Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_42528.321ON68968936070.0
AGL193W8.321ON70968826390.0
SAKL0H15598g8.321ON78769311091e-140
KLTH0G12342g8.321ON77469510201e-127
Kwal_56.239098.321ON7766869991e-124
ZYRO0F10340g8.321ON8187289161e-111
Skud_12.1968.321ON8547338741e-105
Smik_12.1908.321ON8507338501e-101
Suva_10.2208.321ON8547378501e-101
TDEL0F044708.321ON8096898216e-98
YLR127C (APC2)8.321ON8537348185e-97
TBLA0A039208.321ON7327217415e-87
TPHA0C008308.321ON8427097152e-82
NCAS0C032808.321ON8117016992e-80
CAGL0M04235g8.321ON7836746972e-80
KLLA0D16324g8.321ON6977126531e-74
KAFR0H022808.321ON8177145642e-61
KNAG0G024308.321ON7977054874e-51
NDAI0G026008.321ON9117584682e-48
Kpol_YGOB_Anc_8.3218.321ON5114103592e-35
SAKL0H13310g8.414ON63896830.22
CAGL0L08734g8.79ON12131721.2
NCAS0G028402.216ON31794761.3
KLTH0G13376g8.276ON22863723.1
ZYRO0G21296g1.295ON1227194743.3
CAGL0G08470g8.414ON65061716.2
TBLA0A055801.94ON223669717.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4252
         (689 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...  1394   0.0  
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...  1021   0.0  
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   431   e-140
KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...   397   e-127
Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...   389   e-124
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...   357   e-111
Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...   341   e-105
Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...   332   e-101
Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...   332   e-101
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...   320   6e-98
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...   319   5e-97
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   290   5e-87
TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...   280   2e-82
NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...   273   2e-80
CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...   273   2e-80
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   256   1e-74
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   221   2e-61
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   192   4e-51
NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...   184   2e-48
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...   142   2e-35
SAKL0H13310g Chr8 (1143437..1145353) [1917 bp, 638 aa] {ON} simi...    37   0.22 
CAGL0L08734g Chr12 complement(954111..954476) [366 bp, 121 aa] {...    32   1.2  
NCAS0G02840 Chr7 (521469..522422) [954 bp, 317 aa] {ON}                34   1.3  
KLTH0G13376g Chr7 (1149234..1149249,1149315..1149985) [687 bp, 2...    32   3.1  
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    33   3.3  
CAGL0G08470g Chr7 complement(800333..802285) [1953 bp, 650 aa] {...    32   6.2  
TBLA0A05580 Chr1 (1383502..1390212) [6711 bp, 2236 aa] {ON} Anc_...    32   7.7  

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score = 1394 bits (3607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/689 (98%), Positives = 678/689 (98%)

Query: 1   MTYAEELENYHLQLISALPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKL 60
           MTYAEELENYHLQLISALPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKL
Sbjct: 1   MTYAEELENYHLQLISALPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKL 60

Query: 61  LKLDDAEQVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAE 120
           LKLDDAEQVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAE
Sbjct: 61  LKLDDAEQVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAE 120

Query: 121 ELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMVKFV 180
           ELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMVKFV
Sbjct: 121 ELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMVKFV 180

Query: 181 IDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIY 240
           IDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIY
Sbjct: 181 IDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIY 240

Query: 241 RCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELL 300
           RCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELL
Sbjct: 241 RCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELL 300

Query: 301 IPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTK 360
           IPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTK
Sbjct: 301 IPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTK 360

Query: 361 DEIHEVISKNTLTENPQLLDQLSKELKNSTALNFHSVTTIKSKAAIYSVAQERQNPLVKQ 420
           DEIHEVISKNTLTENPQLLDQLSKELKNSTALNFHSVTTIKSKAAIYSVAQERQNPLVKQ
Sbjct: 361 DEIHEVISKNTLTENPQLLDQLSKELKNSTALNFHSVTTIKSKAAIYSVAQERQNPLVKQ 420

Query: 421 FLEWTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSPEILINEFIKLITN 480
           FLEWTPEPGPFNEDISKLGNN           PKDVLEVVFQVFDSPEILINEFIKLITN
Sbjct: 421 FLEWTPEPGPFNEDISKLGNNDTDDTTETLELPKDVLEVVFQVFDSPEILINEFIKLITN 480

Query: 481 HMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEESNLVNVFVMWSDLEKSASFQN 540
           HMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEESNLVNVFVMWSDLEKSASFQN
Sbjct: 481 HMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEESNLVNVFVMWSDLEKSASFQN 540

Query: 541 WSTKLQLIPSNVYPKIISYLYWKISRKSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLR 600
           WSTKLQLIPSNVYPKIISYLYWKISRKSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLR
Sbjct: 541 WSTKLQLIPSNVYPKIISYLYWKISRKSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLR 600

Query: 601 FQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQKVPRGLRTADIVQQTDMAQHHVEA 660
           FQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQKVPRGLRTADIVQQTDMAQHHVEA
Sbjct: 601 FQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQKVPRGLRTADIVQQTDMAQHHVEA 660

Query: 661 IVQYWCQEHVLYSTGDDCYRILERADVAF 689
           IVQYWCQEHVLYSTGDDCYRILERADVAF
Sbjct: 661 IVQYWCQEHVLYSTGDDCYRILERADVAF 689

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score = 1021 bits (2639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/688 (70%), Positives = 571/688 (82%), Gaps = 1/688 (0%)

Query: 1   MTYAEELENYHLQLISALPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKL 60
           M Y++E      Q++ A+   D +L+D++E +L W++PNDDHNNHQMR PSLRIKNSI+L
Sbjct: 1   MMYSQEAVGCQQQVVDAVCTWDPSLKDEIEAVLEWMDPNDDHNNHQMRPPSLRIKNSIRL 60

Query: 61  LKLDDAEQVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAE 120
           L+L +      + LLRQ  +SQ+R HFF +WE L QY DM++LERYYEFPL+YV +FT +
Sbjct: 61  LRLGEQAPGTTVGLLRQCAVSQMRQHFFRHWERLEQYTDMVKLERYYEFPLRYVAVFTED 120

Query: 121 ELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMVKFV 180
           E++ EL+GLRKYLLN N  FR NME+RIR LIL++DDFE +++LYKW+VQGLGHPMVKFV
Sbjct: 121 EVAAELVGLRKYLLNGNPGFRANMEARIRALILQDDDFETAARLYKWIVQGLGHPMVKFV 180

Query: 181 IDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIY 240
           I++LT KI LFC++RM+GNVDQ+++I EVFN+FI +CW QFIQLLQFP  DD ELNNLIY
Sbjct: 181 IEVLTQKIALFCRNRMDGNVDQRYLIMEVFNSFIARCWAQFIQLLQFPTADDPELNNLIY 240

Query: 241 RCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELL 300
           RCFE KFIE+KT+ELF +IIPKFP+SKP+LLEMKSVIKG T ELDRLVAQI NDFH ELL
Sbjct: 241 RCFEKKFIELKTQELFHQIIPKFPMSKPALLEMKSVIKGDTAELDRLVAQIYNDFHKELL 300

Query: 301 IPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTK 360
           +PSVTT+EILLYYVK IKCLMVVDPTGRSMNRFT KLKPKIKERSDLI +VLCAILEL  
Sbjct: 301 VPSVTTVEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPKIKERSDLIISVLCAILELDS 360

Query: 361 DEIHEVISKNTLTENPQLLDQLSKELKNSTALNFHSVTTIKSKAAIYSVAQERQNPLVKQ 420
           DEIHEVISKNTLTENPQLL QLSKELKNSTAL FHS++T K KAAIYSVA ERQ+ LVKQ
Sbjct: 361 DEIHEVISKNTLTENPQLLSQLSKELKNSTALTFHSMSTSKGKAAIYSVAFERQDQLVKQ 420

Query: 421 FLEWTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSPEILINEFIKLITN 480
           FLEWTPEPGPF  D +K   N           PKDVLEVVFQVFDSPE+LINEFI+L+TN
Sbjct: 421 FLEWTPEPGPFTADDAK-ALNSDDDGAETLELPKDVLEVVFQVFDSPEVLINEFIQLVTN 479

Query: 481 HMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEESNLVNVFVMWSDLEKSASFQN 540
           HMLQM+GY+L+AKWSQLLKT+MKKYFKNNKQVLKS+CEESNLVNVFVMWSDLEKSA+FQ 
Sbjct: 480 HMLQMDGYVLNAKWSQLLKTVMKKYFKNNKQVLKSMCEESNLVNVFVMWSDLEKSATFQT 539

Query: 541 WSTKLQLIPSNVYPKIISYLYWKISRKSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLR 600
           WSTKLQL+P NVYPKIISYLYWKI R+S YGDY ++  LA IF QMEKAFE +SPGRKLR
Sbjct: 540 WSTKLQLVPPNVYPKIISYLYWKIGRRSPYGDYAVAPGLAAIFDQMEKAFETRSPGRKLR 599

Query: 601 FQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQKVPRGLRTADIVQQTDMAQHHVEA 660
           FQ DQG+V++ L F+DGRHWS++VSLPKYTVI+LFQ+    L   DI   T+M+   VE 
Sbjct: 600 FQKDQGSVDLQLVFEDGRHWSSRVSLPKYTVIDLFQRQACPLSVTDIAAHTNMSPRLVED 659

Query: 661 IVQYWCQEHVLYSTGDDCYRILERADVA 688
           I+Q+WC EHVL+   +D Y ILE  + A
Sbjct: 660 IIQFWCHEHVLHLNKNDLYEILENHNSA 687

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  431 bits (1109), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 241/693 (34%), Positives = 405/693 (58%), Gaps = 29/693 (4%)

Query: 1   MTYAEELENYHLQLISALPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKL 60
           M    E++  + QL   +   +  L D+L+ +LTW+NPN+ ++NHQ+R PSLR+KN IKL
Sbjct: 1   MGSNAEIQELNAQLREFVTTYNPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRLKNGIKL 60

Query: 61  LKLDDAEQVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAE 120
           +  ++      + LLRQ+ L Q R HFF N+ S+  +KD+ RLE+YYEFPLKY+ +FT +
Sbjct: 61  VVNNEDVPPGFVHLLRQFVLLQTRIHFFSNFNSITSFKDIQRLEKYYEFPLKYINIFTPD 120

