Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40655.527ON72172134270.0
ADR194C5.527ON63768615390.0
SAKL0G04928g5.527ON89269810041e-123
TDEL0A039105.527ON7497399471e-116
KLTH0G03762g5.527ON7096278631e-104
Kwal_47.186425.527ON3093237505e-93
ZYRO0D12562g5.527ON8184827749e-91
NCAS0F010905.527ON7877777528e-88
YDR422C (SIP1)5.527ON8153767198e-83
NDAI0H016005.527ON8423817075e-81
Skud_4.6965.527ON8113237022e-80
Smik_4.6975.527ON8173266934e-79
Suva_2.5995.527ON8273246901e-78
CAGL0F03047g5.527ON7443966702e-76
KNAG0C032305.527ON5615326199e-71
TBLA0D016505.527ON10163275986e-65
KAFR0E033005.527ON4663214742e-51
Kpol_1023.985.527ON6673694075e-41
TPHA0K005305.527ON6463812832e-25
KNAG0E015903.517ON4233252062e-16
Smik_5.1503.517ON4173271858e-14
YER027C (GAL83)3.517ON4173221786e-13
Suva_5.1233.517ON4233291778e-13
KAFR0I023803.517ON4093261742e-12
CAGL0K09350g3.517ON4323211582e-10
SAKL0F02002g3.517ON503641332e-07
KNAG0B006003.517ON389521322e-07
KAFR0F041403.517ON348701313e-07
KLLA0B00583g3.517ON486611314e-07
CAGL0A03696g3.517ON415701304e-07
TPHA0A058103.517ON424641296e-07
TBLA0I032703.517ON433631289e-07
TDEL0D058503.517ON404681279e-07
NCAS0E006203.517ON500591271e-06
Kwal_47.190403.517ON429631262e-06
ZYRO0E08404g3.517ON348651252e-06
Skud_5.1363.517ON418621242e-06
NCAS0F037303.517ON432621243e-06
Kpol_195.23.517ON435631234e-06
Kwal_47.18638singletonOFF3773931216e-06
Ecym_12103.517ON450631217e-06
NDAI0B060103.517ON503621217e-06
KLTH0G01848g3.517ON416641199e-06
NDAI0I028903.517ON582401191e-05
Skud_7.603.517ON441811153e-05
YGL208W (SIP2)3.517ON415801153e-05
AER361C3.517ON475821136e-05
Smik_7.553.517ON415881127e-05
KNAG0B036905.527ON3261091101e-04
Suva_7.533.517ON414811091e-04
Kpol_1004.215.527ON7551901020.002
Kwal_23.49582.267ON64964790.80
NCAS0A009002.8ON984159761.7
Skud_15.4937.68ON157479752.3
KAFR0L009307.246ON44967716.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4065
         (721 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...  1324   0.0  
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   597   0.0  
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...   391   e-123
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   369   e-116
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...   337   e-104
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   293   5e-93
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   302   9e-91
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   294   8e-88
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...   281   8e-83
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...   276   5e-81
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...   275   2e-80
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...   271   4e-79
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...   270   1e-78
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...   262   2e-76
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...   243   9e-71
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....   234   6e-65
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   187   2e-51
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   161   5e-41
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....   113   2e-25
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    84   2e-16
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    76   8e-14
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    73   6e-13
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    73   8e-13
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    72   2e-12
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    65   2e-10
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    56   2e-07
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    55   2e-07
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    55   3e-07
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    55   4e-07
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    55   4e-07
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    54   6e-07
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    54   9e-07
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    54   9e-07
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     54   1e-06
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    53   2e-06
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    53   2e-06
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    52   2e-06
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    52   3e-06
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    52   4e-06
Kwal_47.18638 s47 (907369..908499) [1131 bp, 377 aa] {OFF} [cont...    51   6e-06
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    51   7e-06
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    51   7e-06
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    50   9e-06
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    50   1e-05
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    49   3e-05
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    49   3e-05
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    48   6e-05
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    48   7e-05
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    47   1e-04
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    47   1e-04
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...    44   0.002
Kwal_23.4958 s23 complement(941715..943664) [1950 bp, 649 aa] {O...    35   0.80 
NCAS0A00900 Chr1 (178813..181767) [2955 bp, 984 aa] {ON} Anc_2.8...    34   1.7  
Skud_15.493 Chr15 (865472..870196) [4725 bp, 1574 aa] {ON} YOR32...    33   2.3  
KAFR0L00930 Chr12 complement(170929..172278) [1350 bp, 449 aa] {...    32   6.9  

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score = 1324 bits (3427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 650/721 (90%), Positives = 650/721 (90%)

Query: 1   MGNTTSSTDWXXXXXXXXXXXXXXXXXXXXXXXXEAKGGSVQHGTKERVRQQSITSQLFP 60
           MGNTTSSTDW                        EAKGGSVQHGTKERVRQQSITSQLFP
Sbjct: 1   MGNTTSSTDWGYQKVGRYQQQQQQRRQQRQGVGGEAKGGSVQHGTKERVRQQSITSQLFP 60

Query: 61  GRHQARSKWKSQRNXXXXXXXXXXXXDHLFKRDYSLSDDSSAXXXXXXXXXXXXDLIGMP 120
           GRHQARSKWKSQRN            DHLFKRDYSLSDDSSA            DLIGMP
Sbjct: 61  GRHQARSKWKSQRNVAPGAVSGVGGVDHLFKRDYSLSDDSSAVGMEGVQEEGGVDLIGMP 120

Query: 121 NVAGLKLDSRAQAIMSPGPSSATVEHSKLEASISPELAAQVHRPSIVALKQNLIQGHMGH 180
           NVAGLKLDSRAQAIMSPGPSSATVEHSKLEASISPELAAQVHRPSIVALKQNLIQGHMGH
Sbjct: 121 NVAGLKLDSRAQAIMSPGPSSATVEHSKLEASISPELAAQVHRPSIVALKQNLIQGHMGH 180

Query: 181 PLHSPLRXXXXXXXXXXXTAPSSSYVPSATIDIPYSNPSTMNTLSIIAQHQEDYSTRSSA 240
           PLHSPLR           TAPSSSYVPSATIDIPYSNPSTMNTLSIIAQHQEDYSTRSSA
Sbjct: 181 PLHSPLRDDYDGDDDDGDTAPSSSYVPSATIDIPYSNPSTMNTLSIIAQHQEDYSTRSSA 240

Query: 241 VSISTQDLDGYIENSDVVLSEALVDSVVKNDMRRKRQLQKQSAEASEAINENKNEANQQP 300
           VSISTQDLDGYIENSDVVLSEALVDSVVKNDMRRKRQLQKQSAEASEAINENKNEANQQP
Sbjct: 241 VSISTQDLDGYIENSDVVLSEALVDSVVKNDMRRKRQLQKQSAEASEAINENKNEANQQP 300

Query: 301 DVKKAKVPMSNLLKPSKQMGTVTGTFLPQSELKDSGSFEYGSVQHVEVAADDNYSDDCPE 360
           DVKKAKVPMSNLLKPSKQMGTVTGTFLPQSELKDSGSFEYGSVQHVEVAADDNYSDDCPE
Sbjct: 301 DVKKAKVPMSNLLKPSKQMGTVTGTFLPQSELKDSGSFEYGSVQHVEVAADDNYSDDCPE 360

Query: 361 RVQVIIKWRDTNVDPRTXXXXXXXXXXXXVVQPTRKRKKIPMVYLEQEQCWAAEDLKLPA 420
           RVQVIIKWRDTNVDPRT            VVQPTRKRKKIPMVYLEQEQCWAAEDLKLPA
Sbjct: 361 RVQVIIKWRDTNVDPRTSKISIISSDIASVVQPTRKRKKIPMVYLEQEQCWAAEDLKLPA 420

Query: 421 GIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRDAAIERSPNELAAY 480
           GIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRDAAIERSPNELAAY
Sbjct: 421 GIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRDAAIERSPNELAAY 480

Query: 481 NETSLLLTNETPSPANIRPPLINRGTSSSSRARVIERTNTPISDYTGVLARNSCSNPAIY 540
           NETSLLLTNETPSPANIRPPLINRGTSSSSRARVIERTNTPISDYTGVLARNSCSNPAIY
Sbjct: 481 NETSLLLTNETPSPANIRPPLINRGTSSSSRARVIERTNTPISDYTGVLARNSCSNPAIY 540

Query: 541 RHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNASTGGSQQGSDKNKLQNPSKYLQDSPN 600
           RHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNASTGGSQQGSDKNKLQNPSKYLQDSPN
Sbjct: 541 RHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNASTGGSQQGSDKNKLQNPSKYLQDSPN 600

Query: 601 FMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQN 660
           FMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQN
Sbjct: 601 FMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQN 660

Query: 661 SAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPCYYENY 720
           SAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPCYYENY
Sbjct: 661 SAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPCYYENY 720

Query: 721 E 721
           E
Sbjct: 721 E 721

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/686 (51%), Positives = 430/686 (62%), Gaps = 76/686 (11%)

Query: 36  AKGGSVQHGT--KERVRQQSITSQLFPGRHQARSKWKSQRNXXXXXXXXXXXXDHLFKRD 93
           A  G+ Q  T   +R RQQSITSQLF GRH ARSKWK Q                +FK D
Sbjct: 23  AASGASQWETDSTDRGRQQSITSQLFSGRHHARSKWKFQ-GAGDSATGSSGGIASMFKCD 81

Query: 94  YSLSDDSSAXXXXXXXXXXXXDLIGMPNVAGLKLDSRAQAIMSPGPSSATVEHSKLEASI 153
           Y+L+ D+ +               GMPN+AGL LD+  Q I SPGPS+ATVEH+ LEAS+
Sbjct: 82  YTLNADARSISSEQGETCQ-----GMPNLAGLVLDACTQGIRSPGPSTATVEHTNLEASM 136

Query: 154 SPELAAQVHRPSIVALKQNLIQGHMGHPLHSPLRXXXXXXXXXXXTAPSSSYVPSATIDI 213
           SPELA+Q HRPSI ALKQ+LIQ                          ++ YVPSATIDI
Sbjct: 137 SPELASQTHRPSISALKQSLIQVQ-----------GQTNSRHRAEDIDTAQYVPSATIDI 185

Query: 214 PYSNPSTMNTLSIIAQHQEDYSTRSSAVSISTQDLDGYIENSDVVLSEALVDSVVKNDMR 273
           P SNPST NT S+     +D STRSS +S+ TQD++ YIE S+VVL+E+LVDSVV+ D+R
Sbjct: 186 PCSNPST-NTASV-THRADDSSTRSSLLSLFTQDVEEYIEASEVVLNESLVDSVVRKDLR 243

Query: 274 RKRQLQKQSAEASEAINENKNEANQQPDVKKAKVPMSNLLKPSKQMGTVTGTFLPQSELK 333
           RKRQLQ+Q      A  E   E  +QPD KK K+P S     +   G V      QSE  
Sbjct: 244 RKRQLQQQCGATRAA--EQAAETAKQPDAKKKKLPCSAAALSATASGVV------QSE-- 293

Query: 334 DSGSFEYGSVQHVEVAADDNYSDDCPERVQVIIKWRDTNVDPRTXXXXXXXXXXXXVVQP 393
                            ++ +SD   E V+VIIKWRD  +DP+             V+  
Sbjct: 294 ----------------TEEQHSDAEAEFVEVIIKWRDCLLDPQRTKLSIVSPDIASVIHK 337

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
             KRK + MV+ + EQ W A DL+LP GIYKL F ING +RHSN+LPTATDS SNIVNWF
Sbjct: 338 NSKRK-VAMVFSKDEQFWVAPDLRLPPGIYKLQFLINGALRHSNFLPTATDSHSNIVNWF 396

Query: 454 EVVPGYDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRAR 513
           EVVP YD+ EPYRD A    P E+A   E+  L      +PA  RPPL+ RGTSSSSRAR
Sbjct: 397 EVVPWYDRAEPYRDPA----PEEVAMPPESPQLT-----APAAGRPPLLKRGTSSSSRAR 447

Query: 514 VIERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGN 573
           V+ER+NTPISDYTG+ +R+  + P +  HKS NS ++  +P+   L YS+++PELFK   
Sbjct: 448 VVERSNTPISDYTGI-SRSGSARPLLAHHKSANSIELSPIPRC-VLQYSTEIPELFK--- 502

Query: 574 ASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFL 633
                  +G   +    P        +F +N+QDCNQDELF +LQE W M+AQEAEEV +
Sbjct: 503 ------PEGCPPDPNTAPG-------SFNENIQDCNQDELFRFLQEDWKMSAQEAEEVLV 549

