYGNVVLDLFVRPKEPVTDWRTWVSGIKPHHMANAVTQE 184

>KAFR0J01940 Chr10 complement(373125..375764) [2640 bp, 879 aa] {ON}
           Anc_2.186 YOR098C
          Length = 879

 Score = 32.0 bits (71), Expect = 1.8,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 41/95 (43%), Gaps = 14/95 (14%)

Query: 140 DTKLHEDPVYFKTIYSYTFS-----IAVDGKRRQLSI-------DTAISYWTLLFLDHSF 187
           DT + E P   K + S   S     I V  +R+Q +I       DT I Y T        
Sbjct: 43  DTNMDEIPESVKEVDSVQSSNRAGSIEVKRRRKQDTISTVNPERDTLILYETGSDFRPPV 102

Query: 188 ATKIP--RTRLESWFRFLREQNDANFVTRDTWDML 220
              +P  R RL    +FLR  ND NFVTR +  ++
Sbjct: 103 LPILPIQRLRLLRQKQFLRRMNDRNFVTRHSTSLM 137

>ABL047W Chr2 (308042..309334) [1293 bp, 430 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL109W (HAP4)
          Length = 430

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 77  TDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCSNLNDMS 133
           TD  +K+  + G ++    T C+AQ L + +  +  +EE F ST + L  S+L ++S
Sbjct: 145 TDAFLKFEDEEGGEVPALTTACMAQSLSLGSRASFTDEEDFGSTPSSLFSSDLQNLS 201

>NCAS0F01570 Chr6 complement(311148..312968) [1821 bp, 606 aa] {ON}
           Anc_7.88 YAL016W
          Length = 606

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 26/130 (20%), Positives = 49/130 (37%), Gaps = 5/130 (3%)

Query: 24  TAEKFLNDNRWSLDYALDDLYTRGTSYLNTERTYDAELYSTFQNYASENGRMDTDTLIKY 83
           +A K +ND  W + Y   D +   T+     + Y  EL   F N   +N       +   
Sbjct: 255 SAIKLINDEAWRVRYMAADRFEDLTAQFANNQEYINELIEPFLNLCDDNEGDVRKAIATQ 314

Query: 84  VTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCSNLNDMSEYMNTLDTKL 143
           +      + DP  +    +  ++NL+ D E E   +  A      +N+++E +       
Sbjct: 315 IPGFAKLINDPTLLLTKIIPIIQNLSMD-EIEDVRAALA----LKVNNIAELLTKEQAIQ 369

Query: 144 HEDPVYFKTI 153
           H  P+    +
Sbjct: 370 HLSPILLNML 379

>ABR108C Chr2 complement(581545..588576) [7032 bp, 2343 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YBR136W
            (MEC1)
          Length = 2343

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 12/114 (10%)

Query: 70   SENGRMDTDTLIKYVTDLGYQLED-PVTICLAQLLKVENLTADIEEEQFLSTWA------ 122
            S NG  D D L+ Y+     ++ D    + + ++    NLT+ IEE Q+   W       
Sbjct: 1394 SSNGLQD-DKLLPYLQTTYAEINDIDAVVGVLKVFCSNNLTSRIEELQYSDNWKMAQDCF 1452

Query: 123  -DLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFS---IAVDGKRRQLSID 172
              LG S LN+     N++ T      +Y   +Y  T     + +  K+RQL ++
Sbjct: 1453 DALGDSLLNEQGGVENSVPTSRMLKLMYDHQLYDQTLKKLELNIPSKKRQLPLN 1506

>YBR179C Chr2 complement(586547..589114) [2568 bp, 855 aa] {ON}
           FZO1Mitofusin; integral membrane protein involved in
           mitochondrial outer membrane tethering and fusion; role
           in mitochondrial genome maintenance; efficient tethering
           and degradation of Fzo1p requires an intact N-terminal
           GTPase domain; targeted for destruction by the ubiquitin
           ligase SCF-Mdm30p and the cytosolic ubiquitin-proteasome
           system
          Length = 855

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 52/121 (42%), Gaps = 14/121 (11%)

Query: 43  LYTRGTSYLNTERTYDAELYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQL 102
           L  R  S L   +TY ++L S     +  N +M ++  IK    +  QLE      L+  
Sbjct: 457 LKKRSLSKLLPAKTYLSKLLSDIIMISKSNMKMYSEEEIK----INEQLETLRPEILSAR 512

Query: 103 LKVENLTADIEE--EQFLSTWADLGCSNLNDMSEYMNTLDTKLHEDPVY--FKTIYSYTF 158
            K  +LT  +++  EQ ++   +      N     +N LD  LHE P Y     IY + F
Sbjct: 513 AKCNDLTTSVDQMAEQTITMTYN------NTKEALLNALDVPLHEYPKYQGLGQIYDFIF 566

Query: 159 S 159
           S
Sbjct: 567 S 567

>Smik_2.319 Chr2 complement(572736..575303) [2568 bp, 855 aa] {ON}
           YBR179C (REAL)
          Length = 855

 Score = 29.6 bits (65), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 48/122 (39%), Gaps = 16/122 (13%)

Query: 43  LYTRGTSYLNTERTYDAELYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQL 102
           L  R  S L   +TY ++L S     +  N  M T    K    +  QLE      L   
Sbjct: 457 LKKRSLSKLLPAKTYLSKLLSDITMISKSNMEMYT----KEEKKINEQLETLRPEILIVR 512

Query: 103 LKVENLTADIE---EEQFLSTWADLGCSNLNDMSEYMNTLDTKLHEDPVY--FKTIYSYT 157
            K  +LT  ++   EE   +T+       +N     +N LD  LHE P Y     IY + 
Sbjct: 513 TKCNDLTTSVDQMAEETIAATY-------INTKEALLNALDVPLHEYPKYQGLAQIYDFI 565

Query: 158 FS 159
           FS
Sbjct: 566 FS 567

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.133    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,489,222
Number of extensions: 1264473
Number of successful extensions: 3793
Number of sequences better than 10.0: 51
Number of HSP's gapped: 3838
Number of HSP's successfully gapped: 51
Length of query: 258
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 151
Effective length of database: 41,212,137
Effective search space: 6223032687
Effective search space used: 6223032687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)