Query: 121 ELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMVKFV 180
           E   E+ G R YL+++N  F +N++ R+R LI+ EDDF+M+ K+Y W+ + +GH +V  +
Sbjct: 121 EWFIEMNGFRHYLMSKNRIFGDNIKHRVRQLIM-EDDFDMAWKIYTWLTETMGHQLVSLL 179

Query: 181 IDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIY 240
           +++L +KI  F K  M G   Q+ ++ E FN FI K W+ F Q L+ P EDD E+   I+
Sbjct: 180 LEILMDKIADFSKQNMMGKWTQRFLVMETFNTFITKYWSTFAQALRCP-EDDHEITTEIF 238

Query: 241 RCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELL 300
            CFE +F++++T E+++  + ++P SKP+LLE+++V+K  + +  +L+ +  + F S+L+
Sbjct: 239 HCFEKEFVKIRTSEIYEICVLEYPHSKPALLELRNVMK-TSADYSKLMIEFLSKFESKLM 297

Query: 301 IPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTK 360
            PSVTT EILL Y++ IK  + VDP GR +   T  +KP ++ER D +  +L A+LEL +
Sbjct: 298 NPSVTTTEILLSYIRTIKSFLTVDPAGRYLQSVTAYIKPYLRERRDTVVHLLYAMLELDE 357

Query: 361 DEIHEVISKNTLTENPQLLDQLSKELK-------NSTALNFHSVTTIKSKAAIYSVAQER 413
            EI +      ++ N  +L +LSKELK       ++ + +  +   +   + ++ V +  
Sbjct: 358 SEIDDA----NVSLNMPILTELSKELKDPDFGIEDADSKSRKNKLMVTDSSPVFKVEKPL 413

Query: 414 QNPLVKQFLEWTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSPEILINE 473
              ++  FL+WTPEP     D++    N            K +L+++  +FDS ++ I+E
Sbjct: 414 CEQVLNYFLQWTPEPS----DVAHRKPNNTFVN-------KSLLDILLDIFDSKDVFISE 462

Query: 474 FIKLITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEESNLVNVFVMWSDLE 533
           F+ L T  +L ++ Y L  KW ++L+ L+KK F +         + SN+ N+ +M  D++
Sbjct: 463 FLSLFTKKLLGLKYYKLETKWIKILR-LLKKKFGHTSFPQHQFQDTSNINNIDIMLRDVK 521

Query: 534 KSASFQNWSTKLQLIPSNVYPKIISYLYWKISRKSLYGDYRISSALAIIFQQMEKAFEMK 593
            S    +   ++  +   V+PK ISYL+W  + ++   D+++   L    ++  + +   
Sbjct: 522 TSYELISKMHEVAGLDDRVFPKFISYLFWNSALEAETSDFQLPGWLETEIEKYSEVYSQL 581

Query: 594 SPGRKLRFQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQK--VPRGLRTADIVQQT 651
            PGR+L    DQGTVE+ L F DGR  S +V L K  VI  F +    +GL    IV   
Sbjct: 582 KPGRRLHLYKDQGTVELDLEFKDGRKISCEVPLNKAAVISCFDQDTALKGLAVEQIVDNV 641

Query: 652 DMAQHHVEAIVQYWCQEHVLYSTGD-DCYRILE 683
            M +  V +I+Q+WC+++ +Y     + YR+LE
Sbjct: 642 KMEKALVTSILQFWCKKNAIYYDDRYNTYRVLE 674

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score =  397 bits (1020), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 238/695 (34%), Positives = 388/695 (55%), Gaps = 29/695 (4%)

Query: 1   MTYAEELENYHLQLISALPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKL 60
           MT ++E      QL S L + D +L DDLE +LTW+NPN+  +NHQMR PSLR+K++IK 
Sbjct: 1   MTLSDEGRELSEQLHSLLHDVDSSLEDDLEGILTWVNPNEPGSNHQMRPPSLRVKSAIKS 60

Query: 61  LKLDDAEQVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAE 120
           L          + LL ++ + Q R HFF N++SL+ +KD+ +LERYYEFP +YV +F++E
Sbjct: 61  LLNGVVTSESFIDLLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSSE 120

Query: 121 ELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMVKFV 180
           E  +E+ GLR YL+ +NS  +NN++ R+  L+  EDDF+M+ K+Y+W+ Q  G  + + +
Sbjct: 121 EWCDEMSGLRNYLIRQNSGLKNNIQLRLEQLV-HEDDFDMACKIYEWLCQAEGRLLPEIL 179

Query: 181 IDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIY 240
           +D+L +K++LF    M     Q+  I E +N F+   W+ F ++LQ   EDD E+ N IY
Sbjct: 180 VDVLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQC-MEDDHEITNEIY 238

Query: 241 RCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELL 300
           RCFE +FI ++T ++FD  +  FP +KP+LLE++SV+K + +  + L+ +    F S++L
Sbjct: 239 RCFEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTE-LITEFLYQFESKML 297

Query: 301 IPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTK 360
            PS+TT EILL YV+AIK +++VD + R     T  ++P + ER D + T L A+L L  
Sbjct: 298 NPSITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAMLGLDA 357

Query: 361 DEIHEVISKNTLTENPQLLDQLSKELKNS-TALNFHSVTTIKSKAAIYSVAQERQNPLVK 419
            ++    SKN+ + +  +  QLS EL+ S   ++  +          ++++     P  +
Sbjct: 358 SDLS---SKNSTSTHMSIASQLSAELRGSHQPISSSTAERGNLPHGKHALSMNPYEPAYQ 414

Query: 420 Q----FLEWTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSPEILINEFI 475
           Q    +L W PEP       S   NN            K++ +++ ++FDS ++++ EF+
Sbjct: 415 QIIDYYLHWNPEPAD-----SIQANN------DQALISKELFDIIVELFDSKDVIVREFL 463

Query: 476 KLITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEESNLVNVFVMWSDLEKS 535
            L T  +L + GY L + W Q LK + KK    + +   S  E SN+ N+ VM  D++ S
Sbjct: 464 GLFTRKLLGLRGYKLESNWVQSLKVVKKKL---DFKTYSSAQEFSNINNIDVMLRDVKHS 520

Query: 536 ASFQNWSTKLQLIPSNVYPKIISYLYWKISR--KSLYGDYRISSALAIIFQQMEKAFEMK 593
               +   +   +   + PK +SYL+W       +L  D+ +   L       +KA+   
Sbjct: 521 EELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDFSALPKDHPLPKELEADINNYKKAYTNV 580

Query: 594 SPGRKLRFQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQKVPRGLRTADIVQQTDM 653
             GRKLR   +Q  VE+ L   DGR  + +V+L +  V+        G    +IV+QT++
Sbjct: 581 KKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSYLSSNGDG-TVEEIVKQTNL 639

Query: 654 AQHHVEAIVQYWCQEHVL-YSTGDDCYRILERADV 687
               VE  +++W +  +L YST    Y + ER +V
Sbjct: 640 DISQVEKSLKFWVKSSILRYSTETSRYSVEERQNV 674

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score =  389 bits (999), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 243/686 (35%), Positives = 379/686 (55%), Gaps = 35/686 (5%)

Query: 13  QLISALPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAEQVFLL 72
           QL   L  +D  + DDLE++LTWINPN+  +NHQ+R PSLR+K++IK+L  ++     L 
Sbjct: 13  QLHELLRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALT 72

Query: 73  QLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAEELSNELIGLRKY 132
            +LRQ+ + Q R HFF ++ SL  +KD+ +LERYYEFPL++V LF  EE + E+ GLR Y
Sbjct: 73  DILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNREEWAEEINGLRNY 132

Query: 133 LLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMVKFVIDLLTNKIELFC 192
           L+++N  F  N   R+R L+L EDDFEM+ KLY+W+ +  G  +   ++D + +K++ F 
Sbjct: 133 LISKNLVFNRNARLRLRQLVL-EDDFEMACKLYEWLCRAEGRLLTHLLVDAVLSKVKAFA 191

Query: 193 KSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFENKFIEMKT 252
              ME    ++ V  E++N FI K W+   Q+LQ P EDD ++ N IYRCFE +FI ++T
Sbjct: 192 LKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCP-EDDHDVTNEIYRCFEEEFIRIRT 250

Query: 253 KELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELLIPSVTTIEILLY 312
           ++ F   +  +P S+P+LLE++SV+K    +  +LV ++ + F + +L PS+TT EILL 
Sbjct: 251 QQAFKIFVTGYPESEPTLLELRSVLKTPA-KYTQLVTELLSQFEARMLNPSITTAEILLS 309

Query: 313 YVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTKDEIHEVISKNTL 372
           YVKAIK ++ +D + R     T  ++P + ER D + T L A+L L   E          
Sbjct: 310 YVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDASETR---GPKPT 366

Query: 373 TENPQLLDQLSKELKNSTALNFHSVTTIKSKAAIYSVAQ-ERQNPLVKQ----FLEWTPE 427
             +  +  QLS ELK+S    F S     +++ +  +A    + P+ +Q    +L WTPE
Sbjct: 367 GAHASIASQLSAELKDSHQPIFRSALDKSAQSPVDDMASVNPKEPVYQQVINFYLHWTPE 426

Query: 428 PGPFNEDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSPEILINEFIKLITNHMLQMEG 487
           P       S   NN            K + +++ ++FDS +I+I EF+ L T+ +L ++G
Sbjct: 427 PSD-----SIQANNSDTLMN------KGLFDIIVELFDSKDIIIGEFLTLFTDKLLDLKG 475

Query: 488 YILSAKWSQLLKTLMKKY-FKN--NKQVLKSICEESNLVNVFVMWSDLEKSASFQNWSTK 544
           Y L   W + LK L  ++ FKN  N Q +      SN+ N+ VM  D++ S         
Sbjct: 476 YRLEQNWVKSLKILKNRFDFKNYSNAQGV------SNINNIDVMLRDVKHSEELCAQMHS 529

Query: 545 LQLIPSNVYPKIISYLYWKISRK--SLYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQ 602
           +  I   V P  ISYL+W    K  +L  D R+ S L    ++ +  +    PGRKLR  
Sbjct: 530 VPEISREVIPMFISYLFWNAGSKFSTLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLH 589