Query: 634 EKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEI 693
           EKY VPDLP+YLNS+ LNEIF KLQ++S  GD+ KR S THIIPHVNLNHLLTS+IRDEI
Sbjct: 550 EKYPVPDLPVYLNSSYLNEIFTKLQRSSVTGDV-KRSSFTHIIPHVNLNHLLTSSIRDEI 608

Query: 694 ISVGCTTRYEGKFITQIMYAPCYYEN 719
           ISVGCTTRYEGKFITQIMYAPCYYE+
Sbjct: 609 ISVGCTTRYEGKFITQIMYAPCYYES 634

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score =  391 bits (1004), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 255/698 (36%), Positives = 371/698 (53%), Gaps = 128/698 (18%)

Query: 135 MSPGPSSATVEHSKLEASISP----------------ELAAQVHRPSIVALKQNLIQGHM 178
           +SPGP+S TVE ++ EA + P                +  + +HRPSIVALK++L++G +
Sbjct: 202 LSPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQFPSYLHRPSIVALKRSLVEGRI 261

Query: 179 GHPLHSPLRXXXXXXXXXXXTAPSSSYV---------PSA-------------TIDIPYS 216
           G  LH                    +Y+         PS              +IDIP  
Sbjct: 262 GSKLHVQTSNGDTTNASSSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSIDIPGR 321

Query: 217 NPSTMNTLS----IIAQHQEDYSTRSSAVSISTQDL-DGYIENSDVVLSEALVDSVVKND 271
             +   T+       A   +  ++ S    +S  DL +G++E++DV+L+ A+++S ++ D
Sbjct: 322 GHAATATIGSNRDTTALSDDQDTSLSPGSPVSQLDLSEGFLEDNDVLLNNAVLESAIRKD 381

Query: 272 MRRKRQLQKQSAEASEAINENKNEANQQP--DVKKAKVPMSNLLKPSKQMGTVTGTFLPQ 329
           M+RKRQ +K+  +  ++ + +   A       VKK K    N  +  +Q+G     FLP 
Sbjct: 382 MKRKRQEKKRPEDQEKSFSSSLESAEPSAISGVKKLKPLTPNEQERQRQVGEDYKNFLPS 441

Query: 330 SELKDSG----------------SFEYGSVQHVEVAADDN-------------------- 353
            +   +G                SFE G+V+H E   DD+                    
Sbjct: 442 FQPIRTGATPKLFQVSGNGGRIDSFELGTVEHFESIGDDHRTVSGGSNAPNGGGKTTSMR 501

Query: 354 ------------------YSDDCPERVQVIIKWRDTNVDPRTXXXXXXXXXXXXVVQPTR 395
                             Y +D  + V V++KWRD  VDP+T            V+   +
Sbjct: 502 ANKEAEEEEEEEAAAGARYGED--DLVNVVLKWRDCIVDPKTCKISVISSDISAVLA-LQ 558

Query: 396 KRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEV 455
             KKIPM Y   E+ W   +LKLP G+YKL F ING++RHSN+LPTATDS  N VNWFEV
Sbjct: 559 SSKKIPMEYETTEKSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEV 618

Query: 456 VPGYDQIEPYRDAAIERS--PNELAAYNETSL----LLTNETPSPANIRPPLINRGTSSS 509
           +PGY +IEP RD  ++     ++L    + S+      T   P P   RPPL+++ TSSS
Sbjct: 619 LPGYYEIEPLRDVPVDSMNYGSDLGVSMKESVNGGSDFTITAPIP---RPPLLSQATSSS 675

Query: 510 SR-ARVIERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPEL 568
            R ++ IER+ TP SDYTG+L+R++ + P + + KS++      LP +    YS+D+PEL
Sbjct: 676 YRSSKYIERSTTPYSDYTGILSRSNSARPLLNQKKSSSYDVFAPLPPK-KYEYSTDIPEL 734

Query: 569 FKVGNASTGGSQQGSDKNKLQNPSKY---LQDS----PNFMKNVQDCNQDELFHYLQEKW 621
           FKV +      ++  D +  ++P  Y   L+ S    P+F   VQDCNQD LF  LQ+  
Sbjct: 735 FKVND------EEDHDHDIPEDPPSYSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHD 788

Query: 622 NMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNL 681
            ++AQ AEE FL+KY VPDLPIYLNS+ LN++FN+LQ+++  G+   +  +  +IPHVNL
Sbjct: 789 RIDAQAAEEFFLQKYPVPDLPIYLNSSYLNKVFNQLQKDNNAGE--TKAVVNPVIPHVNL 846

Query: 682 NHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPCYYEN 719
           NHLLTS+IR+EIISVGCTTRYEGKFIT ++YAPCYYEN
Sbjct: 847 NHLLTSSIREEIISVGCTTRYEGKFITHVVYAPCYYEN 884

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 17/71 (23%)

Query: 48  RVRQQSITSQLFPGRHQARS----------------KWKSQRNXXXXXXXXXXXXDHLFK 91
           R RQ SITSQLFPGR+   +                KWK +R               LFK
Sbjct: 22  RDRQHSITSQLFPGRNTRNAQDDSPVSAAAAAAAPGKWK-RRLSLNHAPAVVSTPSPLFK 80

Query: 92  RDYSLSDDSSA 102
            +YS+++ S+A
Sbjct: 81  PNYSMNESSNA 91

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score =  369 bits (947), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 264/739 (35%), Positives = 372/739 (50%), Gaps = 107/739 (14%)

Query: 50  RQQSITSQLFPGR---HQARSKWKSQRNXXXXXXXXXXXXDHLFKRDYSLSDDSSAXXXX 106
           RQQSITSQLFP R   H       ++RN              LFK DYSL   +      
Sbjct: 37  RQQSITSQLFPSRNTRHVGPHSMNAKRNRHPHPQPPS-----LFKSDYSLRSTAEETPAN 91

Query: 107 XXXXXXXXDLIGMPNVAGLKLDS-----RAQAIMSPGPSSATVEHSKLEASISPEL---- 157
                   D     N+AGL L S     +  + ++PG S+ TV+ ++  A  + +L    
Sbjct: 92  TGSTENIRD-----NMAGLSLKSSNENAQVPSFLTPGHSTPTVQPTRQAAVPAADLKNKL 146

Query: 158 -----------AAQVHRPSIVALKQNLIQGHMGHPLHSPLRXXXXXXXXXXXTAPSSSYV 206
                      + +  RPS+VALK+ L+       LHS               + S   V
Sbjct: 147 QNGLNQQKEISSHRFQRPSVVALKKTLLDDGE---LHS-----------TSSRSTSGDVV 192

Query: 207 PSATIDIPYSNPSTMNTLSIIAQHQEDYSTRSSAVSISTQDLD-----GYIENSDVVLSE 261
            SA++DI YS       L++ +  Q     + +     T D D     GY+++ DVVL++
Sbjct: 193 SSASLDI-YS------ALNLDSPTQSGSKAKDTDADPDTSDFDDISDDGYLQSEDVVLNQ 245

Query: 262 ALVDSVVKNDMRRKRQLQKQSAEASEAINENKNEANQ--QPDVKKAKVPMSNLLKPSKQM 319
           +L+ +V++ DM+RKR  +K     +  ++  K  +N      ++   VP +  LK     
Sbjct: 246 SLLQNVLRRDMKRKRPAKKSKVPNTSHVSNLKASSNSVSYESLENGNVPDAKKLKSLSYD 305

Query: 320 GTVTGTFLPQSE--------LKDSG-----SFEYGSVQHVEVAADDNYSDDC-------- 358
           G++  +F P ++          D+G     SFE GSV+H EV       +          
Sbjct: 306 GSLP-SFQPTAQNNDRLNGLAHDNGFNRIDSFEKGSVEHREVETSPTMRNSSSASPSSSS 364

Query: 359 ------PERVQVIIKWRDTNVDPRTXXXXXXXXXXXXVVQ--PTRK--RKKIPMVYLEQE 408
                 PE+V VI+KWRD   DP               +   P+ K       M Y E+E
Sbjct: 365 IISNTEPEKVHVILKWRDQIEDPSKCKITIISTDIASALNFDPSDKSFHGTFSMKYDEKE 424

Query: 409 QCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRDA 468
             +   +L LP GIYK  F ING++RHSN LP+ATDS+ NIVNWFEV+PGY+ +EP+R+ 
Sbjct: 425 NNFYVPNLSLPPGIYKFQFVINGEIRHSNLLPSATDSVGNIVNWFEVIPGYESVEPFRNE 484

Query: 469 AIERSPNELAAYNETSLLLT----NETPS------PANIRPPLINRGTSSSSRARVIERT 518
                   +      S   T    +E+P       P   RPPL  R TSS S  +  ER+
Sbjct: 485 IDYHENMGIDPPQSDSSTSTGKHHDESPGKVPLVQPVPGRPPLAARHTSSYSNKQ--ERS 542

Query: 519 NTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNASTGG 578
            TP SDYTGV   NS    +   H++ +S D+    +     YS+++PELFK GN     
Sbjct: 543 GTPYSDYTGVSRCNSAVRKSPLIHQTLSSIDLVTALQPKKYEYSNEIPELFKAGNVLGQS 602

Query: 579 SQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSV 638
            +           +    D P+F++NV DCNQD LF  LQ+   ++A+ AE++FLEKY+V
Sbjct: 603 DENQFPTPPPPPMNPPSYDQPSFLENVVDCNQDNLFVSLQQGGLLDAETAEQLFLEKYTV 662

Query: 639 PDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGC 698
           PDLP+YLNST LN+IFN+ Q+++++G       L HIIPHVNLNHLLTS+IRDE+ISVGC
Sbjct: 663 PDLPVYLNSTYLNKIFNEFQKHNSLGS--NSSGLNHIIPHVNLNHLLTSSIRDEMISVGC 720

Query: 699 TTRYEGKFITQIMYAPCYY 717
           TTRYEGKFITQ++YAPCYY
Sbjct: 721 TTRYEGKFITQVVYAPCYY 739

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score =  337 bits (863), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 227/627 (36%), Positives = 327/627 (52%), Gaps = 109/627 (17%)

Query: 131 AQAIMSPGPSSATVEHSKLEASISPELAAQVHRPSIVALKQNLIQGHMGHPLHSPLRXXX 190
           A  + SPGPS+  V+++K +A IS +++      SI +LK+ L++G +G  +H P     
Sbjct: 149 APVLRSPGPSTPVVKYTKHDA-ISDQIS------SITSLKKMLVEGRVGDNIHPP----- 196

Query: 191 XXXXXXXXTAPSSSYVPSATIDIPYSNPSTMNTLSIIAQHQEDYSTRSSAVSISTQDLDG 250
                     P+S       IDIP   PS   + +  +   +D  +           L G
Sbjct: 197 ----------PTS-------IDIP-RRPSAALSDAYFSDDGDDEESL----------LQG 228

Query: 251 YIENSDVVLSEALVDSVVKNDMRRKRQLQKQSAEASEAINENKNEANQQPDVKKAK---- 306
               +DVV++    +SV++N M+RKR  +K     + +     +E    P +KK K    
Sbjct: 229 ---TNDVVIN----NSVLENAMKRKRGTKKNKGVGASS---ESHEHISYPGLKKLKPLEH 278

Query: 307 ------VPMSNLLKPSKQMGTVT--GTFLPQ---SELKDSGSFEYGSVQHVEVAADDNYS 355
                 +P    + P      V      +P+     L    SFE G+V+H E A +  +S
Sbjct: 279 GGDKRDLPHFRAMHPRPSEDNVGPDSAAIPRLITDSLNRIDSFEKGTVEHYEGANESGFS 338

Query: 356 ------------DDCPER----VQVIIKWRDTNVDPRTXXXXXXXXXXXXVVQPTRKRKK 399
                       DD  E       VI+ W+D  VDP+T             + P +K  K
Sbjct: 339 SQNLTSSDMRDSDDADEDRGPGTHVILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFSK 398

Query: 400 IPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGY 459
           IPMV+  +  CW A DL LP+G+YK  F ING++RHS+YLPTATDS  N VNWFEVV G+
Sbjct: 399 IPMVFDMERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGH 458

Query: 460 DQIEPYRDAA----IERSPNELAAYNETSLLLTNETPSPANIRPPLINRG---TSSSSRA 512
           D IEP RD      ++ S +++A           E P+P   RP L + G   ++    +
Sbjct: 459 DSIEPSRDVISSEDVKLSKDQIAV----------EQPAPE--RPALGSDGSSSSNWKGSS 506

Query: 513 RVIERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVG 572
           R +ER+ TP SDYTG+ +R+  + P + RH + +S D+     +P   Y+ ++PELFK  
Sbjct: 507 RHVERSGTPFSDYTGLCSRSELTKPEL-RHNNTSSYDLLAPVPRPKYEYTDEIPELFK-- 563