Query: 603 NDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQKVPRGLRTADIVQQTDMAQHHVEAIV 662
            +Q TV + L F D R    +VS+ K +V+    +   G+    IV+ T + +  V+  +
Sbjct: 590 QEQSTVVLQLHFADKRVMDFEVSMDKSSVLACVAETT-GISRDKIVEATGLEKAQVDQNL 648

Query: 663 QYWCQEHVL-YSTGDDCYRILERADV 687
           ++W    VL + +    Y  LER D 
Sbjct: 649 RFWLDASVLRFDSKTSLYSSLERQDT 674

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score =  357 bits (916), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 241/728 (33%), Positives = 391/728 (53%), Gaps = 59/728 (8%)

Query: 1   MTYAEELENYHLQLISALPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKL 60
           M   E+L+   +Q+            DDLE+LLTWINPN+  +NHQ + P+LR+KNSIK+
Sbjct: 5   MRAGEDLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKM 64

Query: 61  L---------KLDDAEQVFL-LQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFP 110
           L         + D+ +  +L +QL+RQ+ + Q+R HFF +  +L  +KD+ RL +YYEFP
Sbjct: 65  LVNQYYNMELREDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFP 124

Query: 111 LKYVGLF--TAEELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWM 168
           LKYV +F    EE   E  GL  YLLNR+   R N+ SR++ L++E DDF+++  + KW+
Sbjct: 125 LKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVME-DDFDLAMDVVKWL 183

Query: 169 VQGLGH-PMVKFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQF 227
            +   +   +  ++DL+  KI  FC+ +M G  + + +I E FN FI   W+QF  LL  
Sbjct: 184 NESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLAC 243

Query: 228 PNEDDQELNNLIYRCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRL 287
           P ED+ EL  ++Y  FE +F++++TKE+FD ++  +P SKP+LLE++ V+   +++  ++
Sbjct: 244 P-EDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLV-KSKDFTQI 301

Query: 288 VAQICNDFHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDL 347
           V +  ++F  ++L PS++T+  LL YVK +K  + +DPTGR +N  +  +KP  +ER+DL
Sbjct: 302 VVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDL 361

Query: 348 ITTVLCAILELTKDEIHEVISKNTLTENPQLLDQLSKELKNSTALNFHSVTTIK-----S 402
           +T +L AILEL  +E  E  ++  L  N   L+QLS+ELK+       S  TI      S
Sbjct: 362 VTVLLYAILELQSEEF-EGPARAYLDTNS--LNQLSQELKDPEFGIESSFETIPQADLLS 418

Query: 403 KAAIYSVAQERQNP------LVKQFLEWTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDV 456
           + A  +      +P      ++K FL+WTPEP    + ISK                +++
Sbjct: 419 RPASTATTAAMLDPRLPYKSVIKNFLQWTPEPM---DTISK-------NYSKSLSASRNL 468

Query: 457 LEVVFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSI 516
           L+++  +F+S +  ++EF+ L+T  +L ++ Y L  KWS  L+ L  K+       + + 
Sbjct: 469 LDILMDMFESKDFFVSEFLSLLTRKLLTLKLYTLDRKWSHCLRLLKTKFGPAGAAAVVAT 528

Query: 517 ---------------CEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLY 561
                           + SN+ N+ VM  D+  S+       ++  +   +YPK IS LY
Sbjct: 529 GIGGGDGGSIDGVRGGDPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLY 588

Query: 562 WKISRKSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRHWS 621
           W     S    +++   +A+   +  + +    PGR L    DQG V + L+F DGR   
Sbjct: 589 WNRDNSSNGWTFQLDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKR 648

Query: 622 NKVSLPKYTVIELFQ---KVPRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVLYSTGDDC 678
            + +L + +VI+ F        GL    I  +  M      A +Q+W QE VLY  G + 
Sbjct: 649 CEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDG-NA 707

Query: 679 YRILERAD 686
           Y+  E  D
Sbjct: 708 YKTREYLD 715

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  341 bits (874), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 228/733 (31%), Positives = 379/733 (51%), Gaps = 83/733 (11%)

Query: 25  LRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAE----------------- 67
           + DDL +LL W++PND  +NHQ+R PSLRIKN IK+L  ++                   
Sbjct: 30  IADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPNNVSTSSYGVINSGQTINAVA 89

Query: 68  ---------QVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLF- 117
                    Q+ LL  L+++ + Q+RYHFF  +  ++  KD+ R E YYEFPL+YV +F 
Sbjct: 90  GEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLKDIQRWENYYEFPLRYVPIFD 149

Query: 118 -TAEELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGH-P 175
            +  + S EL  LR Y+LNRN  F+NN+  R+  LI++ DDF+++  L +W+    G   
Sbjct: 150 LSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMD-DDFDLAGNLIRWLNFANGSLS 208

Query: 176 MVKFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQEL 235
            ++ +++ L NKIE FC++ M G  +++ +I E FN FI++ W+QF +L+  P EDD EL
Sbjct: 209 SMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQYWSQFCELICCP-EDDHEL 267

Query: 236 NNLIYRCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDF 295
              ++ CFE+ F+ ++T+E+FD  +  +P SK +LLE+K ++K   ++   +V +  +DF
Sbjct: 268 TTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIMKDF-KDYTNIVTKFLSDF 326

Query: 296 HSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAI 355
              +L PS+TT++ LL YVK IK  +V+DPTGR ++     +KP  +ER  L+  +L A+
Sbjct: 327 KKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVKPYFQERKHLVNVLLYAM 386

Query: 356 LELTKDEIHEVIS-KNTLTENPQLLDQLSKELKNSTALNFHSVTTIKSKAAIYSV----- 409
           L+L ++E+ E I+ K  +     L+D L             S    K    ++++     
Sbjct: 387 LDLPEEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHKSKDKNKRSPFLWNLKVKGK 446

Query: 410 AQERQNPLVKQ----------FLEWTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDVLEV 459
            +  ++PL +Q          +L W PEP           N+             ++ E+
Sbjct: 447 KETNEDPLARQTMLYEHVLNHYLTWVPEP-----------NDIIPGSVKSSYIKTNLFEI 495

Query: 460 VFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKK-----------YFKN 508
           +  +F+S E  I+EF  L+T+ +  ++ Y L  KWSQ LK + ++           Y  N
Sbjct: 496 LLDLFESREFFISEFRNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITN 555

Query: 509 NKQVL------KSICEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYW 562
               L       +  ++SNL ++ VM  D++ S        ++  +   V+PK IS LYW
Sbjct: 556 GILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPKFISLLYW 615

Query: 563 K---ISRKSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRH 619
           K    ++      +RI + L    Q+    +    PGR+L+   DQG VE+ L+F DGR 
Sbjct: 616 KHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRK 675

Query: 620 WSNKVSLPKYTVIELFQKV---PRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVLYSTGD 676
               VSL +Y+V+  F      P  L    + +  ++    +  ++ +W Q+ VL   G 
Sbjct: 676 LVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEG- 734

Query: 677 DCYRILERADVAF 689
           + Y ++E +D  F
Sbjct: 735 EVYSVIEYSDTGF 747

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score =  332 bits (850), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 232/733 (31%), Positives = 372/733 (50%), Gaps = 85/733 (11%)

Query: 24  ALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAE---------------- 67
            + DDL +LL W +PND  +NHQ+R PSLRIKN IK+L  + A                 
Sbjct: 29  TIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSI 88

Query: 68  ----------QVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLF 117
                     Q+ LL  L+++ + Q+RYHFF ++E++   KD+ R E YYEFPL+YV +F
Sbjct: 89  VNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPIF 148

Query: 118 TAE--ELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGH- 174
             +    S EL  LR YLLNRN  F+NN+ +R+  LI++ DDF+++  L +W+    G  
Sbjct: 149 DLDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMD-DDFDLADNLIQWLNSADGSL 207

Query: 175 PMVKFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQE 234
             ++ +++ L NKI  FC+  M G  +++ +I E FN FI++ W+QF +L+  P EDD E
Sbjct: 208 SSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCP-EDDHE 266

Query: 235 LNNLIYRCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICND 294
           L   ++ CFE+ F+ ++TKE+FD  +  +P SK +LLE+K ++K   ++   +V    +D
Sbjct: 267 LTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDF-KDYANIVTTFLSD 325

Query: 295 FHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCA 354
           F   +L PS+TT++ LL YVK IK  +V+DPTGR ++  T  +KP  +ER  L+  +L A
Sbjct: 326 FKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVDLLLYA 385

Query: 355 ILELTKDEIHEVISKNTLTENPQLLDQLSKELKNSTALNFHSVT--------------TI 400
           +L+L ++E+ E I   T   + + L  L   L +S    F +V                +
Sbjct: 386 MLDLPEEELKEKI---TFKVDIKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKV 442

Query: 401 KSKAAIYSVAQER-QNPLVKQFLEWTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDVLEV 459
           K K      +Q      ++  +L W PEP           N+             ++ EV
Sbjct: 443 KGKNGPSPTSQTMIYQHILNYYLTWVPEP-----------NDMIPGSVKSSCIKTNLFEV 491

Query: 460 VFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKK-----------YFKN 508
           +  +F+S E  I+EF  L+T+ +  ++ Y L  KW+Q LK + +K           Y  N
Sbjct: 492 LLDLFESREFFISEFRNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITN 551

Query: 509 NKQVL------KSICEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYW 562
               L       +  ++SNL ++ VM  D++ S        ++  +   ++PK IS LYW
Sbjct: 552 GILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYW 611

Query: 563 KIS---RKSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRH 619
           K +   + S    + +   L    Q+    +    PGRKL+   DQG VEI L F DGR 
Sbjct: 612 KYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRK 671

Query: 620 WSNKVSLPKYTVIELFQKVPRGLRTADIVQQTD---MAQHHVEAIVQYWCQEHVLYSTGD 676
               VSL + +VI  F        +  + Q +D   +    +  ++ +W Q+ V+ S  +
Sbjct: 672 LVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVI-SKEN 730

Query: 677 DCYRILERADVAF 689
             Y ++E  +  F
Sbjct: 731 GVYSVIENCETDF 743

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  332 bits (850), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 234/737 (31%), Positives = 378/737 (51%), Gaps = 91/737 (12%)

Query: 25  LRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAE----------------- 67
           + DDL +LL W++P+D  +NHQ+R PSLRIKN IK L  ++A                  
Sbjct: 30  ITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPNNACTSSYGAMNTAQANNSIV 89

Query: 68  ---------QVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLF- 117
                    Q+  +   +++ + Q+RYHFF ++ S+   KD+ R E YYEFPL+YV +F 
Sbjct: 90  NEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLKDIQRWENYYEFPLRYVSIFD 149

Query: 118 -TAEELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGH-P 175
                 + EL  LR YLLNRN+ F+NN+ +R+  LI++ DDF+++S L +W+    G   
Sbjct: 150 LNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIID-DDFDLASNLIRWLNSANGSLS 208

Query: 176 MVKFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQEL 235
            +  +++ L +KI +FC+  M G  +++ +I E FN FI++ W+QF +L+  P EDD EL
Sbjct: 209 SMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQYWSQFSELIGCP-EDDHEL 267

Query: 236 NNLIYRCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDF 295
              ++ CFE+ F+ ++TKE+FD  +  +P SK +LLE+K ++K   ++   +V    +DF
Sbjct: 268 TTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIMKDF-KDYTNIVTTFLSDF 326

Query: 296 HSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAI 355
              +L PS+TT++ LL YVK IK  +V+DPTGR ++  T  +KP  +ER  L+  +L AI
Sbjct: 327 KKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAI 386

Query: 356 LELTKDEIHEVIS-----KNTL----TENPQLLDQLS-------KELKNSTALNFHSVTT 399
           L+L ++E+ E IS     K  L    T +   +DQ++       K    S   N H V  
Sbjct: 387 LDLPEEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSKDKNKGGSFPWNLH-VKG 445

Query: 400 IKSKAAIYSVAQER-QNPLVKQFLEWTPEPG---PFNEDISKLGNNXXXXXXXXXXXPKD 455
            K K    S+ Q      ++  +L W PEP    P N   S +  N              
Sbjct: 446 KKEKNGSSSITQSMLYEHILNYYLTWVPEPNDMIPGNIKSSSIKTN-------------- 491

Query: 456 VLEVVFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQ---- 511
           + EV+  +F+S E  I+EF  L+T+ +  ++ Y L  KWS+ LK + +K  K+ +     
Sbjct: 492 LFEVLLDLFESREFFISEFRNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTN 551

Query: 512 -VLKSI------------CEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIIS 558
            +   I             + SN+ ++ VM  D++ S        ++  +   +YPK IS
Sbjct: 552 YIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDPAIYPKFIS 611

Query: 559 YLYWKISRKSLYGD---YRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFD 615
            LYWK +  +   +   + +   L    Q+    +    PGRKL+   DQG +E+ L F+
Sbjct: 612 LLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFN 671

Query: 616 DGRHWSNKVSLPKYTVIELFQKV---PRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVLY 672
           DGR     VSL + +VI  F      P  L    + +  ++A   +  ++ +W Q  VL 
Sbjct: 672 DGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVL- 730

Query: 673 STGDDCYRILERADVAF 689
           S  +  Y ++E +   F
Sbjct: 731 SEENGVYSVIEYSRTDF 747

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score =  320 bits (821), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 218/689 (31%), Positives = 357/689 (51%), Gaps = 61/689 (8%)

Query: 24  ALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLL---------------KLDDAEQ 68
              DDLE LLTW+NPN+  +NH MR P LR+K++IKL                +++   +
Sbjct: 26  GCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQYYNSGYISGSDGEINKGPE 85

Query: 69  VFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLF--TAEELSNEL 126
             L   LRQ+ + Q+R HFF ++  +  +KD+ RLE+YY  PL Y+ LF  +  E   E 
Sbjct: 86  FELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSPLAYIHLFESSGYEWIIER 145

Query: 127 IGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMVK-FVIDLLT 185
            GLR YLLNRN  F NNM+ R+  L ++ DDFE  +++  W+ +       K  ++DL+ 
Sbjct: 146 DGLRHYLLNRNMEFHNNMKQRMESLFMQ-DDFEYVAEMLDWVEKAHTSLSSKDILLDLII 204

Query: 186 NKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFEN 245
            K++ FC   M G   + +++ + FN FI K W+ F QLL  P +DD  L N++Y CFE 
Sbjct: 205 AKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCP-QDDHGLTNVVYTCFEK 263

Query: 246 KFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELLIPSVT 305
           +FI ++T+E+FD  + +FP SKP+++EM+ +I  +T+    +V    + F  ++L PSVT
Sbjct: 264 QFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTD-FKTIVIAFLSTFEKKVLNPSVT 322

Query: 306 TIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTKDEIHE 365
           T + LL YVK++K  + +DP+GR +      +K   +ERSDL+  +L AIL+L  D    
Sbjct: 323 TTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVILLYAILDLQLDG--- 379

Query: 366 VISKNTLTENPQLLDQLSKELKNSTAL---------NFHSVTTIKSKAAIYSVAQERQNP 416
            +  + +  +P  L  L+ EL++             N  +V T  +K          +  
Sbjct: 380 -LVGSHIQVDPVCLKALASELRDPELGIENDIYPDDNLANVATGMAKLNYEGCLPYEE-- 436

Query: 417 LVKQFLEWTPEPGPFN-EDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSPEILINEFI 475
           ++++FL W P+P       ISK   +              +L+++ ++F+S +  ++EF+
Sbjct: 437 VMQRFLSWNPDPRDMAPRAISKQSPSHM-----------SLLDILMELFESKDFFVSEFL 485

Query: 476 KLITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEE----------SNLVNV 525
           KL+T  +L ++ Y L   WS+ L+ L KK  +    +  +   +          SN+ + 
Sbjct: 486 KLLTKRLLSLKFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDYSNINSN 545

Query: 526 FVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYWKISRKSLYGDYRISSALAIIFQQ 585
            VM  D++ S        ++  +   +YPK ISYLYW    +S   D+ I   L   F++
Sbjct: 546 DVMLWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWNCQLES-KNDFEIPEPLNSEFEK 604

Query: 586 MEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQK--VPRGLR 643
             + +     GR L+   DQG +E+ L F DGR     V+L +Y VI+ F +      L 
Sbjct: 605 YSRVYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQFDEDSYANRLM 664

Query: 644 TADIVQQTDMAQHHVEAIVQYWCQEHVLY 672
              I    +M    V++ +Q+W ++ VLY
Sbjct: 665 AETISLYLNMEISRVKSALQFWVEKGVLY 693

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score =  319 bits (818), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 228/734 (31%), Positives = 376/734 (51%), Gaps = 90/734 (12%)

Query: 27  DDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAE------------------- 67
           DDL +LLTW++PND  +NHQ+R PSLRIKN IK+L  ++A                    
Sbjct: 32  DDLNSLLTWMSPNDAKSNHQLRPPSLRIKNIIKVLFPNNATTSPYSMINTSQANNSIVNE 91

Query: 68  -------QVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLF--T 118
                  Q+ L   L+++ + Q+RYHFF ++ ++   KD+ R E YYEFPL+YV +F   
Sbjct: 92  GNTNKELQLQLFSTLKEFYIFQVRYHFFLHFNNINYLKDIQRWENYYEFPLRYVPIFDVN 151

Query: 119 AEELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGH-PMV 177
             + + EL  LR YLLNRN  F+NN+ +R+  LI++ DDF+++  L +W+    G     
Sbjct: 152 VNDWALELNSLRHYLLNRNIKFKNNLRTRLDKLIMD-DDFDLADNLIQWLKSANGSLSST 210

Query: 178 KFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNN 237
           + +++ L +KI  FC+  M    +++ +I E FN FI++ W+QF +L+  P EDD EL  
Sbjct: 211 ELIVNALYSKINKFCEDNMSRVWNKRFMIMETFNKFINQYWSQFSKLVGCP-EDDHELTT 269

Query: 238 LIYRCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHS 297
            ++ CFE+ F+ ++T E+FD  +  +P SK +LLE++ ++K   ++   +V    +DF  
Sbjct: 270 TVFNCFESNFLRIRTNEIFDICVLAYPDSKVTLLELRKIMKDF-KDYTNIVTTFLSDFKK 328

Query: 298 ELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILE 357
            +L PSVTT++ LL YVK IK  +V+DPTGR ++  T  +KP  +ER  L+  +L A+L+
Sbjct: 329 YILNPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAMLD 388

Query: 358 LTKDEIHEVISKNT-LTENPQLLDQL-----------SKELKNSTALNFHSVTTIKSKAA 405
           L ++E+ E I+ N  +     L+D L           +K  KN  +  F     +K K  
Sbjct: 389 LPEEELKEKINFNVDMKALLSLVDTLHDSDINQDTNITKRDKNKKS-PFLWNLKVKGKRE 447

Query: 406 IYSVAQERQNPLVKQ----FLEWTPEPG---PFNEDISKLGNNXXXXXXXXXXXPKDVLE 458
           +      R   L +     ++ W PEP    P N   S +  N              + E
Sbjct: 448 LNKDLPIRHAMLYEHILNYYIAWVPEPNDMIPGNIKSSYIKTN--------------LFE 493

Query: 459 VVFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKKYFK-----NNKQVL 513
           V+  +F+S E  I+EF  L+T+ +  ++ Y L  KW++ LK + +K  K     ++  + 
Sbjct: 494 VLLDLFESREFFISEFRNLLTDRLFTLKFYTLDEKWTRCLKLIREKIVKFTETSHSNYIT 553

Query: 514 KSI------------CEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLY 561
             I             ++SNL ++ VM  D++ S        ++  +   ++PK IS LY
Sbjct: 554 NGILGLLETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPIIFPKFISLLY 613

Query: 562 WKISRKSLYGD---YRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGR 618
           WK +  +   +   + +   L    Q+    +    PGRKL+   D+G VEI L F DGR
Sbjct: 614 WKYNCDTQGSNDLAFHLPIDLERELQKYSDIYSQLKPGRKLQLCKDKGKVEIQLAFKDGR 673

Query: 619 HWSNKVSLPKYTVIELFQKV---PRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVLYSTG 675
                VSL + +VI  F      P  L    + +  ++A   +  ++ +W Q+ VL    
Sbjct: 674 KLVLDVSLEQCSVINQFDSPNDEPICLSLEQLSESLNIAPPRLTHLLDFWIQKGVLLKE- 732