Query: 573 NASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVF 632
            A+  GS       + +      Q  P+F+  VQDCNQD LF  LQ+   +++Q AEE F
Sbjct: 564 -ANFDGSLVPPPYEERELTKDGSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAF 622

Query: 633 LEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDE 692
           L++Y  PDLP+YL+S+ LN +F+  Q  +       +  + HI+PHVNLNHLLTS+IRDE
Sbjct: 623 LQQYPTPDLPVYLDSSFLNAVFSGFQDKTD-----SKTRVNHIVPHVNLNHLLTSSIRDE 677

Query: 693 IISVGCTTRYEGKFITQIMYAPCYYEN 719
           IISVGCTTRYEGKFITQI+Y PCYY N
Sbjct: 678 IISVGCTTRYEGKFITQIIYTPCYYSN 704

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score =  293 bits (750), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 154/323 (47%), Positives = 205/323 (63%), Gaps = 20/323 (6%)

Query: 402 MVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQ 461
           MV+  +  CW A DL LPAG+YK  F ING++RHS +LPTATDS  N VNWFEVV G+  
Sbjct: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60

Query: 462 IEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSS---RARVIERT 518
           IEP RD            + E  + ++   PS A+ RPP+++  +S S+    A+ IER+
Sbjct: 61  IEPSRDVISND-------FTENQVAISANDPS-ASPRPPILSGSSSFSNWKNSAKHIERS 112

Query: 519 NTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNASTGG 578
            TP SDYTG+ +R   + P + RHK+ +S D+     +P   YS+++PELFK     +  
Sbjct: 113 GTPYSDYTGLCSRTDLAKPEL-RHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSST 171

Query: 579 SQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSV 638
                +    QNP K   + P+F+  VQDCNQD LF  LQ+   +++Q AEE FL++Y  
Sbjct: 172 PPPYQESVPSQNPVK---NQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPT 228

Query: 639 PDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGC 698
           PDLP+YL+S+ LN +F   Q+ +       +  L HI+PHVNLNHLLTS+IRDEIISVGC
Sbjct: 229 PDLPVYLDSSFLNAVFRGFQEKNDT-----KSKLNHIVPHVNLNHLLTSSIRDEIISVGC 283

Query: 699 TTRYEGKFITQIMYAPCYYENYE 721
           TTRYEGKFITQI+Y PCYY N E
Sbjct: 284 TTRYEGKFITQIIYTPCYYGNKE 306

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score =  302 bits (774), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 193/482 (40%), Positives = 254/482 (52%), Gaps = 51/482 (10%)

Query: 278 LQKQSAEASEAINENKNEANQQPDVKKAK-VPMSNLLKPSKQMGTVTGTFLPQ-SELKDS 335
           L+ +S      ++ +  E     DVKK K +P   ++  +  +G +    L Q  +    
Sbjct: 343 LESESPRGQSGLSYDSLELGHLQDVKKLKSIPHDMIMPHASAVGKIRPEVLQQHGKFYSM 402

Query: 336 GSFEYGSVQHVEVAADDNYSDDCP-----------ERVQVIIKWRDTNVDPRTXXXXXXX 384
            SFE GSV+H EV  D N +               + V V IKWRD      T       
Sbjct: 403 DSFEKGSVEHREVE-DRNRNSSLSSLSSSPVSGSSQDVHVAIKWRDHLPVDGTNRMSMVS 461

Query: 385 XXXXXVVQPTRK----RKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLP 440
                 +   R+    R   PM Y E+ + W   DL LP G+Y+L F ING++ HSNYLP
Sbjct: 462 EDIASTLSFERQKHGARNTFPMRYEEETKEWVVPDLVLPVGVYRLQFLINGELTHSNYLP 521

Query: 441 TATDSLSNIVNWFEVVPGYDQIEPYRDAAIERSPNELAAYNET--------------SLL 486
           TATDS+ N VNWFEV+PGY+++EPYRD     S   L A N                  +
Sbjct: 522 TATDSVGNFVNWFEVIPGYEKVEPYRDEVELDSGQPLNAGNNGIAGSVLSLENQGSEGTV 581

Query: 487 LTNETPSPANIRPPLINRGTSSSSRARVIERTNTPISDYTGVLARNSCSNPAIYRHKSNN 546
           L    P   N+RPPL +   SS+   RVI R+NTP SDYTG+    S S+ A+ +   N 
Sbjct: 582 LMEPVPGKVNVRPPLASMHHSSN---RVI-RSNTPYSDYTGI----SRSSSALRKSPINC 633

Query: 547 ST---DVDILPKQPTLIYSSDVPELFKVGNASTGGSQQGSDKNKLQNPSKY------LQD 597
           +T   D+    +     YS+++PELFK    +    +          P  Y         
Sbjct: 634 TTSSLDLHTALQPKKYKYSNEIPELFKTAPITKANDENEDFTFGHMEPPTYDWARGHPSS 693

Query: 598 SPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKL 657
           +  F   V DCNQDELF  LQ+   ++A+ AE++FLEKY VPDLPIYLNS  LN I ++ 
Sbjct: 694 NAGFGNQVVDCNQDELFTELQQGGLLDAETAEQLFLEKYPVPDLPIYLNSYYLNRIISEF 753

Query: 658 QQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPCYY 717
           Q+N+  G       + HIIPHVNLNHLLTS+IRDE+ISVGCTTRYEGKFITQ++YAPCYY
Sbjct: 754 QKNNYPGG--GSGGINHIIPHVNLNHLLTSSIRDEMISVGCTTRYEGKFITQVIYAPCYY 811

Query: 718 EN 719
           EN
Sbjct: 812 EN 813

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 104/257 (40%), Gaps = 35/257 (13%)

Query: 47  ERVRQQSITSQLFPGRHQARSKWKSQRNXXXXXXXXXXXXDHLFKRDYSLSDDSSAXXXX 106
           ++ RQ SITSQLFP R + R       N              LFK++YSL + S+     
Sbjct: 39  DKGRQSSITSQLFPSR-KTRHAPSGLGNLKRKTQNVVPHPPSLFKKNYSLEEASAGAQGP 97

Query: 107 XXXXXXXXDLIGMP--------------------NVAGLKLDSRAQA---IMSPGPSSAT 143
                   ++  M                     N+AGL + S  +      SPGP++ T
Sbjct: 98  NNNNNDNHNVTLMAADDDPRDFNDTKTSTESVRENMAGLSIKSSNETGPMFFSPGPATPT 157

Query: 144 VEHSKLEASISPELAAQV--HRPSIVALKQNLIQGHMGHPLHSPLRXXXXXXXXXXXTAP 201
           V+ +K EA I P     +  +R S+VALK+NL +         P             T P
Sbjct: 158 VQPTKEEA-IPPMDDNMIFHNRQSVVALKKNLEESEQ------PSSRSGSSANMETRTTP 210

Query: 202 --SSSYVPSATIDIPYSNPSTMNTLSIIAQHQEDYSTRSSAVSISTQDLDGYIENSDVVL 259
             +    P     +  +  +T  T       +    T   +  I     DGY+ + D+VL
Sbjct: 211 IDNRRLKPLPRQAVAAAITATATTAPATPNGRPSIDTDPESSDIDNISDDGYLHSKDIVL 270

Query: 260 SEALVDSVVKNDMRRKR 276
           +++L+ +V+K DM+RKR
Sbjct: 271 NQSLLHNVIKRDMKRKR 287

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score =  294 bits (752), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 248/777 (31%), Positives = 362/777 (46%), Gaps = 142/777 (18%)

Query: 50  RQQSITSQLFPGRHQARSKWKSQRNXXXXXXXXXXXXDHL--------FKRDYSLS---- 97
           R+ SI+S LF  ++       S+R+            D++        FK+ YS+S    
Sbjct: 44  RKGSISSNLFTNKNS------SKRHATSIMSQSKVTNDNIQNPPETVFFKKGYSISRSMQ 97

Query: 98  DDSSAXXXXXXXXXXXXDLIGMPNVAGLKLDS--------RAQAIMSPGPSSATVEHSKL 149
           DDS                I  P +A L L +        ++ + MSPGP++ TVE +K 
Sbjct: 98  DDSDIKTEGQATVDSEN--IHEP-MASLSLKTSMENDENRKSFSFMSPGPANPTVEQTKH 154

Query: 150 EASISPELAAQVHRPSIVALKQNLIQGHMGHP--LHSPLRXXXXXXXXXXXTAPSSSYVP 207
           +  ++ +  +  HRPSIV LKQ L    + +   +    +           +  SSS + 
Sbjct: 155 D--VTNKENSFEHRPSIVTLKQTLSGTKVTNDNNIDKLNKTISSSSNSQSVSTASSSSIA 212

Query: 208 SAT--IDIP----YSNPSTMNTL---SIIAQHQEDYST-------RSSAVSISTQDLD-- 249
           + T  IDIP    Y+    M+T+     +  +Q DY T         S   +ST   +  
Sbjct: 213 NRTGSIDIPKENRYNFKDAMDTIPKQHSVHAYQHDYFTINDENARNGSDGRLSTSGDNSE 272

Query: 250 -GYIENSDVVLSEALVDSVVKNDMRRKRQLQKQSAEASEAINENKNEANQQPDVKKAKVP 308
            G ++N D+VL+++ +   +K DM+RKR        AS A  + +    ++  +      
Sbjct: 273 PGVLQNVDIVLNQSFLKDAMKRDMKRKRT----DTGASTATPDIEKPTEKKKPISATAAM 328

Query: 309 MSNLLKPSKQMGTVTGTFLPQSELKDSGSFEYGS----------------VQHVEV-AAD 351
           M  L     QM         + E K SGS+ Y                  ++H+E    +
Sbjct: 329 MLKLYGDKNQM--------EKEEKKSSGSYSYADQYEHSTSQINLREVKKIKHIENDFVE 380

Query: 352 DNYSDDCP-------------------------------------ERVQVIIKWRDTNVD 374
           DN+    P                                     + VQV++KWRD   +
Sbjct: 381 DNFGISSPKEIKIQHIDDVKNAPPSSLSSSMSSSSFGPSSDEQTNDNVQVVLKWRDQIDN 440

Query: 375 PRTXXXXXXXXXXXXVVQPTRKRK--KIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQ 432
           P+              + P +  K  K+PM++    + W   +L LP GIY+L F ING 
Sbjct: 441 PKHCKISIVSDDISSAI-PAKATKAGKLPMLFNPMIKEWYVPNLLLPPGIYRLKFSINGD 499

Query: 433 VRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRDAAIERSPNELAAYNETSLLLTNETP 492
           + HSN+LPTATDS+ NIVNWFEV+PGYD +EPYRD  IE        ++      T    
Sbjct: 500 LTHSNFLPTATDSMGNIVNWFEVLPGYDTVEPYRDEIIE------TTFHTNGSQGTLRDN 553

Query: 493 SPANIRPPLINRGTSSSSRARVIERTNTPISDYTGVLARNSCSN---PAIYRHKSNNSTD 549
           +P  IR    +   S++     +    TP SDYTG+   NS  N    ++   +     D
Sbjct: 554 NPTTIRSRRSSSFVSANGDLASM----TPYSDYTGISRSNSALNSKRTSLVSLRGVGKLD 609

Query: 550 VDILPKQPTLI-YSSDVPELFKVGNASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDC 608
           +   P +P  I YS+++PELFK+ N+         D    +  S +  + P+F   V DC
Sbjct: 610 L-FTPMEPKKIEYSNEIPELFKISNSIEDEDDDEGDYGHNETLSPF--EEPSFTNRVVDC 666

Query: 609 NQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQN----SAMG 664
           NQD+LF  LQ+  N++A+ AE +FL KY VPDLPIYLNS+ LN+IF + Q+     +   
Sbjct: 667 NQDKLFSDLQKNGNIDAETAEMLFLNKYQVPDLPIYLNSSYLNKIFLQFQKQHNDPTPSA 726

Query: 665 DLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPCYYENYE 721
           +      +THIIPHVNLNHLLTS+IRDEIISV CTTRY+GKFITQ+MYAPC Y N E
Sbjct: 727 NTASTIGITHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCNYGNPE 783

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score =  281 bits (719), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 164/376 (43%), Positives = 215/376 (57%), Gaps = 35/376 (9%)

Query: 360 ERVQVIIKWRDTNVDPRTXXXXXXXXXXXXVVQPTRK---------------RKKIPMVY 404
           E   V++KW+D      T             ++  R+                 +I MVY
Sbjct: 450 ENTLVVLKWKDDGTVAATTEVFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVY 509

Query: 405 LEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEP 464
            +  + W   DL LPAGIY+L F ING + HSN+LPTATDS  N VNWFEV+PGY  IEP
Sbjct: 510 DDVHKEWFVPDLFLPAGIYRLQFSINGILTHSNFLPTATDSEGNFVNWFEVLPGYHTIEP 569