Query: 676 DDCYRILERADVAF 689
           +  Y ++E +++ F
Sbjct: 733 NGTYSVIEHSEMDF 746

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  290 bits (741), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 204/721 (28%), Positives = 372/721 (51%), Gaps = 81/721 (11%)

Query: 25  LRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAEQVF----------LLQL 74
           + D+LE LL W++PND ++NH +  P+L++K  IK  ++  +  ++          +   
Sbjct: 29  ISDELETLLIWLDPNDPNSNHHLHPPTLQLKTIIK--QITPSSDIYKDPSNSIKNNIQNW 86

Query: 75  LRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAEELSNELIGLRKYLL 134
           L+ + + Q+R +FF   +++ QYKDM++LE+YY+FPL+++ LFT +E   EL+ LR Y+L
Sbjct: 87  LKLFYVYQVRTYFFKKIDNIRQYKDMIKLEKYYQFPLQFIPLFTFQEWCFELLSLRHYIL 146

Query: 135 NRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMVK-FVIDLLTNKIELFCK 193
           ++N  F   +   +R LI +E+DFE S  +  W+ +   + + + F++D+L  KI L+C+
Sbjct: 147 HQNKEFTQKIILELRQLI-KEEDFETSLDIVTWIREVDSNLLSENFILDILLEKITLYCE 205

Query: 194 SRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFENKFIEMKTK 253
             M+GN  +++++ E +N F+   W  F QLL    ED+ ++ N++++ FE +FI+++ +
Sbjct: 206 QTMKGNWTRRYLVMETYNTFMMNYWLNFTQLLNC-KEDNHKITNILFKYFEKQFIKIRIQ 264

Query: 254 ELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELLIPSVTTIEILLYY 313
           E+F   I  +P +KP+LLE+++++        +LV    + F   +L P++ TI+ LL Y
Sbjct: 265 EIFKICILSYPDTKPTLLELRNLL-VTYNFFQKLVVNFLSAFERIVLTPTINTIDCLLAY 323

Query: 314 VKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTKDEIHEVISKNTLT 373
           ++ +K   ++DP+GR +   T  + P  +ER  L   +L AIL L K ++   I    ++
Sbjct: 324 IRTVKSFQILDPSGRYLYSITNYINPHFRERKMLAPILLHAILALPKIDLENAIYPIKVS 383

Query: 374 -----------ENPQLLDQLSKELKNSTALNFHSVTTIKS----------KAAIYSVAQE 412
                      E+P+L  + +   KNS    F+ + + K              + + + E
Sbjct: 384 SISLKLIINELEDPELGIENTSTKKNSIK-KFNEILSPKRFNNHNSSEYLPDLLQNTSSE 442

Query: 413 RQNP------LVKQFLEWTPEPGPF-NEDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFD 465
             N       +VKQFL W P P      D  KL ++             ++L+++  +F+
Sbjct: 443 DSNSTLLVQKVVKQFLTWVPIPNDIATNDTKKLYSST------------NLLDILLNIFE 490

Query: 466 SPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKS-ICEESNLV- 523
           S E L+ EF KL++  +L  + Y L  KW   L+ L K++   +     + + +  NLV 
Sbjct: 491 SKEFLLTEFSKLLSKRLLITKNYKLEGKWGACLQLLRKRFSSGSDNYTNTNLADTDNLVN 550

Query: 524 -------NVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYW------KISR--KS 568
                  N+ VM SDL  S+           + + VYPK IS  YW       +S     
Sbjct: 551 GENLKITNMNVMLSDLNYSSELCKIFHHANGVNTRVYPKFISSHYWVDLDDENVSNGPNE 610

Query: 569 LYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRHWSNKVSLPK 628
               ++I  +L   F++  K +E  + GRK+    ++G +EI L+F+DGR      +LP+
Sbjct: 611 ETNHFQIPPSLLGYFEEYAKLYEDLNEGRKVDIWPNEGVIEIKLSFEDGRVLEIDATLPQ 670

Query: 629 YTVIELFQ------KVPRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVLYSTGDDCYRIL 682
           Y +++  Q      +  +G    ++    +++  +V  +V +W +++VL    DD Y IL
Sbjct: 671 YALLQYIQEKNAIMQNNQGFTVNELSVPLNLSLQNVTELVDFWLKKNVLKKV-DDKYSIL 729

Query: 683 E 683
           E
Sbjct: 730 E 730

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score =  280 bits (715), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 207/709 (29%), Positives = 366/709 (51%), Gaps = 73/709 (10%)

Query: 27  DDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLD-----DAEQVFLL-QLLRQWTL 80
           DD+++LL W+NPND  +NHQ++ P++R+K  IK + LD     D + +  L  LLR + +
Sbjct: 26  DDIDSLLDWLNPNDPKSNHQLKPPTIRLKKVIKKILLDVNTLGDYDSIETLNSLLRYYYI 85

Query: 81  SQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAEEL--SNELIGLRKYLLNRNS 138
            Q+R +FF N +S+  +KD+++LE+YYEFP+ +V +F         EL  +R YLL  N 
Sbjct: 86  FQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNL 145

Query: 139 TFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMV--KFVIDLLTNKIELFCKSRM 196
           TFR+N+ +R++ L+ +EDDF+++ ++ KW  +     +   + +++ L +KI ++   + 
Sbjct: 146 TFRSNLINRLKKLV-KEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYADKQF 204

Query: 197 EGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFENKFIEMKTKELF 256
                Q+ +I E +N FI+K W+ F  LL    EDD E+  ++Y+ FE +F+ ++++E+F
Sbjct: 205 TNAWSQRFIIMETYNKFINKYWSNFAVLLNCA-EDDHEITKVLYKYFEKQFLRIRSEEIF 263

Query: 257 DEIIPKFPLSKPSLLEMKSVI---KGATEELDRLVAQICNDFHSELLIPSVTTIEILLYY 313
           D  +  +P SKP+++E++ ++   K +T  L RL+++    F  ++L  S+ T  IL+ Y
Sbjct: 264 DICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSE----FQLKVLNLSIPTCTILIAY 319

Query: 314 VKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTKDEIHEVISKNTLT 373
           +K +K L+++DPT R +  FT    P ++++SD+I  +L AIL+L  D+I    +   + 
Sbjct: 320 IKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIK---TNPIVK 376

Query: 374 ENPQLLDQLSKELKNS---TALNFHSV---------TTIKSKAAIYSVAQERQNPLVKQF 421
            +  LL  LS+EL+ S     LNF  V            K+ + +    QE    L  Q 
Sbjct: 377 VDQNLLKLLSEELRESHFGINLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQI 436

Query: 422 LE----WTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSPEILINEFIKL 477
           L     W PE    + + S                 K++L+++F +FD  E+ +  F++L
Sbjct: 437 LNRALTWLPESKLVSPNKS-----------IKMMRKKNLLDILFAIFDDHELFLKRFVEL 485

Query: 478 ITNHMLQMEGYILSAKWSQLLKTLMKKYFKN---------NKQVLKSICEESNLVNVFVM 528
           +   +  ++GY L   W Q L+    K+  N         N + L    +   + N+ VM
Sbjct: 486 LKQKLFVIKGYNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMYMTNIDVM 545

Query: 529 WSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYWKIS-----RKSLYGDYRISSALAIIF 583
             D+  S         +  + + +  KIIS LYW+       RK+ YG   ++     +F
Sbjct: 546 LWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQYDMKNEKRKTYYG--LLNKMDQTLF 603

Query: 584 QQMEKAFEMKS---PGRKLRFQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQKVPR 640
            Q++K  ++ S   PGR L    DQ T+EI   F+D R  + + +   Y  I  F +   
Sbjct: 604 NQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLE-NE 662

Query: 641 GLRTADIVQQTDMAQHHVEAI---VQYWCQEHVLYSTGDDCYRILERAD 686
           G  +  + + + +    +E +   +++W  + +LY  G   YR LE  D
Sbjct: 663 GTSSYTLEELSIITSFGLEDLKISLKFWLDQKILYFDG-KTYRPLEYLD 710

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score =  273 bits (699), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 203/701 (28%), Positives = 345/701 (49%), Gaps = 55/701 (7%)

Query: 14  LISALPENDE-ALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAEQVFLL 72
           +I++L E  E      LE+LL W++PN      Q + P+L +K+ I LL+   ++     
Sbjct: 10  IITSLREQVERQFHPQLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQDEKFK 69

Query: 73  QLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAEELSNELIGLRKY 132
             LR++ L  +++HF  N + +   KD   LE  Y +PL+++ L  + ++SN +   + Y
Sbjct: 70  MWLREYYLYVVKFHFMKNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDISNLVKSFKHY 129

Query: 133 LLNRNSTFRNNMESRIRVLILEEDDFEMS------SKLYKWMVQGLG-HPMVKFVIDLLT 185
           L+++N TFR N+ ++ +   L  + FE         ++  W+    G       ++D   
Sbjct: 130 LIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASL 189

Query: 186 NKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFEN 245
            KIE+F + +M G ++QK ++ E FN FID  W    QL+    EDD +L NLIY+ FE 
Sbjct: 190 TKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWKNLTQLIG-NIEDDHDLTNLIYQFFER 248

Query: 246 KFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIK-------GATEELDR-------LVAQI 291
           +FI+++ +E+   ++  +P +KP++LE+KS++        GA +   R       L+ Q 
Sbjct: 249 QFIKIRIEEILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQF 308

Query: 292 CNDFHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERS-DLITT 350
              F  E L P + TI++L  YVKA K  +++DP+G  +N     +KP ++    +++  
Sbjct: 309 LVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDI 368

Query: 351 VLCAILELTKDEIHEVISKNTLTENPQLLDQLSKELKNSTALNFHSVTTIKSKAAIYSVA 410
           +L A+L L   ++ E+  + T T + + ++ LSKEL N  + +   V   K      +  
Sbjct: 369 LLYALLNLKSKDLIELNCEKT-TYDMRSIELLSKELSNDHSKHAGDVDYKKFSPEGTNEF 427

Query: 411 QERQNP---LVKQFLEWTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSP 467
           +    P   +   FL W P   P    IS+  N+           P   ++ VF   +S 
Sbjct: 428 ENSTLPYEQVYTDFLNWKPSITP----ISESSNDDEFASLGKNITP---IDYVFNALESK 480