Query: 465 YRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRARVIERTNTPISD 524
           +R        NE    ++    L  E P    ++    +   SS   A+ +ER +TP SD
Sbjct: 570 FR--------NEADIDSQVEPTLDEELPKRPELKRFPSSSRKSSYYSAKGVERPSTPFSD 621

Query: 525 YTGVLARNSCSN--PAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNASTGGSQQG 582
           Y G L+R+S  N   +  R K++ S D+    K   L+YS+++P LF +G+ ST   +  
Sbjct: 622 YRG-LSRSSSINMRDSFVRLKAS-SLDLMAEVKPERLVYSNEIPNLFNIGDGSTISVKGD 679

Query: 583 SDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLP 642
           SD    Q P       P+F   V DCNQD+LF  LQ+  N++A+ AE VFL +Y VPDLP
Sbjct: 680 SDDVHPQEP-------PSFTHRVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPVPDLP 732

Query: 643 IYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGCTTRY 702
           IYLNS+ LN I N+  QNS   +     ++ HIIPHVNLNHLLTS+IRDEIISV CTTRY
Sbjct: 733 IYLNSSYLNRILNQSNQNSESHER-DEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRY 791

Query: 703 EGKFITQIMYAPCYYE 718
           EGKFITQ++YAPCYY+
Sbjct: 792 EGKFITQVVYAPCYYK 807

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 112/284 (39%), Gaps = 65/284 (22%)

Query: 43  HGTKERVRQQSITSQLFPGR---HQARSKWKSQRNXX---------------------XX 78
           H    + RQ SITSQLF  R   H+ R+   S+ N                         
Sbjct: 23  HDAFNKDRQGSITSQLFNNRKSTHKRRASHTSEHNGAIPPRMQLLASHDPSTDCDGRMSS 82

Query: 79  XXXXXXXXDHLFKRDYSLSDDSSAXXXXXXXXXXXXDL-IGMPNVAGLKLDSRAQAIMSP 137
                    HLFK+DYSLS  +              D  +G P     +   ++ + +SP
Sbjct: 83  DTTIDKGPSHLFKKDYSLSSAADVNDTTLANLTLSDDHDVGAP-----EEQVKSPSFLSP 137

Query: 138 GPSSATVEHSK--------LEASISPELAA---------QVHRPSIVALKQNLIQGH-MG 179
           GPS ATV+ +K        L  ++  E            + HR SI+ALK+NL++     
Sbjct: 138 GPSMATVKRTKSDLDDLSTLNYTMVDETTENERNDKPHHERHRSSIIALKKNLLESSATA 197

Query: 180 HPLHSPLRXXXXXXXXXXXTAPSSSYVPSATIDIPYSNPSTMNTLSIIAQHQ-----EDY 234
            P  SP R           +A   +   + +IDIP   P +        Q+Q     E +
Sbjct: 198 SP--SPTRSSSVH------SASLPALTKTDSIDIPVRQPYSKKPSIHAYQYQYLNNDETF 249

Query: 235 STRS----SAVSISTQDLDGYIENSDVVLSEALVDSVVKNDMRR 274
           S  S       S S     G +++ D+VL+++L+ + +K DM+R
Sbjct: 250 SENSQMDKEGNSDSVDAEAGVLQSEDMVLNQSLLQNALKKDMQR 293

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score =  276 bits (707), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 158/381 (41%), Positives = 223/381 (58%), Gaps = 37/381 (9%)

Query: 360 ERVQVIIKWRDTNVDPRTXXXXXXXXXXXXVVQPTRKRKK----------IPMVYLEQEQ 409
           + V V++KWRD   +P+              ++ +  ++K          +PMV+    +
Sbjct: 475 DNVHVVLKWRDQIDNPKKCKIAIISDDIVNALESSSSKRKSNTNNNDNNTLPMVFNPMIK 534

Query: 410 CWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRDAA 469
            W   +L LP GIY+L F IN  + HSN+LPTATDS+ NIVNWFEV+PGYD +EPYRD  
Sbjct: 535 EWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEI 594

Query: 470 IERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRARVIERTNTPISDYTGVL 529
           IE + +   A ++ +L + + T   +      ++  +  SS         TP SDY G+ 
Sbjct: 595 IETTFH--TAPSQGTLSVHDLTMIRSRRSSSFVSAKSDLSSF--------TPYSDYAGI- 643

Query: 530 ARNSCS------NPAIYRHKSNNSTDVDILPKQPTLI-YSSDVPELFKVGNASTGGSQQG 582
           +R+S S        ++   +  N  D+   P +P  I YS ++PELFK+ N+      + 
Sbjct: 644 SRSSSSVGTATKKASLVSLRGTNKLDL-FTPIEPKKIAYSKEIPELFKIANS------ED 696

Query: 583 SDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLP 642
           ++K ++ +      + P+F   V DCNQD+LF  LQ   N++A+ AE +FL +Y +PDLP
Sbjct: 697 TNKMEIDDDGSSPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLP 756

Query: 643 IYLNSTSLNEIFNKLQQNSAMGDLPKRKS--LTHIIPHVNLNHLLTSNIRDEIISVGCTT 700
           IYLNST LN+IF + Q+      LP   S  LTHIIPHVNLNHLLTS+IRDEIISV CTT
Sbjct: 757 IYLNSTYLNKIFTQFQKQHNDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTT 816

Query: 701 RYEGKFITQIMYAPCYYENYE 721
           RY+GKFITQ+MYAPC Y + E
Sbjct: 817 RYQGKFITQVMYAPCNYSSQE 837

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 129/322 (40%), Gaps = 76/322 (23%)

Query: 41  VQHGTKERVRQQSITSQLFPGRHQARSKWKSQRNXXX---XXXXXXXXXDHLFKRDYSLS 97
           +Q     + R+ SITS LF       SK  S+R+                ++FK+DYS+ 
Sbjct: 32  IQKQESPKERKGSITSHLF------SSKGSSKRHALMPKPIEAQGNIKSHNVFKKDYSM- 84

Query: 98  DDSSAXXXXXXXXXXXXDLIGMPNVAGLKL----DSRAQAIMS---PGPSSATVEHSK-- 148
            D               D      +A L L    D+  +  MS   PGPS+ TV+ +K  
Sbjct: 85  -DEPLTNKGGIKNNDFNDENIHETMASLSLVTSSDNERKKSMSFARPGPSTPTVQPTKHD 143

Query: 149 ---LEASI-------SPELAAQV--HRPSIVALKQNLIQGHMGHPLH-SPLRXXXXXXXX 195
              LE S        +  +A  +  HRPSIVALK  L +  +  P   S           
Sbjct: 144 ITSLEGSTDVNTGIDNMNVAGDLNSHRPSIVALKNTLAESSIHPPSDLSKTVSTSSNCQS 203

Query: 196 XXXTAPSSSYVPSATIDIP---------------------------YSNPSTMNTLSIIA 228
               + SS+   + +IDIP                           Y N    N    + 
Sbjct: 204 FSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNENTNNDGGLH 263

Query: 229 QHQEDYSTRSSAVSISTQDLD---GYIENSDVVLSEALVDSVVKNDMRRKR----QLQKQ 281
           +H+E+++     + +ST + D   G ++++D+V++++ + + +K DM+RKR       K 
Sbjct: 264 KHKENFND----MQLSTSNDDEESGVLQSADIVVNQSTLQNALKRDMKRKRTDTISTNKS 319

Query: 282 SAEASEAINENKNEANQQPDVK 303
            A  S+A+     +A  +P+ K
Sbjct: 320 GAPTSDAL-----KAKDEPEAK 336

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score =  275 bits (702), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 155/323 (47%), Positives = 194/323 (60%), Gaps = 23/323 (7%)

Query: 399 KIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPG 458
           +I M+Y    + W   DL LPAGIY+L F ING + HSN+LPTATDS  N VNWFEV+PG
Sbjct: 501 RIRMIYDSVHREWFVPDLFLPAGIYRLQFSINGLLTHSNFLPTATDSEGNFVNWFEVLPG 560

Query: 459 YDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPP---LINRGTSSSSRARVI 515
           Y  IEP+RD A            +    + +     A IRP    L +   SS   A+  
Sbjct: 561 YHTIEPFRDEA------------DMDFQMRSTLDEEAPIRPEPKRLSSSRKSSYYSAKDG 608

Query: 516 ERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNAS 575
           ER  TP SDY G+   NS      +     +S D+    K   L YS+++P LF +G AS
Sbjct: 609 ERPGTPFSDYRGLSRSNSVFLRGSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIGEAS 668

Query: 576 TGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEK 635
           T  S+   D  +  +P    QD P+F   V DCNQD+LF  LQ+  N++A+ AE VFL +
Sbjct: 669 TTTSK---DHFERLSP----QDRPSFTHKVVDCNQDDLFATLQQGGNIDAETAEAVFLSR 721

Query: 636 YSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIIS 695
           Y +PDLPIYLNS+ LN I N+   NS   D      + HIIPHVNLNHLLTS+IRDEIIS
Sbjct: 722 YPIPDLPIYLNSSYLNRILNQSNPNSEFHD-GDEGGINHIIPHVNLNHLLTSSIRDEIIS 780

Query: 696 VGCTTRYEGKFITQIMYAPCYYE 718
           V CTTRYEGKFITQ++YAPCYY+
Sbjct: 781 VACTTRYEGKFITQVIYAPCYYK 803

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 92/216 (42%), Gaps = 45/216 (20%)

Query: 89  LFKRDYSLSDDSSAXXXXXXXXXXXXDLIGMPNVAGLKLDSRAQAIMSPGPSSATVEHSK 148
           LFK+DYSL++ +              D  G    +  +   ++ + +SPGPS ATV+ +K
Sbjct: 93  LFKKDYSLANAADENDTTLANLSLNDDHDG----SAPEEQVKSPSFLSPGPSMATVKQTK 148

Query: 149 -----------------LEASISPELAAQVHRPSIVALKQNLIQGH-MGHPLHSPLRXXX 190
                            +E   S     + HR SI+ALK+ L++      P  SP R   
Sbjct: 149 SDLDDLSTVNCTVVDETMENERSGHPHHERHRSSIIALKKTLMENSATASP--SPTRSS- 205

Query: 191 XXXXXXXXTAPSSSYVP---SATIDIP----YSNPSTMNT-----LSIIAQHQEDYSTRS 238
                   +  S+S  P   + +IDIP    YS   +++      LS       +  T  
Sbjct: 206 --------SVHSASLPPLTKTGSIDIPVKQTYSKKPSVHAYQYQYLSPDPTFSGNSHTGK 257

Query: 239 SAVSISTQDLDGYIENSDVVLSEALVDSVVKNDMRR 274
            A   +     G +++ D+VL+++L+ + +K DM+R
Sbjct: 258 EANGDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQR 293

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score =  271 bits (693), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 205/326 (62%), Gaps = 28/326 (8%)

Query: 399 KIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPG 458
           +I MVY    + W   DL LP GIY+L F ING + HSNYLPTATDS  N VNWFEV+PG
Sbjct: 504 RIRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPG 563

Query: 459 YDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSR----ARV 514
           Y  IEP+R        NE    ++   +L  E+P    IRP L    +SS       A+ 
Sbjct: 564 YHTIEPFR--------NEADLGSQVEPVLEEESP----IRPELKRFSSSSRKSSYYSAKG 611

Query: 515 IERTNTPISDYTGVLARNSCSN--PAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVG 572
           +ER +TP SDY G L+R+S  N   +  R K++ S D+    K   L YS+++P LF + 
Sbjct: 612 VERPSTPFSDYRG-LSRSSSVNMRDSFVRLKAS-SLDLMAEIKPEKLEYSNEIPNLFNIA 669

Query: 573 NASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVF 632
           +   GG+     +++  +P    Q+ P+F   V DCNQD+LF  LQ+  N++A+ AE VF
Sbjct: 670 D---GGTTSVIRESRDSSP----QEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVF 722

Query: 633 LEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDE 692
           L +Y +PDLPIYLNS+ LN+I N+   NS   D     ++ HIIPHVNLNHLLTS+IRDE
Sbjct: 723 LSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDR-DEGAINHIIPHVNLNHLLTSSIRDE 781

Query: 693 IISVGCTTRYEGKFITQIMYAPCYYE 718
           IISV CTTRYEGKFITQ++YAPCYY+
Sbjct: 782 IISVACTTRYEGKFITQVIYAPCYYK 807

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 113/289 (39%), Gaps = 75/289 (25%)

Query: 43  HGTKERVRQQSITSQLFPGRHQARSKWKSQ----------RNXXXXXXXXXXXXDH---- 88
           H T  + RQ SITSQLF  R     +  S           R             D     
Sbjct: 23  HETFNKDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTIPSRMQLLASHDSVTDCDDSVND 82

Query: 89  ----------LFKRDYSLSDDSSAXXXXXXXXXXXXDLIGMPNVAGLKLDSRAQAIMSPG 138
                     LFK+DYSL++ +               LI   +V   +   ++ + +SPG
Sbjct: 83  DTTIDKEPSLLFKKDYSLNNTADGNDTTLANLS----LIDDHDVGAPEEQVKSPSFLSPG 138

Query: 139 PSSATVEHSK-----------------LEASISPELAAQVHRPSIVALKQNLIQGH-MGH 180
           PS ATV+ +K                  E   +     + HR SI+ALK+ L++      
Sbjct: 139 PSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHERHRSSIIALKKTLLENSATAS 198

Query: 181 PLHSPLRXXXXXXXXXXXTAPSSSYVPSAT----IDIPYSNPSTMNTLSIIAQHQEDYST 236
           P  SP R           ++  S+ +P  T    ID P   P+     SI A +Q  Y +
Sbjct: 199 P--SPTRS----------SSVHSASMPPLTKMDSIDTPLK-PAYSKKPSIHA-YQYQYLS 244

Query: 237 RSSAVSISTQ--------DLD---GYIENSDVVLSEALVDSVVKNDMRR 274
                S ++Q        ++D   G +++ D+VL+++L+ + +K DM+R
Sbjct: 245 PDPTFSGNSQAGKEKNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQR 293

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score =  270 bits (690), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 195/324 (60%), Gaps = 27/324 (8%)

Query: 399 KIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPG 458
           +I M+Y    + W   +L LP GIY+L F ING + HSN+LPTATDS    VNWFEV+PG
Sbjct: 519 RIRMIYDAVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPG 578

Query: 459 YDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRP----PLINRGTSSSSRARV 514
           Y  IEP+RD A   S        +    +  E P    IRP       +   SS   A+ 
Sbjct: 579 YHTIEPFRDEADTES--------QVGSTIDVEAP----IRPEPKRLSSSSRKSSYYSAKG 626

Query: 515 IERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNA 574
           +ER +TP SDY G+   NS +    +     +S D+    K   L YS+++P LF +GN 
Sbjct: 627 VERPSTPFSDYRGLSRSNSANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLFTIGNG 686

Query: 575 STGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLE 634
           S    Q+         PS   QD P+F   V DCNQD+LF  LQ+  N++A+ AE VFL 
Sbjct: 687 SATPIQEDL-------PS---QDLPSFTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLS 736

Query: 635 KYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEII 694
           +Y +PDLPIYLNS+ LN+I N+   NS  GD     ++ HIIPHVNLNHLLTS+IRDEII
Sbjct: 737 RYPIPDLPIYLNSSYLNKILNQGNPNSESGD-KDEGAINHIIPHVNLNHLLTSSIRDEII 795

Query: 695 SVGCTTRYEGKFITQIMYAPCYYE 718
           SV CTTRYEGKFITQ++YAPCYY+
Sbjct: 796 SVACTTRYEGKFITQVIYAPCYYK 819

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 95/222 (42%), Gaps = 57/222 (25%)

Query: 89  LFKRDYSLS---DDSSAXXXXXXXXXXXXDLIGMPNVAGLKLDSRAQAIMSPGPSSATVE 145
           LFK+DYS++   DD+               L    + +  +   ++   +SPGPS ATV+
Sbjct: 96  LFKKDYSVAKAADDNETTLANLS-------LYDRHDASAPEEQVKSPTFLSPGPSMATVK 148

Query: 146 HSK-------------LEASISPELA----AQVHRPSIVALKQNLIQGH-MGHPLHSPLR 187
            +K             ++ +I  E       + HR SI+ALK+ L++      P  SP R
Sbjct: 149 QTKNYPDDLSTVNNTIVDETIGDERKDHPHHERHRSSIIALKKTLLENSATASP--SPTR 206

Query: 188 XXXXXXXXXXXTAPSSSYVP---SATIDIPYSNPSTMNTLSIIAQHQEDYSTRSSAVSIS 244
                         S+S +P   + +IDIP     T +    +  +Q  Y      +S  
Sbjct: 207 SSSIH---------STSLLPLSKAGSIDIPIKQ--TYSKKPSVHAYQYQYLDPDPTLSDD 255

Query: 245 TQDLD------------GYIENSDVVLSEALVDSVVKNDMRR 274
           +Q LD            G +++ D+VL+++L+ + +K D++R
Sbjct: 256 SQ-LDKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQR 296

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score =  262 bits (670), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/396 (38%), Positives = 213/396 (53%), Gaps = 46/396 (11%)

Query: 359 PERVQVIIKWRDTN----------------VDPRTXXXXXXXXXXXXVVQPTRKRKKIPM 402
           P+R  VI+KWRD+                 +                +     +  KIP+
Sbjct: 347 PDRTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPL 406

Query: 403 VYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQI 462
            Y      W   DL LP GIY+L F +NG + HS++LPTATD   NI+NWFEV+ GYD+I
Sbjct: 407 SYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRI 466

Query: 463 EPYRDAA----------------IERSPNELAAYNETSLLLTNETPSPANIRPPLINRG- 505
           EPYRD +                +E +  + ++ N T+  + N  P   N++ P  ++  
Sbjct: 467 EPYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTT-SMRNNNPVALNLQAPAPSKAQ 525

Query: 506 ---TSSSSRARVIERTNTPISDYTGVLARNS-CSNPAIYRHKSNNSTDVDILP--KQPTL 559
               SS   A+  E++ T  SDYTGV   NS  S  +   + +    D++  P  K    
Sbjct: 526 ASRNSSYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVY 585

Query: 560 IYSSDVPELFKVGNASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQE 619
            YS+++P LF++    +   +   D N  +N  +   D P+F   V DCNQD LF  LQ+
Sbjct: 586 EYSNNIPALFRI----SCDMEDVDDDNGTENNPRAFYDRPSFTNRVVDCNQDALFGDLQK 641

Query: 620 KWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHV 679
              M+A+EAE +FL+KY VPDLP+YLNST LN+IF++  Q    G   +  S+ HIIPHV
Sbjct: 642 GGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQ--VAGPSTQDSSINHIIPHV 699

Query: 680 NLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPC 715
           NL HLLTS+IRD I+SV CTTRY GKFITQ++YAPC
Sbjct: 700 NLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPC 735

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 106/252 (42%), Gaps = 46/252 (18%)

Query: 89  LFKRDYSLSDDSSAXXXXXXXXXXXXDLIGMPNVAGLKL-----DSRAQAIMSPGPSSAT 143
           LFK DYS++ ++S                   N+AGL L     D  A  I SPGPS+AT
Sbjct: 4   LFKEDYSVTKEASEPEADESIDV---------NMAGLSLTSSMGDGSALHISSPGPSNAT 54

Query: 144 VEHSKLEASISPE--------------LAAQVHRPSIVALKQNLIQGHMGHPLHS---PL 186
           V+  K E +   E               A   HRPSIVALK +L +            P 
Sbjct: 55  VQTIKREVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVAEAAAAKRKNLPF 114

Query: 187 RXXXXXXXXXXX------------TAPSSSYVPSATIDIPYSNPSTMNTLSIIAQHQEDY 234
           R                        +PS     +A+IDIP S     ++  ++      Y
Sbjct: 115 RTINNVMDSQRSSISSSRDEIFVDASPSPVVTRTASIDIPRSEDGRRSSNRLVNSKPYLY 174

Query: 235 STRSSAVSISTQDLDGYIENSDVVLSEALVDSVVKNDMRRKR--QLQKQSAEASEAINEN 292
           +   S V +   D  G ++ +DVVL++ L++  +K DM+RKR   +Q  + E ++ ++ N
Sbjct: 175 NYEPSGVPVGDPD-GGMLQGTDVVLNQELLEQALKRDMKRKRADTMQSSTVELNKKVDTN 233

Query: 293 KNEANQQPDVKK 304
            ++ +   ++ K
Sbjct: 234 TSKNSNHTEIMK 245

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score =  243 bits (619), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 175/532 (32%), Positives = 264/532 (49%), Gaps = 87/532 (16%)

Query: 244 STQDLD---GYIENSDVVLSEALVDSVVKNDMRRKRQLQKQSAEASEAINENKNEANQQP 300
            T+ LD   G ++N D VL++A++   +K DM+RKR     S  A+  ++ ++ +  Q+ 
Sbjct: 58  GTEALDPDSGIVQNQDRVLNQAILQHAIKKDMKRKRNDSNASGTAAAVLHNHRQQQQQEE 117

Query: 301 DVKKAKVPMSNLLKPSKQMGTVTGTFLPQSELKDSGSFEYGSVQHV-------------- 346
           +V+   +  +     S +M       L     K+  + E    + V              
Sbjct: 118 NVEGPTLVGAQTGAASGEMSATAAIMLKLYGDKNQLAHEVHEAREVHEVKSAASNVRLPE 177

Query: 347 ------------------EVAADD----NYSDDCPERVQVIIKWRDTNVDPRTXXXXXXX 384
                             +VAA D    N+SD   E V+VI+KWRD  + P         
Sbjct: 178 VKKIKKPLPEKETEKVRTQVAAADEQFSNFSDFENENVRVILKWRDPQLQPYQGTGAAIK 237

Query: 385 ---------XXXXXVVQPTRKRKKIPMVYLE---QEQCWAAEDLKLPAGIYKLMFFINGQ 432
                         ++ P R+ K+  ++YL+   +++ W   DL LP GIY+L F ING 
Sbjct: 238 SHDIYSTLRAIKSELITPERENKE-DLLYLDYDAKKKDWFVPDLYLPPGIYRLKFLINGM 296

Query: 433 VRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRDAAIERSPNELAAYNETSLLLTNETP 492
           + HSN+LPTATD+   IVNWFEV+PGY+ IEPYRD ++    +E  + +      T +  
Sbjct: 297 LLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMIGQDDE--SIDSQPYKSTTDVT 354

Query: 493 SPANIRPPLINRGTSSSSRARVIERTNTPISDYTGVLARNSCS-NPAIYRHKSNNSTDVD 551
             A I          S S  R+      P    T +   +S S N A   +++N   D+ 
Sbjct: 355 DYAGISRSSSVVSKHSKSNLRL------PNLHITSLNKESSASVNEA---NETNEGNDIQ 405

Query: 552 ILPKQPTLIYSSDVPELFKVGNASTGGSQQGSDKNKLQNPSKYLQDSPN-----FMKNVQ 606
           +LP +P   YS+++PELF+  + +T   ++ +D  +++  SK     PN      +  V 
Sbjct: 406 LLP-EPKYEYSTEIPELFQFDDVNT---RKTNDIKEVRKESKLETLYPNGKFDFTLARVV 461

Query: 607 DCNQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDL 666
           + NQD LF  +Q+   M  +EAEE FL K+ V DLPIYLNST LN+ F+           
Sbjct: 462 NSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNKNFS----------- 510

Query: 667 PKRKSLTHIIPHVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPCYYE 718
                + HIIPHVNL HLLT++I+++II VGCTTRY GKFITQ++YAPC Y+
Sbjct: 511 ---GEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFITQVIYAPCSYD 559

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score =  234 bits (598), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 137/327 (41%), Positives = 190/327 (58%), Gaps = 32/327 (9%)

Query: 399  KIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPG 458
            K+ +VY + E+ W   +L LP GIY++ F +N  ++HS++LPTATD   NIVNWFEV+ G
Sbjct: 706  KMELVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSG 765

Query: 459  YDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRARVIERT 518
            YD IEP+RD  I       +A N    L+ N  P           +  S +  A    + 
Sbjct: 766  YDFIEPFRDENIS------SADNSDGTLMQNIIPEKL--------KTISMTKMAGNGSKG 811

Query: 519  NTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDIL-PKQPTLI-YSSDVPELFKVGNAST 576
            +TP S+YTGV   NS S  A        S +V++  P +P  + YS+++PE+FK      
Sbjct: 812  STPRSNYTGVSRSNSLS--ASSSSSVWKSVNVNLFTPLEPNKVEYSTEIPEIFK------ 863

Query: 577  GGSQQGSDKNKLQNPSKYL--QDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLE 634
                  ++ N    P +Y   +  P  + NV DC+Q+ELF  L     M+ + AE++FL+
Sbjct: 864  ----NTTENNTSNAPMQYHPERKRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLD 919

Query: 635  KYSVPDLPIYLNSTSLNEIFNKLQQNSAMG--DLPKRKSLTHIIPHVNLNHLLTSNIRDE 692
            KY VP+LPIYLNS  + +I  ++ Q S  G         L HIIPHVNL HLLTS+IR+E
Sbjct: 920  KYPVPELPIYLNSKYMTQIVGEINQPSGSGPPSSLNNNDLNHIIPHVNLQHLLTSSIREE 979