Query: 468 EILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEESNLVNVFV 527
           + LI+EF+KL+T  +L M+GY +  +W + LK L  K   ++K ++      S++  + +
Sbjct: 481 DKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDK-VTSDKNIVNDESITSDINTILI 539

Query: 528 MWSDL--------EKSASFQNWSTKLQLIPSNVYPKIISYLYWKISRKSLYGDYRISSAL 579
           M  D+        EK + FQN S+++QL     +PK IS LYWK  R+S Y  + + S L
Sbjct: 540 MLHDISISKESSNEKISEFQN-SSEMQL-----FPKFISKLYWKFKRQSEY-QFPLDSKL 592

Query: 580 AIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQK-- 637
                +  K++    PG KL+  N  G   + LTF DGR  S   +  +YTV+  F    
Sbjct: 593 RKKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDK 652

Query: 638 --VPRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVLYSTGD 676
               + L    +     M    V A +Q+W  + VL    D
Sbjct: 653 DDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQND 693

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score =  273 bits (697), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 197/674 (29%), Positives = 352/674 (52%), Gaps = 52/674 (7%)

Query: 32  LLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAEQVFLLQLLRQWTLSQLRYHFFHNW 91
           LL W++P     NHQ++ P+L +K  I+ L L  +    LL  ++ +   Q R +F++ +
Sbjct: 33  LLQWLDPAG-KKNHQLKPPNLLVKTMIEKLLLG-SNDYQLLSNIQDYYCWQCRVYFYNEY 90

Query: 92  ESLMQYKDMLRLERYYEFPLKYVGLFTAE-ELSNELIGLRKYLLNRNSTFRNNMESRIRV 150
           + +    ++ R+ER+  FPLKY+ +F     + NE+     YLL  N    +    R+R 
Sbjct: 91  KRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRN 150

Query: 151 LILEEDDFEMSSKLYKWMVQGLGHPMVKFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVF 210
            +LE DDFE+++++  +            V+D++ +KIE FC+       +++++I E F
Sbjct: 151 RMLE-DDFELATEIVDYF-DYCQTDSTSIVLDIILDKIEQFCQLHYTRKWNKRYLIMETF 208

Query: 211 NAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFENKFIEMKTKELFDEIIPKFPLSKPSL 270
           N FI + W+Q   LL F  ED+  + N +Y+ FE +FI ++T E+FD  I      +P+L
Sbjct: 209 NQFISQYWDQLSSLL-FCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPTL 267

Query: 271 LEMKSVIKGATEELDRLVAQICNDFHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSM 330
           LE++  I     + + +V ++ + F+ +++ PS+ T + L  Y++ IK   ++DP+GR +
Sbjct: 268 LELRKEI-STVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYL 326

Query: 331 NRFTFKLKPKIKERSDLITTVLCAILELTKDEIHEVISKNTLTE--NPQLLDQLSKELKN 388
              +  +KP  ++R DL+  +L ++L L  DE  ++   NT+    + + L  L+ ELK+
Sbjct: 327 QTISSYVKPHFRQRKDLVHLLLFSMLGL--DETDQL---NTMPSQVSEEKLTALTNELKD 381

Query: 389 STALNFHSVTTIKSKAAIYSVAQERQN----PLVKQFLEWTPE-PGPFNEDISKLGNNXX 443
           +   ++   +       I S ++E  +     ++K+++EW PE P  F + I  L ++  
Sbjct: 382 TEICSYTEESDDVVDPMIGSFSKEEDSMVLEQVIKRYMEWIPEVPTSFGKGI--LSDHKL 439

Query: 444 XXXXXXXXXPKDVLEVVFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMK 503
                      D+ +++ ++ +S E L+ EF  L+T  +L + GY L  KWS+ L +L+K
Sbjct: 440 -----------DLFDILLELLESKETLVIEFKNLLTKKLLDLRGYTLDKKWSKFL-SLLK 487

Query: 504 KYFKNNKQVLKSICEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSN----VYPKIISY 559
           K F N         + +N+  + +M  D+ KS      +T +QL   N    VYPKI+S 
Sbjct: 488 KRFDNRSTETMDEEDLNNINTIDIMLRDIYKSRQI---ATDMQLDLHNTNVKVYPKIVSA 544

Query: 560 LYWK--ISRKSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDG 617
           LYW      +S  GD+ +   L  + +   + +  K  G+KL  + D G+V + L+F DG
Sbjct: 545 LYWSNNSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDG 604

Query: 618 RHWSNKVSLPKYTVIELFQKVPR--------GLRTADIVQQTDMAQHHVEAIVQYWCQEH 669
           R    K SL +Y+V+ LF K P+        GL  +++  ++ M    +  I++YW  + 
Sbjct: 605 RTVHCKASLRQYSVLTLF-KSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKD 663

Query: 670 VLYSTGDDCYRILE 683
           VLY + D  YR LE
Sbjct: 664 VLYFS-DGKYRTLE 676

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  256 bits (653), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 178/712 (25%), Positives = 355/712 (49%), Gaps = 55/712 (7%)

Query: 5   EELENYHLQLISALPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKL-LKL 63
           +EL+  H +++  L  N   L ++++ +L W+NP       Q ++P+LRIK  +K+ L+ 
Sbjct: 6   DELKLLHEKILLNLASN---LEEEVDMVLAWLNPT-----FQPQIPTLRIKQCLKVVLEQ 57

Query: 64  DDAEQVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAEELS 123
            D    FL++   Q+ L+ +R HFF  ++ ++ +KDM++LE+ Y   ++++   +   + 
Sbjct: 58  SDERTRFLIE---QYYLTLIRTHFFLQFDDIVNWKDMIKLEKLYISKVEFMFGTSVYWIK 114

Query: 124 NELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMVKFVIDL 183
            E+I  ++ L+ +N+ FR  + +++   IL+ +D     ++Y+W+        ++F + +
Sbjct: 115 EEMISFKRLLMKKNNEFRKQLHAKLESHILD-NDLVRFDQMYQWLAPAFDGQEIEFNVRI 173

Query: 184 LTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCF 243
           +  K++   +  M+  +D ++++   +N FI   W++F +LL    EDD EL  +IY+ F
Sbjct: 174 INLKVDQMSQKLMKNKIDDRYLVMNTYNHFIKDFWSKFSKLLII--EDDHELTAIIYQSF 231

Query: 244 ENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELD-RLVAQICNDFHSELLIP 302
           E  +I+ K  E + +I+PKFP S+  LLE++S++    + +  +++  + + F S  L  
Sbjct: 232 EKNYIKYKCDEFYTDIVPKFPASRKCLLELRSILNKDIKTVGTKVLETLYHGFVSRFLTS 291

Query: 303 SVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTKDE 362
           S+ T EIL YY+K +KCL ++DP G  +   +  ++  +  R D+I T+L  I     +E
Sbjct: 292 SLLTCEILYYYIKTVKCLKIIDPMGICLRSLSKAVRVYLNPRPDIIKTLLLGIFPFQNNE 351

Query: 363 IHEVISKNTLTE-NPQLLDQLSKELKN-STALNFHSVTTIKSKAAIYSVAQERQNPLVKQ 420
             ++ S    +  + + L+Q S+E+ + S      +     ++  +     +  + L+KQ
Sbjct: 352 RFKIASSTDGSSVHLEKLEQFSREVGDFSMGPELPTALPWFNQPHLPRCTYDGDDQLLKQ 411

Query: 421 FLEWTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSPEILINEFIKLITN 480
           +L W PEP     D+    +N           P D++ V+  V +S   L+++ + +++ 
Sbjct: 412 YLNWVPEPPRIKLDVEDFADN-----DGKYVPPVDLIHVLLDVLESKRTLVDDLLGVVSG 466

Query: 481 HMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEESNLV---NVFVMWSDLEKSAS 537
             ++ E Y L  +W +++  ++       K  + S  EE++L    +V +M  DL  S+ 
Sbjct: 467 KFIESEEYSLDPEWQRIMDIILNHLEGTRKGTVTS--EEADLTHLNDVDIMLEDLRLSSQ 524

Query: 538 FQNWSTKLQLIPSNVYP--KIISYLYWK----ISRKSLYGDYRISSALAIIFQQMEKAFE 591
           F+N            +P  KI+S LYW+    ++ + +   Y+  S +  + Q++ K +E
Sbjct: 525 FRNQVAHKNNSHFENFPHIKILSKLYWRHYQNLNGRLVTTKYKWDSEMEPLIQKLTKVYE 584

Query: 592 MKSPGRKLRFQNDQGT-VEIALTFDDGRHWSNKVSLPKYTVIELFQKVPRGLRTA----- 645
             + GR L+F     + V I +    G     KV++ +Y VI  FQ    G R A     
Sbjct: 585 RLNTGRTLKFDTGSSSRVSINIVTKSGERRFFKVTMEQYLVISHFQNETNG-RNAPGMMA 643

Query: 646 --------------DIVQQTDMAQHHVEAIVQYWCQEHVLYSTGDDCYRILE 683
                         D+ + T M +  +  I+ +W Q+ ++    DD Y + E
Sbjct: 644 DCNYVIPERRYTLKDLHKMTSMPRQKILDILSFWQQKEIVTKHSDDSYSVQE 695

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  221 bits (564), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 192/714 (26%), Positives = 342/714 (47%), Gaps = 76/714 (10%)

Query: 27  DDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAEQVFLLQLLRQWTLSQLRYH 86
           +DL+ LL W++P +    HQ + PSLRIK SI+ ++            L +  +  +R+ 
Sbjct: 18  EDLDRLLLWLSPAE----HQCKPPSLRIKKSIQRIRECFQLSSDFTNCLVKLYIDLIRFE 73

Query: 87  FFHNWE---SLMQYKDMLRLERYYEFPLKYVGLFTAEELSNELIGLRKYLLNRNSTFRNN 143
           F    +   + +++ D+L+LE   E P  ++     E   N L  LR YLL+ + +F+  
Sbjct: 74  FISYMKENANCLKFNDVLKLENRIEHPRLFIPELEFEYFKN-LHMLRHYLLDSDKSFKTA 132

Query: 144 MESRIRVLILEEDDFEMSSKLYKWMVQGLGHPMV--KFVIDLLTNKIELFCKSRMEGNVD 201
           + + I  LI+E DDF  ++ +  W+       +     V+D+L  KI   C   + G+  
Sbjct: 133 LCTSIENLIME-DDFYSATIILDWIDSAYSIDLSPKDLVLDMLVKKIAGICSGSIRGSWT 191