Query: 693  IISVGCTTRYEGKFITQIMYAPCYYEN 719
            +ISV CTTRYEGKF+TQI+Y PC+YEN
Sbjct: 980  MISVACTTRYEGKFLTQILYTPCFYEN 1006

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score =  187 bits (474), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 119/321 (37%), Positives = 169/321 (52%), Gaps = 60/321 (18%)

Query: 395 RKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFE 454
           RK+ KI ++Y      W   +L LP GIYKL F ING + HSNYLPTAT++  NIVNWFE
Sbjct: 198 RKKFKINLLYDIVTNEWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFE 257

Query: 455 VVPGYDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRARV 514
           V+ GY  IEPYRD   ER                            +I+R  S+++ +  
Sbjct: 258 VICGYKTIEPYRDE--ER----------------------------IIHREKSTANESI- 286

Query: 515 IERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKV-GN 573
              ++  ++DY G+ +R+S          S++    ++      + Y++++PE+FK    
Sbjct: 287 ---SSNSLTDYAGI-SRSSSIVSNKSSLISSSLKLTNLNLNDDEIKYTNEIPEIFKFDST 342

Query: 574 ASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFL 633
           A++  + Q  D +               +  V D NQD +F  LQ+   MN  EAE  FL
Sbjct: 343 ANSNVNNQAFDMS---------------LSKVIDLNQDHVFASLQKIARMNTDEAENYFL 387

Query: 634 EKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEI 693
            ++ + DLPIYLNS  LN+IF +   N             + +PHVNLNHLLT++I+D+ 
Sbjct: 388 NRFKIHDLPIYLNSNFLNKIFIRDNNNETT---------NNTVPHVNLNHLLTTSIKDDT 438

Query: 694 ISVGCTTRYEGKFITQIMYAP 714
           + V CTTRY GKFITQIMYAP
Sbjct: 439 LCVACTTRYVGKFITQIMYAP 459

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  161 bits (407), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 118/369 (31%), Positives = 179/369 (48%), Gaps = 33/369 (8%)

Query: 361 RVQVIIKWRDTNVDPRTXXXXXXXXXXXXV-VQPTRKR----KKIPMVYLEQEQCWAAED 415
           RV V+++WRD+ +   T              VQ             M Y + E  W   D
Sbjct: 309 RVNVVLRWRDSYIQNETCKSVSIISEDILTSVQAQNSGVLLISNFSMTYDKNENNWVLPD 368

Query: 416 LKLPAGIYKLMFFINGQ-VRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPY-RDAAIERS 473
           L LP G Y+L F I+    R+SNYLP   D L  I+N  E++PGY  +EP+  +  I   
Sbjct: 369 LFLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFEHNNHIMIQ 428

Query: 474 PN----ELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRARVIERTNTPISDYTGVL 529
            N    EL+  N  S  L +E PS   +          SS    +I         Y+ V 
Sbjct: 429 ENIINSELSLNN--SRQLQSEPPSYPELEENF------SSPIESIISEDELDNDQYSKVY 480

Query: 530 ARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNASTGGSQQGSDKNKLQ 589
            +    N +I + K    T + I P    + Y++++P+LFK+ + +   ++       ++
Sbjct: 481 GK---RNNSIGQSK----TSLSIKPCISEVTYTNEIPQLFKITDNNCIVNENYERYGFVE 533

Query: 590 NPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTS 649
            PS      P     V DCNQD LF   Q+   ++ + AE++FLEKY VPDLP++L+S  
Sbjct: 534 PPS---YGEPGLENRVIDCNQDILFATFQQNGAVDVELAEQLFLEKYPVPDLPVFLDSHF 590

Query: 650 LNEIFNKLQQNSAMGDLPKR----KSLTHIIPHVNLNHLLTSNIRDEIISVGCTTRYEGK 705
             ++F+    +  + D+       K+    IPHVNLNH+LT+ I + +ISV CTTRY+ K
Sbjct: 591 SEKLFDNNDSSKNLNDMNGEDIQIKNNGQDIPHVNLNHVLTNKISNGMISVACTTRYKRK 650

Query: 706 FITQIMYAP 714
           F+T I+Y+P
Sbjct: 651 FVTHILYSP 659

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 105/381 (27%), Positives = 164/381 (43%), Gaps = 72/381 (18%)

Query: 360 ERVQVIIKWRDTNVDPRTXXXXXXXXXXX-XVVQPTR----KRKKIPMVYLEQEQCWAAE 414
           ++ +V ++W D+   P               V+   R    K K++P+ Y      W   
Sbjct: 310 QKTRVTLRWIDSKFKPNNYQSVSIISEDIIDVINFYRSNNDKIKRLPLKYDSLTHEWKIS 369

Query: 415 DLKLPAGIYKLMFFIN-GQVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRDAAIERS 473
           DL LPAG Y+  F IN   V HS ++ T  D     VN+FEV       EP + ++    
Sbjct: 370 DLFLPAGYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKYVRTFEPLQLSS---- 425

Query: 474 PNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRARVIERTNTPISDYTGVLARNS 533
               A Y          T + A+ R              R IE + T  S++  +L    
Sbjct: 426 ----ALY----------TVTQADDR--------------RHIECSKTS-SEFLNLLDNYD 456

Query: 534 CS---NPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNASTGGSQQGSDKNKLQN 590
                N   Y H  + + +     K     Y++ +PELFK    +       ++   L+ 
Sbjct: 457 IRTRYNANFYSHNESGTGNNFNNNK-----YTNQIPELFKFSEKNIRELSTETEITFLEP 511

Query: 591 PSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTSL 650
           PS      P+F  N+ DC+Q++LF  LQ+   +++  AE+V L++Y V +LPI+  + S+
Sbjct: 512 PS---YGEPSFYNNIVDCSQEKLFLSLQQNGAVDSYVAEQVILQRYPVSELPIFFENISM 568

Query: 651 NEI------FNK----------LQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEII 694
            ++       NK          L  N +    PK        PHV LNHL+T  I   ++
Sbjct: 569 EKLASHNNNLNKSHTNKHWLEGLTPNESDNITPKEP------PHVILNHLVTQKISRNVV 622

Query: 695 SVGCTTRYEGKFITQIMYAPC 715
           SV  TTRY+ K+ITQI+Y+P 
Sbjct: 623 SVAVTTRYKQKYITQILYSPI 643

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 133/325 (40%), Gaps = 75/325 (23%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V L  +       L+LP G +K  F ++ ++R S+YLPTATD + N VN+ 
Sbjct: 170 TGWRKMIGLVPLPGKPSVLHVKLQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYL 229

Query: 454 EVVPGYDQIEPYRDAAIERSPNEL--AAYNETSLLLTNETPSPANIRPPLINRGTSSSSR 511
           EVV       P     + ++ NE+    +N+  + L  +    A    P   R T  S+R
Sbjct: 230 EVV------APPAAPQLGQTQNEINDQQWNDEQMGLPAQDRDTATY--PSATRKTPMSAR 281

Query: 512 ARVIERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKV 571
           +R+         D  G   R                   D  P +P+L+++ D+P +F  
Sbjct: 282 SRIAFEIEQEPDDMGGGYTRFH-----------------DETPSKPSLVFTRDIPAVFT- 323

Query: 572 GNASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEV 631
                                      P  M+           +YL     ++ Q+    
Sbjct: 324 --------------------------DPAVMEQ----------YYL----TLDQQQNNHQ 343

Query: 632 FLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIP-HVNLNHLLTSNIR 690
            +   + P LP +L +  LN  ++ LQ     G+  +  S    IP HV LNHL TS+I+
Sbjct: 344 NMAWLTPPQLPPHLENVILNS-YSSLQ-----GESNENNSGALPIPNHVILNHLATSSIK 397

Query: 691 DEIISVGCTTRYEGKFITQIMYAPC 715
              + V    RY+ K+ TQI+YAP 
Sbjct: 398 HNTLCVASIVRYKQKYATQILYAPL 422

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 75.9 bits (185), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 84/327 (25%), Positives = 130/327 (39%), Gaps = 97/327 (29%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G ++  F ++ ++R S+YLPTATD + N VN+ 
Sbjct: 182 TGWRKMIGLVPVPGQPGLMHVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYM 241

Query: 454 EVVPGYD-QIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRA 512
           EV    D   EP +  +  +     A Y +   L         N RP         S+R+
Sbjct: 242 EVTAPPDWSSEPQQQGSDNK-----ANYADDDKL---------NKRP--------MSARS 279

Query: 513 RV---IERTNTPISD-YTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPEL 568
           R+   IE+    + D YT                        D  P +P L Y+ D+P +
Sbjct: 280 RIALEIEKEPDDMGDGYTRFH---------------------DETPAKPNLEYTQDIPAV 318

Query: 569 FKVGNASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEA 628
           F                             PN M+           +YL     ++ Q+ 
Sbjct: 319 FT---------------------------DPNVMEQ----------YYL----TLDQQQN 337

Query: 629 EEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSN 688
               +   + P LP +L +  LN  ++  Q ++  G LP       I  HV LNHL TS+
Sbjct: 338 NHQNMAWLTPPQLPPHLENVILNS-YSNAQTDNTSGALP-------IPNHVILNHLATSS 389

Query: 689 IRDEIISVGCTTRYEGKFITQIMYAPC 715
           I+   + V    RY+ K++TQI+Y P 
Sbjct: 390 IKHNTLCVASIVRYKQKYVTQILYTPL 416

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 122/322 (37%), Gaps = 87/322 (27%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G ++  F ++ ++R S+YLPTATD + N VN+ 
Sbjct: 182 TGWRKMIGLVPVPGQPGLMHVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYM 241

Query: 454 EVVPGYDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRAR 513
           EV    D     +    E+  N +               S  + RP         S+R+R
Sbjct: 242 EVSAPPDWGNEPQQHLAEKKANHVDD-------------SKLSKRP--------MSARSR 280

Query: 514 VIERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGN 573
           +         D      R     PA                 +P L Y+ D+P +F    
Sbjct: 281 IALEIEKEPDDMGDGYTRFHDETPA-----------------KPNLEYTQDIPAVFT--- 320

Query: 574 ASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFL 633
                                    PN M+           +YL     ++ Q+     +
Sbjct: 321 ------------------------DPNVMEQ----------YYL----TLDQQQNNHQNM 342

Query: 634 EKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEI 693
              + P LP +L +  LN  ++  Q ++  G LP       I  HV LNHL TS+I+   
Sbjct: 343 AWLTPPQLPPHLENVILNS-YSNAQTDNTSGALP-------IPNHVILNHLATSSIKHNT 394

Query: 694 ISVGCTTRYEGKFITQIMYAPC 715
           + V    RY+ K++TQI+Y P 
Sbjct: 395 LCVASIVRYKQKYVTQILYTPL 416

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 128/329 (38%), Gaps = 98/329 (29%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G ++  F ++ ++R S+YLPTATD + N VN+ 
Sbjct: 185 TGWRKMIGLVPVPGQPGLMHVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYM 244

Query: 454 EVVPGYD-QIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRA 512
           EV    D   EP + A+  +S               N      + + P+       S+R+
Sbjct: 245 EVTAPPDWSNEPQQQASDNKS---------------NHADDSQSAKRPM-------SARS 282

Query: 513 RV---IERTNTPISD-YTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPEL 568
           R+   IE+    + D YT                        D  P +P L Y+ D+P +
Sbjct: 283 RIALEIEKEPDDMGDGYTRFH---------------------DEAPPKPDLEYTQDIPAV 321

Query: 569 FKVGNASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEA 628
           F                             PN M+           +YL     ++ Q+ 
Sbjct: 322 FT---------------------------DPNVMEQ----------YYL----TLDQQQN 340

Query: 629 EEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNS--AMGDLPKRKSLTHIIPHVNLNHLLT 686
               +   + P LP +L +  LN   N    N+    G LP       I  HV LNHL T
Sbjct: 341 NHQNMAWLTPPQLPPHLENVILNNYSNAQTDNNENTSGALP-------IPNHVILNHLAT 393

Query: 687 SNIRDEIISVGCTTRYEGKFITQIMYAPC 715
           S+I+   + V    RY+ K++TQI+Y P 
Sbjct: 394 SSIKHNTLCVASIVRYKQKYVTQILYTPL 422

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 126/326 (38%), Gaps = 77/326 (23%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G ++  F ++ ++R S+YLPTATD + N VN+ 
Sbjct: 156 TGWRKMIGLVPVPGQPGVFYVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYL 215

Query: 454 EVVPGYDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRAR 513
           EV      I P  +     +      ++ ++     +  +       +       S+R+R
Sbjct: 216 EV------IAPATEVTGAPTTTTFGTWDSSAQSQQAQQQNLQQNEASIKVENQPLSARSR 269

Query: 514 V---IERTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFK 570
           +   IER    + D                R         D +P++P   Y+ D+P +F 
Sbjct: 270 IALQIEREPDEMGD-------------GFSRFH-------DEMPQKPQYDYTQDIPAVFT 309

Query: 571 VGNASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEE 630
                                       P  M+           +YL     ++ Q+   
Sbjct: 310 ---------------------------DPTVMEQ----------YYL----TLDQQQNNH 328

Query: 631 VFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIP-HVNLNHLLTSNI 689
             +   + P LP +L +  LN   N      + G+  +  S    IP HV LNHL TS+I
Sbjct: 329 QNMAWLTPPQLPPHLENVILNSYSN------SQGESNENTSGALPIPNHVILNHLATSSI 382

Query: 690 RDEIISVGCTTRYEGKFITQIMYAPC 715
           +   + V    RY  K++TQI+YAP 
Sbjct: 383 KHNTLCVASIVRYRQKYVTQILYAPL 408

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/321 (23%), Positives = 122/321 (38%), Gaps = 86/321 (26%)

Query: 397 RKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVV 456
           RK I ++ +E E       L+L  G ++  F ++ Q+R S+ LPTATD + N VN+ EV 
Sbjct: 194 RKMIGLIPVESEPGHFKIKLQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEV- 252

Query: 457 PGYDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRARVIE 516
                  P  D+   R+  E    N+ S+   ++  S      PL       S+R+ +  
Sbjct: 253 ----SAVPKSDSTSSRTGKERKDKNKKSVSKVSKDRSTVG---PL-------SARSCIAL 298

Query: 517 RTNTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVGNAST 576
                  D+     R        Y  +         LP++P   +SS++P +F       
Sbjct: 299 EIEKEPDDFGDGYTR--------YHEE---------LPQEPKYEFSSEIPAIF------- 334

Query: 577 GGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKY 636
                                               +   + E+  M  Q  +   +   
Sbjct: 335 ------------------------------------VDQSIIEQLTMERQRKKSNNMSWL 358

Query: 637 SVPDLPIYLNSTSLNEIFNKLQQNSA--MGDLPKRKSLTHIIP-HVNLNHLLTSNIRDEI 693
           + P LP  L +  LN+    L Q++    G LP        IP H  LNHL+T++I+   
Sbjct: 359 TPPQLPPQLENVILNKFGEPLSQSTENNAGALP--------IPNHSVLNHLVTTSIKHNT 410

Query: 694 ISVGCTTRYEGKFITQIMYAP 714
           + V    RY  K+++QI Y P
Sbjct: 411 LCVATNNRYRQKYVSQIYYVP 431

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 39/64 (60%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I ++ +  +       L+LP G ++  F ++ ++R S+YLPTATD + N VN+ 
Sbjct: 231 TGWRKMIGLIPVPNQPGMFHIKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYM 290

Query: 454 EVVP 457
           E+VP
Sbjct: 291 EIVP 294

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 42/80 (52%), Gaps = 7/80 (8%)

Query: 639 PDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIP---HVNLNHLLTSNIRDEIIS 695
           P LP +L     N I N    NSA  +    ++ +  +P   HV LNHL TS+I+   + 
Sbjct: 427 PQLPPHLE----NVILNNYSANSAQAEESGGENNSGALPIPNHVVLNHLATSSIKHNTLC 482

Query: 696 VGCTTRYEGKFITQIMYAPC 715
           V    RY+ K+ TQI+YAP 
Sbjct: 483 VASIVRYKSKYATQILYAPL 502

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%)

Query: 416 LKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRD 467
           LKLP G +K  F ++ ++R S++LPTATD   N VN+ EV P  + +E  +D
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEVKPSEETLELEKD 244

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 29/37 (78%)

Query: 678 HVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAP 714
           +V LNHLLTS+I++ ++ +GC+ RY  K++TQ+ Y P
Sbjct: 351 YVTLNHLLTSSIKNNMLCLGCSVRYRQKYVTQVYYTP 387

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (58%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V       WA   LKLP G ++  F ++ ++R S+ +P+ATDS+ N+VN+ 
Sbjct: 126 TSWRKMIALVEHPTNPDWARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYI 185

Query: 454 EVVPGYDQIE 463
           EV P   Q E
Sbjct: 186 EVKPSKRQYE 195

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 47/80 (58%), Gaps = 12/80 (15%)

Query: 639 PDLPIYLNSTSLNEIFNKLQQ--NSAMGDLPKRKSLTHIIP-HVNLNHLLTSNIRDEIIS 695
           P +P + +   LN+  N LQ   +S  G LP        IP HV LNHL+ ++++  +++
Sbjct: 277 PQIPPHFDVVILNDQ-NSLQHTDDSNAGFLP--------IPNHVVLNHLIVNSVKSNMLA 327

Query: 696 VGCTTRYEGKFITQIMYAPC 715
           +  TTRY+ KFITQ+ Y+P 
Sbjct: 328 ISTTTRYKEKFITQVCYSPI 347

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%)

Query: 397 RKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVV 456
           RK I +V +  +       L+LP G ++  F ++ ++R S++LPTATD + N VN+ E+V
Sbjct: 222 RKMIGLVPVTDKPGVFHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIV 281

Query: 457 P 457
           P
Sbjct: 282 P 282

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 639 PDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGC 698
           P LP  L     N I N   +N+  G      +L  I  HV LNHL TS+I+   + V  
Sbjct: 414 PQLPPQLE----NVILNNYNKNAEPGSENNSGALP-IPNHVVLNHLATSSIKHNTLCVAS 468

Query: 699 TTRYEGKFITQIMYAPC 715
             RY+ K+ TQI+YAP 
Sbjct: 469 IVRYKRKYATQILYAPL 485

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 2/70 (2%)

Query: 397 RKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVV 456
           RK I +V +  +       L+LP G ++  F ++ ++R S++LPTATD + N VN+ E+ 
Sbjct: 183 RKMIGLVPMPDQPNVLHVKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIA 242

Query: 457 P--GYDQIEP 464
           P  G D+  P
Sbjct: 243 PVAGTDEKPP 252

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 64/139 (46%), Gaps = 15/139 (10%)

Query: 578 GSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEKYS 637
           G  +  D + L+   +Y QD P       D N  E ++   ++   N Q      +   +
Sbjct: 290 GYSRFHDTSPLETKYEYTQDIPAVFT---DPNVMEQYYLTLDQQKNNHQN-----MAWLT 341

Query: 638 VPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIP-HVNLNHLLTSNIRDEIISV 696
            P LP +L +  LN   N      A G+  +  S    IP HV LNHL TS+I+   + V
Sbjct: 342 PPQLPPHLENVILNSYSN------AQGESNENNSGALPIPNHVILNHLATSSIKHNTLCV 395

Query: 697 GCTTRYEGKFITQIMYAPC 715
               RY+ K++TQI+YAP 
Sbjct: 396 ASIVRYKRKYVTQILYAPL 414

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G +K  F ++ ++R S++LPTATD + N VN+ 
Sbjct: 161 TGWRKMIGLVPVPGQPGVLHVKLQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYL 220

Query: 454 EVVP 457
           E VP
Sbjct: 221 EAVP 224

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 678 HVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPC 715
           HV L+HL TS+I+   + V    RY+ K++TQI+YAP 
Sbjct: 386 HVVLHHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 423

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G ++  F ++ ++R S++LPTATD + N VN+ 
Sbjct: 180 TGWRKMIGLVPVPDQPGLLHVKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYL 239

Query: 454 EVV 456
           EVV
Sbjct: 240 EVV 242

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query: 639 PDLPIYLNSTSLNEIFNKLQQN-SAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVG 697
           P LP +L +  LN        N +  G LP       I  HV LNHL TS+I+   + V 
Sbjct: 362 PQLPPHLENVILNSYSGSGSDNENTSGALP-------IPNHVVLNHLATSSIKHNTLCVA 414

Query: 698 CTTRYEGKFITQIMYAPC 715
              RY+ K++TQI+YAP 
Sbjct: 415 SIVRYKSKYVTQILYAPL 432

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 39/68 (57%)

Query: 397 RKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVV 456
           RK I +V +          L+LP G ++  F ++ ++R S+YLPTATD + N VN+ EV+
Sbjct: 168 RKMIGLVPVPGHPDLLHVKLQLPVGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVI 227

Query: 457 PGYDQIEP 464
               Q +P
Sbjct: 228 APPSQEKP 235

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 42/81 (51%), Gaps = 13/81 (16%)

Query: 639 PDLPIYLNSTSLNEIFNKLQQNSA----MGDLPKRKSLTHIIPHVNLNHLLTSNIRDEII 694
           P LP +L +  LN   N   QN +     G LP       I  HV LNHL TS+I+   +
Sbjct: 332 PQLPPHLENVPLNSYTNS--QNDSNENNSGALP-------IPNHVVLNHLATSSIKHNTL 382

Query: 695 SVGCTTRYEGKFITQIMYAPC 715
            V    RY+ K++TQI+YAP 
Sbjct: 383 CVASIVRYKRKYVTQILYAPL 403

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%)

Query: 397 RKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEV 455
           RK I ++ +  +Q      L+LPAG ++  F ++ +++ S++LPTATD   N VN+ EV
Sbjct: 252 RKMISLIPVPDKQGLFHVKLQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 56/106 (52%), Gaps = 15/106 (14%)

Query: 611 DELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRK 670
           +E +  L  K N N+       L+  + P LP +L +  LN   +   +N++ G LP   
Sbjct: 408 EEYYLTLDRKKNSNSSS-----LQWLTPPQLPPHLENIILNSSQDTSNENTS-GALP--- 458

Query: 671 SLTHIIP-HVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPC 715
                IP HV LNHL+T++I+   + V    RY+ K++TQI+YAP 
Sbjct: 459 -----IPNHVVLNHLVTTSIKHNTLCVASIIRYKHKYVTQILYAPL 499

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 38/63 (60%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G ++  F ++ ++R S++LPTATD + N VN+ 
Sbjct: 146 TGWRKMIGLVPVPDQPGLFHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYL 205

Query: 454 EVV 456
           E+V
Sbjct: 206 EIV 208

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 639 PDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHI-IP-HVNLNHLLTSNIRDEIISV 696
           P LP +L     N I N     S  GD     +   + IP HV LNHL TS+I+   + V
Sbjct: 354 PQLPPHLE----NVILNNYSSQSEPGDSGSENNSGALPIPNHVVLNHLATSSIKHSTLCV 409

Query: 697 GCTTRYEGKFITQIMYAPC 715
               RY+ K+ TQI+Y+P 
Sbjct: 410 ASIVRYKRKYATQILYSPL 428

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 38/65 (58%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G ++  F ++ ++R S+YLPTATD + N VN+ 
Sbjct: 133 TGWRKMIGLVPVPDQPGLLHAKLQLPIGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYL 192

Query: 454 EVVPG 458
           E+  G
Sbjct: 193 EIGRG 197

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (53%), Gaps = 14/82 (17%)

Query: 639 PDLPIYLNSTSLNEIFNKLQQNSA----MGDLPKRKSLTHIIP-HVNLNHLLTSNIRDEI 693
           P LP +L    LN  +N +Q +S      G LP        IP HV LNHL TS+I+   
Sbjct: 275 PTLPPHLEDVPLNS-YNGIQGDSNNENNSGALP--------IPNHVVLNHLATSSIKHNT 325

Query: 694 ISVGCTTRYEGKFITQIMYAPC 715
           + V    RY+ K++TQI+YAP 
Sbjct: 326 LCVASIVRYKRKYVTQILYAPL 347

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 37/62 (59%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G ++  F ++ ++R S+YLPTATD + N VN+ 
Sbjct: 183 TGWRKMIGLVPVPGQPGLMHVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYM 242

Query: 454 EV 455
           EV
Sbjct: 243 EV 244

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 42/77 (54%), Gaps = 8/77 (10%)

Query: 639 PDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGC 698
           P LP +L +  LN  ++  Q ++  G LP       I  HV LNHL TS+I+   + V  
Sbjct: 349 PQLPPHLENVILNS-YSNAQTDNTSGALP-------IPNHVILNHLATSSIKHNTLCVAS 400

Query: 699 TTRYEGKFITQIMYAPC 715
             RY+ K++TQI+Y P 
Sbjct: 401 IVRYKQKYVTQILYTPL 417

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 37/62 (59%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G ++  F ++ ++R S+YLPTATD + N VN+ 
Sbjct: 185 TGWRKMIGLVPMPDQPNILHVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYL 244

Query: 454 EV 455
           E+
Sbjct: 245 EI 246

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 42/80 (52%), Gaps = 11/80 (13%)