Query: 202 QKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFENKFIEMKTKELFDEIIP 261
           ++ ++ E FN FI+  W+ F QLL+ P E+D EL   +++CFE +FI ++  E+F+    
Sbjct: 192 RRFIVIETFNDFIEVYWSHFAQLLKCP-ENDHELTKTVFKCFEREFINIRINEIFEIFTS 250

Query: 262 KFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELLIPSVTTIEILLYYVKAIKCLM 321
            +P SKP++LE++ V+K A ++L RL     + F  E+L P VTTI+ L  Y+KAIK  +
Sbjct: 251 AYPESKPTILELRKVMK-APKDLQRLTYTFLDTFKDEMLNPCVTTIDALTSYLKAIKGFL 309

Query: 322 VVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTKDE-----IHEVISKNTLT--- 373
           ++DP GR +N  T  +KP  +++SDLI  +L AIL+L   +     I  +   N L+   
Sbjct: 310 LLDPAGRYLNLVTTFVKPYFQDKSDLINILLYAILDLKPKDFEDLNISYIPGLNKLSLDM 369

Query: 374 -ENPQLLDQLSKELKNSTALNFHSVTTIKSKAAIYSVAQERQNPLVKQFLEWTPEPGPFN 432
            E+P+   +  +   N+      ++ +I +  +++      Q+ ++KQF+ W PEP   N
Sbjct: 370 REDPEFSIENVEPNDNNYKRTVPNLESIGAN-SLHDKGTLIQDHIMKQFMMWVPEPNMNN 428

Query: 433 -EDISKLGN-----NXXXXXXXXXXXPKDVLEVVFQVFDSPEILINEFIKLITNHMLQME 486
            E+    GN     N             ++L+++  +F+S EI I +F+ L+T    +++
Sbjct: 429 LENDHDNGNDFEEDNNDVTAVNSIFYNVNLLDILLDLFESKEIFIGKFVNLLTIKFFKLQ 488

Query: 487 GYILSAKWSQLLKTLMKKYFKNNKQVLKSICEE-------------------SNLVN--- 524
            Y +   W + L+ +  K+  +N  + + + E+                   +N  N   
Sbjct: 489 NYRVDPNWQKCLELINSKFNSSNISMDEKMEEDVAIGTVNPTNENYVDEKRKTNASNDME 548

Query: 525 --------VFVMWSDLEKSA--SFQNWS--TKLQLIPSNVY--PKIISYLYWKISRKSLY 570
                   + VM +D+  S   SFQ  S   +  L  +NV   PK IS LYW      L 
Sbjct: 549 EIQISLNKIEVMLNDIRHSEKFSFQISSELNRYGLRSNNVGIKPKFISPLYWDYEDNELG 608

Query: 571 GDYRISSAL-------AIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRHWSNK 623
            +  +   +       AI+  Q    +   + G  L +   +  +E+ ++F+DG      
Sbjct: 609 VNNFLKENVFDEECTKAIL--QYASEYCSINKGFALHYCKGKEMIEVEISFNDGAIKGFL 666

Query: 624 VSLPKYTVIELFQKVPRGLRTADIVQQTDMAQHHVEAI--VQYWCQEHVLYSTG 675
           V+  +Y V+ LF      L    I+   +  +   E I  +++W +++VL   G
Sbjct: 667 VNASQYYVLTLFDTGNEKLTIESILTAGEAKRSKNEIIDALKFWVEKNVLVYEG 720

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  192 bits (487), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 177/705 (25%), Positives = 326/705 (46%), Gaps = 85/705 (12%)

Query: 23  EALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSI-----KLLKLDDAEQVFLLQLLRQ 77
           E  +DDLE ++ WI+P      H    PSLR+K +I     K  +LD   +++ + +++Q
Sbjct: 19  EQEQDDLERVMGWIHPQ----AHACHPPSLRMKKAIRSVLGKASELDRQFKIYYIDVIKQ 74

Query: 78  -WTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFT-AEELSNE--LIGLRKYL 133
            +   Q++  F H          +  LE    +P+ Y+   + +++L+ E  +  LR YL
Sbjct: 75  EYLCDQVKREFKH----------IQVLESKLVYPVTYLPFLSISDQLAIEQTICSLRHYL 124

Query: 134 LNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQG---LGHPMVKFVIDLLTNKIEL 190
           ++ +   RN++ +    L +++DDFE   ++ +W+      L  P     +D + +KI  
Sbjct: 125 VDNDDNLRNSLVAEFETL-MQDDDFESGYQIIEWLYTANAKLLRPW-NLALDTIVSKIST 182

Query: 191 FCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFENKFIEM 250
            C + M  N + K ++   FN FI+  W+   + L   +ED+ +   ++Y+CFE +F+ +
Sbjct: 183 LCDNEMRRNWEAKFLVMNTFNKFINLYWSHLAKFLHL-SEDNHDFTKVLYKCFEKEFVRI 241

Query: 251 KTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHSELLIPSVTTIEIL 310
           +T+E+F+ ++  +  +K ++LE+++ + G  E L +LV Q    F  ++L PSV T+E L
Sbjct: 242 RTEEIFEIVVESYQAAKTTILELRTFMSGY-ERLSKLVNQFLKQFKIKVLNPSVNTVEAL 300

Query: 311 LYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTKDEIHEVISKN 370
           + +++++KC +++DP  R M+  T  +KP   +R D +  +L AIL+L +D   E +  +
Sbjct: 301 VAFIRSVKCFVILDPRARHMHTITNFVKPFFHQRGDAVQIILYAILDL-RDVDFEKMGVS 359

Query: 371 TLTENPQLLDQLSKELKNSTALNFHS--VTTIKSKAAIYS--------------VAQERQ 414
            +    + L +LS EL+    +N ++   T   S + I S              +     
Sbjct: 360 PV----KGLSELSHELREDPYVNINAKCQTPTPSPSKISSPHLNDSSSMDVDDKLDDGTT 415

Query: 415 NPLVKQFLEWTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSPEILINEF 474
           + + KQ L      G    +                    ++L+ +F++FD  + L++ F
Sbjct: 416 DLVYKQVLNQFXXRGHHETNQGTRDYVGVNVKFSQRSNRTNLLDPLFELFDKKDELLSCF 475

Query: 475 IKLITNHMLQMEGYILSAKWSQLLKTLMKKYFK--------------------NNKQVLK 514
           +KL+T  + ++ GY L   W++  + + +K  K                    NN+QVL 
Sbjct: 476 LKLLTLKLFKLSGYTLEPNWNECYQLIKRKVTKGDVGDGGPLSRDTADAPVSSNNEQVLL 535

Query: 515 SICEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYWK-----ISRKSL 569
           S      L  + VM  DL ++A       +  ++  NV+PK IS  YW       ++   
Sbjct: 536 S------LNKIDVMLHDLRENAKITRRLHRTSMLNGNVFPKFISSQYWSYRDDTFTKAGN 589

Query: 570 YGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGR-HWSNKVSLPK 628
               +I   L     Q    F     GR +R   ++   EI LT +DG      KV   K
Sbjct: 590 RDQIKIDPVLETDILQYGGRFCELKYGRMVRLCKEKTIFEIELTVNDGEVPQVFKVDAMK 649

Query: 629 YTVIELFQ-KVPR-GLRTADIVQQTDMAQHHVEAIVQYWCQEHVL 671
           Y+VIE +    PR G    ++ +   M    V+  + YW    +L
Sbjct: 650 YSVIEKYATGGPRAGYTPTELCELCGMDIADVQTSLTYWVNAGLL 694

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score =  184 bits (468), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 182/758 (24%), Positives = 349/758 (46%), Gaps = 109/758 (14%)

Query: 29  LENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAEQVFLLQLLRQWTLSQLRYHFF 88
           L+ +L W+NPN+          ++ +KN I ++     +   +  L +++    ++ HF 
Sbjct: 30  LQTMLLWLNPNE-TTTQSATTMTIDLKNCINIIVSTYGKDDQIRLLFKKYYSFVIKLHFM 88

Query: 89  HN--WESLMQYKDMLRLERYYEFPLKYV-GLFTAEELSNELIGLRKYLLNRNSTFRNNME 145
            +   +++   ++  +LE  Y  PL++   L    E+ + +   ++YL+N N TFR N+ 
Sbjct: 89  KDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTNEMQSLINIFKRYLINNNFTFRKNVL 148

Query: 146 SRIRVLILEEDDFEMS------SKLYKWMVQGLGH-PMVKFVIDLLTNKIELFCKSRMEG 198
             +  L L ED FE        +++  W+    G+   +  ++DLL  KIE FC+  M G
Sbjct: 149 HSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGNVSPIDLLLDLLLRKIEKFCQREMAG 208

Query: 199 NVDQKHVIEEVFNAFIDKCWNQFIQLLQFPN------EDDQELNNLIYRCFENKFIEMKT 252
             + + +I E FN FI++ W    +L           E+D  L NLIY  F  +FI+++ 
Sbjct: 209 LWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFIKIRI 268

Query: 253 KELFDEIIPKFPLSKPSLLEMKSVIKGAT---------------------EELDRLVAQI 291
            E    ++  FP+S P+++E+K+V+  ++                     E L   V + 
Sbjct: 269 NESLKIMVSNFPISTPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYLKLFVKKF 328

Query: 292 CNDFHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKER-SDLITT 350
             DF  + L P + TI ++   VK     +++DP G+ +      LKP I+ R +D++  
Sbjct: 329 LKDFQRKFLNPCIPTIPLIRALVKMTNSFLILDPRGQLLTTIILTLKPLIQRRTTDIVNI 388

Query: 351 VLCAILELTKDEIH--------EVISKNTLTEN--PQLLDQLSKELKNSTALNFHSVTT- 399
           +L A+L L + E+H        ++ S N L     P ++  +++   N + + + +  T 
Sbjct: 389 LLYAMLNLNEMELHKLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVPYTTAGTG 448

Query: 400 -----------------IKSKAAIYSVAQ-ERQNP-------LVKQFLEWTPEPGPFNED 434
                            +K  A   ++    R+ P       L KQ+LEW P      + 
Sbjct: 449 TTCSNERITNDDIPYQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVPPMNKIYDS 508

Query: 435 ISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSPEILINEFIKLITNHMLQMEG-YILSAK 493
            SK  N             +  ++ +F+ FDS ++L++E++KL+T   +  +  Y L   
Sbjct: 509 TSK--NTVVDDEETSRIRSRHAIDYLFRFFDSIDLLLSEYLKLLTEKFIHSKNYYTLDNN 566

Query: 494 WSQLLKTLMKKYFKNNKQVLKSICEESNLVNVFVMWSDLEKSASF---QNWSTKLQLIPS 550
           W   L  L +   K+N   +     +S +  + +M +D+++SAS+   +  + +  ++  
Sbjct: 567 WLWCLNLLKE---KSNSSNVPDENVKSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQG 623

Query: 551 NV--YPKIISYLYWKIS-------RKSLYGDY-------RISSALAIIFQQMEKAF-EMK 593
           ++  YPK +S LYWKI+       R ++ GD+       + +     +  ++ + F E+ 
Sbjct: 624 DIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELG 683

Query: 594 SPGRKLRFQNDQGTVEIALTFDDGRH-WSNKVSLPKYTVIELFQKVPRGL-----RTADI 647
             G+K+    D+  +E+ ++FDDGR  + + +++ +Y V+ LF  V +G      +  D 
Sbjct: 684 RKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFT-VEKGAAFTLEKAYDF 742

Query: 648 VQQTDMAQHHVEAIVQYWCQEHVLYSTGDD-CYRILER 684
                  +  +E  +Q+W  + VLY   DD CY++LER
Sbjct: 743 FSGLKRGKQKLEECIQFWVDKKVLYLDDDDGCYKVLER 780

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score =  142 bits (359), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 121/410 (29%), Positives = 210/410 (51%), Gaps = 43/410 (10%)

Query: 302 PSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCAILELTKD 361
           PS+TT++ L+ YVK +K  + +DP+G+ ++  +  + P ++ER+DL++ +L AIL+L  +
Sbjct: 3   PSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERNDLVSVLLYAILDLQSE 62

Query: 362 EIHEVISKNTLTENPQLLDQLSKELKN---------STALNFHSVTTIKSKAAIYSVAQE 412
              E  ++N L  +  ++  LS EL++         +  L+ + +T   S  +  S    
Sbjct: 63  NFQEE-AQNILDADSLVI--LSDELRDPEFGIEGELNIDLDKNELTGQPSNKSGDSSLLY 119

Query: 413 RQNPLVKQFLEWTPEPGPFNEDISKLGNNXXXXXXXXXXXPKDVLEVVFQVFDSPEILIN 472
           RQ  ++ Q L W PE    +    K+               K++L+++ ++F++ E+ I 
Sbjct: 120 RQ--VITQMLNWVPESSKIDSKRQKM-----------IGLRKNLLDILLEIFENNEVFIA 166

Query: 473 EFIKLITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEE------SNLV--- 523
           EF+KL+T  +L+++ Y L ++WS+ LK L+K+ FK N     SI         S+LV   
Sbjct: 167 EFLKLLTKKLLKLKYYKLDSRWSKCLK-LLKEKFKGNSAGTTSISTNIGNVTGSDLVYIN 225

Query: 524 NVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYWKISR--KSLYGDYRISSALAI 581
           N+ VM  DL+ S    +   +++ +   + PK IS LYW  ++  KS   + + +    +
Sbjct: 226 NIDVMLWDLKTSGDLTSRMHQIEGLDRRIQPKFISSLYWDQAKESKSKGNNAKQTQIDPL 285

Query: 582 IFQQMEKAFEMKS---PGRKLRFQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQKV 638
           +  Q+EK   + S   PGR L    D GTVE+  TF+DGR  S   +L +  +I  F + 
Sbjct: 286 LSTQLEKYIRVYSELKPGRTLHLLKDHGTVELEFTFEDGRTISCDATLEQSNIINYFSEA 345

Query: 639 --PRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVLYSTGDDCYRILERAD 686
               GL    +   + +    ++ I+Q+W  E VLY  G   YRILE  D
Sbjct: 346 VSENGLSLEQLHILSGIESTGLKKILQFWVDEKVLYFDG-QLYRILEYLD 394

>SAKL0H13310g Chr8 (1143437..1145353) [1917 bp, 638 aa] {ON} similar
           to uniprot|P13099 Saccharomyces cerevisiae YLR234W TOP3
           DNA Topoisomerase III
          Length = 638

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 13/96 (13%)

Query: 478 ITNHMLQMEGYILSAKWSQ------LLKTLMKKYFKNNKQVLKSICEESNLVNVFVMWSD 531
           +  H++ ++     + W+Q          L  K  K+ +++ K+I  ES   +  ++W+D
Sbjct: 59  VAGHLMNIDFGSEYSNWNQCDTRKLFDAPLEDKKSKDQQKIAKNIENESKYADFLMIWTD 118

Query: 532 LEKSASFQNW-----STKL--QLIPSNVYPKIISYL 560
            ++   +  W     ++K   +L PSNVY  I S+L
Sbjct: 119 CDREGEYIGWEIVQAASKFNRRLTPSNVYRAIFSHL 154

>CAGL0L08734g Chr12 complement(954111..954476) [366 bp, 121 aa] {ON}
           similar to uniprot|Q02608 Saccharomyces cerevisiae
           YPL013c
          Length = 121

 Score = 32.3 bits (72), Expect = 1.2,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 607 TVEIALTFDDGRHWSNKVSLPKYTVIELFQK 637
           T E+AL FD  ++W    + P  TV+ LFQK
Sbjct: 62  TKEVALDFDRAKYWIGVGAQPSDTVVRLFQK 92

>NCAS0G02840 Chr7 (521469..522422) [954 bp, 317 aa] {ON} 
          Length = 317

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 37/94 (39%), Gaps = 3/94 (3%)

Query: 529 WSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYWKISRKSLYGDYRISSALAIIFQQMEK 588
           W  LE+   F  WS+  Q IPSN  P   S       R  +  D   SS  + +     K
Sbjct: 40  WDPLEE---FSRWSSFYQRIPSNTEPSTTSSDADSFPRNIMTFDSPTSSTSSYMLPHKCK 96

Query: 589 AFEMKSPGRKLRFQNDQGTVEIALTFDDGRHWSN 622
               +    KLR QN+   +   +  +DG   +N
Sbjct: 97  VSPFRRKKEKLRSQNEIKAIMNYINLNDGERETN 130

>KLTH0G13376g Chr7 (1149234..1149249,1149315..1149985) [687 bp, 228
           aa] {ON} similar to uniprot|Q12255 Saccharomyces
           cerevisiae YLR093C NYV1 v-SNARE component of the
           vacuolar SNARE complex involved in vesicle fusion
           inhibits ATP- dependent Ca(2 ) transport activity of
           Pmc1p in the vacuolar membrane
          Length = 228

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 4/63 (6%)

Query: 240 YRCFENKFIEMKTKELFDEI-IPK-FPLSKPSLLEMKSVIKGATEELDRLVAQICNDFHS 297
           + C+     +  T   F +I +PK  PL    L E+KS+  G+ EEL   V  I   FH 
Sbjct: 75  FDCYYGTADDATTYVCFSQIDVPKILPLR--LLTELKSISNGSDEELAEHVRTIVRQFHE 132

Query: 298 ELL 300
           ELL
Sbjct: 133 ELL 135

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 88/194 (45%), Gaps = 22/194 (11%)

Query: 121  ELSNE-LIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMV--QGLGHPMV 177
            E+SNE L G+++ + N +   +N+ +S      LE+ + + +S L K     +     MV
Sbjct: 882  EISNEELSGIQEEIKNMSERKKNSEKS------LEKANSQQASLLKKLETFQKDAEKSMV 935

Query: 178  KFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNN 237
            K    L   + EL  K R  G      + EE  N+F +    + +Q L   NED   L+N
Sbjct: 936  KKTT-LAARREELQQKIREVG-----LLAEEALNSFNNLSSGELLQRLNSVNEDISGLSN 989

Query: 238  LIYRCFEN--KFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIK-GATEELDRLVAQICND 294
            +  R FEN  KF E +T+   +E   +   SK S+  + + +K      +D    ++  +
Sbjct: 990  VNKRAFENFKKFGEKRTE--LEERAEELDESKSSIQNLITRLKRQKVNAVDSTFNKVSEN 1047

Query: 295  FHS--ELLIPSVTT 306
            F    E L+P  T 
Sbjct: 1048 FSKVFEKLVPRGTA 1061

>CAGL0G08470g Chr7 complement(800333..802285) [1953 bp, 650 aa] {ON}
           highly similar to uniprot|P13099 Saccharomyces
           cerevisiae YLR234w TOP3 DNA topoisomerase III
          Length = 650

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 30/61 (49%), Gaps = 7/61 (11%)

Query: 507 KNNKQVLKSICEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSN-------VYPKIISY 559
           KN +++  +I  E+   +V ++W+D ++   +  W   ++   SN       VY  + S+
Sbjct: 95  KNQQKIAANIRREAKFADVLMIWTDCDREGEYIGWEVYMEAQKSNRRLNDNQVYRAVFSH 154

Query: 560 L 560
           L
Sbjct: 155 L 155

>TBLA0A05580 Chr1 (1383502..1390212) [6711 bp, 2236 aa] {ON}
           Anc_1.94 YNL262W
          Length = 2236

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 5/69 (7%)

Query: 103 LERYYEFPLKYVGLFTAEELS--NELIGLRKYLLNRNSTFRNNM-ESR--IRVLILEEDD 157
           L+++ E  LK + + T E+LS  N L+GL++ LL  N    NN+ E+R  +R ++ E  +
Sbjct: 162 LKKFLETCLKSIEIITKEDLSLDNHLVGLKRTLLKLNFVNSNNLFEARKLLRPILTENSN 221

Query: 158 FEMSSKLYK 166
            +    +YK
Sbjct: 222 TKRQRDIYK 230

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,171,396
Number of extensions: 3485533
Number of successful extensions: 12337
Number of sequences better than 10.0: 62
Number of HSP's gapped: 12614
Number of HSP's successfully gapped: 66
Length of query: 689
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 572
Effective length of database: 40,065,477
Effective search space: 22917452844
Effective search space used: 22917452844
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)