Query: 639 PDLPIYLNSTSLNEIFNKLQQNSA--MGDLPKRKSLTHIIP-HVNLNHLLTSNIRDEIIS 695
           P LP +L +  LN   N    N+    G LP        IP HV LNHL TS+I+   + 
Sbjct: 360 PQLPPHLENVILNSYSNSQGTNNENNSGALP--------IPNHVILNHLATSSIKHNTLC 411

Query: 696 VGCTTRYEGKFITQIMYAPC 715
           V    RY+ K++TQI+YAP 
Sbjct: 412 VASIVRYKRKYVTQILYAPL 431

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 37/63 (58%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G +K  F ++ ++R S++LPTATD + N VN+ 
Sbjct: 156 TGWRKMIGLVPVPGQPGVLHVKLQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYL 215

Query: 454 EVV 456
           E V
Sbjct: 216 EAV 218

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 13/81 (16%)

Query: 639 PDLPIYLNSTSLNEIFN---KLQQNSAMGDLPKRKSLTHIIP-HVNLNHLLTSNIRDEII 694
           P LP +L +  LN   +   +  QN++ G LP        IP HV LNHL TS+I+   +
Sbjct: 363 PQLPPHLENVILNSYSSNSPETGQNNS-GSLP--------IPNHVVLNHLATSSIKHNTL 413

Query: 695 SVGCTTRYEGKFITQIMYAPC 715
            V    RY+ K++TQI+YAP 
Sbjct: 414 CVASIVRYKRKYVTQILYAPL 434

>Kwal_47.18638 s47 (907369..908499) [1131 bp, 377 aa] {OFF} [contig
           192] PARTIAL
          Length = 377

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 95/393 (24%), Positives = 152/393 (38%), Gaps = 113/393 (28%)

Query: 48  RVRQQSITSQLFPGRHQARS-----KWKSQ-RNXXXXXXXXXXXXDHLFKRDYSLSDDSS 101
           R RQ SITSQLFP R   R+      WKS+  +               F++DYSL   S 
Sbjct: 23  RGRQDSITSQLFPSRTTGRNPEEKKGWKSRVLHGKRAGTTSPSSAPSPFRKDYSLDSASE 82

Query: 102 AXX-----------------XXXXXXXXXXDLIGMPNVAGLKL-DSRAQA---------I 134
                                          L+   ++A L L +S +QA         +
Sbjct: 83  TASYNFKKSASGNPAPPMCIAAHASAEDSSSLLLRDHLAELSLQNSESQAHVAASPAPLL 142

Query: 135 MSPGPSSATVEHSKLEASISPELAAQVHRPSIVALKQNLIQGHMGHPLHSPLRXXXXXXX 194
            SPGPSS  V+ +K EA     L  Q+   S+ +LK+ L++G +G  +++P         
Sbjct: 143 QSPGPSSPVVQSTKQEA-----LFEQLS--SMTSLKKMLVEGRIGDQINAP--------- 186

Query: 195 XXXXTAPSSSYVPSATIDIPYSNPSTMNTLSIIAQHQEDYSTRSSAVSISTQDLDGYIEN 254
                 PSS       IDIP   PS   + + ++   +D  +    V             
Sbjct: 187 ------PSS-------IDIPR-RPSVAVSDTYMSDDGDDEESLLQGV------------- 219

Query: 255 SDVVLSEALVDSVVKNDMRRKRQLQKQSAEASEAINENKNEANQQPDVKKAK--VPMSNL 312
           +DVV++    +S+++N M+RKR  +K  A  +     +  E      +KK K   P S+ 
Sbjct: 220 NDVVIN----NSMLENAMKRKRSSRKNKALGASC---SSRETMPHSGLKKLKPLEPASDR 272

Query: 313 L----------KPSKQMGTVTGTFLPQ---SELKDSGSFEYGSVQHVEVAADDNYSDDCP 359
           +          +P++         +P+         GSFE G+V+H E     ++S    
Sbjct: 273 INLPSFSAMHARPTENDYDPDSAAVPRLVPDTFDRIGSFENGTVEHYEGTNQSDFSSQGV 332

Query: 360 ---------------ERVQVIIKWRDTNVDPRT 377
                          +   VI+KW+D  VDP++
Sbjct: 333 NSSDSGSSDDTNSSIQDTHVILKWKDNIVDPKS 365

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 36/63 (57%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V            L+LP G ++  F ++ ++R S++LPTATD + N VN+ 
Sbjct: 195 TGWRKMIGLVAAPNNPGLFHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYM 254

Query: 454 EVV 456
           E+V
Sbjct: 255 EIV 257

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 639 PDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGC 698
           P LP +L    LN  +NK    SA G          I  HV LNHL TS+I+   + V  
Sbjct: 378 PQLPPHLEHVILNH-YNK----SADGASENTSGALPIPNHVVLNHLATSSIKHNTLCVAS 432

Query: 699 TTRYEGKFITQIMYAPCY 716
             RY+ K+ TQI+YAP +
Sbjct: 433 IVRYKSKYATQILYAPLH 450

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 36/62 (58%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I ++ +          L+LP G ++  F ++ ++R S+YLPTATD + N VN+ 
Sbjct: 229 TGWRKMIGLIPVAGHPNLLHVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYL 288

Query: 454 EV 455
           E+
Sbjct: 289 EI 290

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%)

Query: 678 HVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPC 715
           HV LNHL TS+I+   + V    RY+ K++TQI+YAP 
Sbjct: 465 HVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 502

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 37/64 (57%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T  RK I +V +  +       L+LP G ++  F ++ ++R S+YL TATD + N VN+ 
Sbjct: 146 TGWRKMIGLVPVADQPGVFHIKLQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYL 205

Query: 454 EVVP 457
           E+ P
Sbjct: 206 EISP 209

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 639 PDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIP-HVNLNHLLTSNIRDEIISVG 697
           P LP +L +  LN   N    +   G   +  S    IP HV LNHL TS+I+   + V 
Sbjct: 341 PQLPPHLENVILNNYSNS---SDPGGSGSENNSGALPIPNHVVLNHLATSSIKHNTLCVA 397

Query: 698 CTTRYEGKFITQIMYAPC 715
              RY+ K+ TQI+Y+P 
Sbjct: 398 SIVRYKRKYATQILYSPL 415

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 28/40 (70%)

Query: 416 LKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEV 455
           L+LP G ++  F ++ ++R S+YLPTATD   N VN+ EV
Sbjct: 280 LQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEV 319

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 678 HVNLNHLLTSNIRDEIISVGCTTRYEGKFITQIMYAPC 715
           HV LNHL+T++I+   + V    RY+ K+ TQI+Y P 
Sbjct: 544 HVVLNHLVTTSIKHNTLCVASIIRYKHKYATQILYTPL 581

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 13/81 (16%)

Query: 639 PDLPIYLNSTSLNEIF---NKLQQNSAMGDLPKRKSLTHIIP-HVNLNHLLTSNIRDEII 694
           P LP  L +  LN+ +   ++  +N++ G LP        IP HV LNHL+TS+I+   +
Sbjct: 367 PQLPPQLENVILNKYYATQDQFNENNS-GALP--------IPNHVVLNHLVTSSIKHNTL 417

Query: 695 SVGCTTRYEGKFITQIMYAPC 715
            V    RY+ K++TQI+Y P 
Sbjct: 418 CVASIVRYKQKYVTQILYTPI 438

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 36/62 (58%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T+ RK I ++    +       L+L  G ++  F ++ ++R S++LPTATD + N VN+ 
Sbjct: 210 TKWRKMIGLIPDANKNGLFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYI 269

Query: 454 EV 455
           EV
Sbjct: 270 EV 271

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 13/80 (16%)

Query: 639 PDLPIYLNSTSLNEIF---NKLQQNSAMGDLPKRKSLTHIIP-HVNLNHLLTSNIRDEII 694
           P LP  L +  LN+ +   ++  +N++ G LP        IP HV LNHL+TS+I+   +
Sbjct: 341 PQLPPQLENVILNKYYATQDQFNENNS-GALP--------IPNHVVLNHLVTSSIKHNTL 391

Query: 695 SVGCTTRYEGKFITQIMYAP 714
            V    RY+ K++TQI+Y P
Sbjct: 392 CVASIVRYKQKYVTQILYTP 411

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 28/40 (70%)

Query: 416 LKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEV 455
           L+L  G ++  F ++ ++R S++LPTATD + N VN+ EV
Sbjct: 206 LRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 245

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (54%), Gaps = 15/82 (18%)

Query: 639 PDLPIYLNSTSLNEIFNK----LQQNSAMGDLPKRKSLTHIIP-HVNLNHLLTSNIRDEI 693
           P LP +L    LN  +NK    + +N++ G LP        IP HV LNHL TS+I+   
Sbjct: 403 PQLPPHLEHVILNH-YNKSADGVSENTS-GALP--------IPNHVVLNHLATSSIKHNT 452

Query: 694 ISVGCTTRYEGKFITQIMYAPC 715
           + V    RY+ K+ TQI+YAP 
Sbjct: 453 LCVASIVRYKQKYATQILYAPL 474

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 29/41 (70%)

Query: 416 LKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVV 456
           L+LP G ++  F ++ ++R S++L TATD + N VN+ E+V
Sbjct: 236 LQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIV 276

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 43/88 (48%), Gaps = 24/88 (27%)

Query: 629 EEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIP-HVNLNHLLTS 687
           E V L KY       Y+     NE       NS  G LP        IP HV LNHL+TS
Sbjct: 348 ENVILNKY-------YMTQDQFNE------NNS--GALP--------IPNHVVLNHLITS 384

Query: 688 NIRDEIISVGCTTRYEGKFITQIMYAPC 715
           +I+   + V    RY+ K++TQI+YAP 
Sbjct: 385 SIKHNTLCVASIVRYKQKYVTQILYAPI 412

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 36/62 (58%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T+ RK I ++   +        L+L  G ++  F ++ ++R S++LPTATD + N VN+ 
Sbjct: 184 TKWRKMIGLIPDSKHSGAFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYI 243

Query: 454 EV 455
           EV
Sbjct: 244 EV 245

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 49/109 (44%), Gaps = 5/109 (4%)

Query: 361 RVQVIIKWRDTNVDP-RTXXXXXXXXXXXXVVQPTRKR---KKIPMVYLEQEQCWAAEDL 416
           R +V +++RD++  P R              +Q T K    ++IP+ +      W A DL
Sbjct: 69  RTKVKLRFRDSHTIPFRVHSVAIQGTDITSKLQRTGKMGGLQQIPLQFEGDSSEWVAPDL 128

Query: 417 KLPAGIYKLMFFINGQV-RHSNYLPTATDSLSNIVNWFEVVPGYDQIEP 464
            LP G YK  F IN     HS YLP  T       N+F V+   + +EP
Sbjct: 129 YLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEP 177

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 16/113 (14%)

Query: 609 NQDELFHYLQEKWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPK 668
           NQ   F+Y  ++ +  + + +  F E+Y+VP +P Y  S  +       Q N+    LP 
Sbjct: 227 NQKTFFYYAFQEQDAASGDYDAQFCERYTVPIIPPYFYSIDITP-----QDNTLKVPLP- 280

Query: 669 RKSLTHIIPHVNLNHLLT---SNIRDEIISVGCTTRYEGKFITQIMYAPCYYE 718
                  I   NLN  +     +I ++ + +GC   Y GK++  + Y P  +E
Sbjct: 281 -------IQLANLNRTIFPSPEDICNDYLCIGCVISYRGKYMAHLFYRPSPWE 326

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (56%), Gaps = 13/81 (16%)

Query: 639 PDLPIYLNSTSLNEIF---NKLQQNSAMGDLPKRKSLTHIIP-HVNLNHLLTSNIRDEII 694
           P LP  L +  LN+     +++ +N++ G LP        IP HV LNHL+TS+I+   +
Sbjct: 340 PQLPPQLENVILNKYCTTQDQVNENNS-GALP--------IPNHVVLNHLITSSIKHNTL 390

Query: 695 SVGCTTRYEGKFITQIMYAPC 715
            V    RY+ K++TQI+Y P 
Sbjct: 391 CVSSIVRYKQKYVTQILYTPI 411

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 36/62 (58%)

Query: 394 TRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWF 453
           T+ RK I +V    +       L+L  G ++  F ++ ++R S++LPTATD + N VN+ 
Sbjct: 183 TKWRKMIGLVPDSDKSGSFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYI 242

Query: 454 EV 455
           EV
Sbjct: 243 EV 244

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 77/190 (40%), Gaps = 22/190 (11%)

Query: 50  RQQSITSQLFPGRHQAR-----SKWKSQRNXXXXXXXXXXXXDHLFKRDYSLS---DDSS 101
           RQ SI S+LF  R+ +      S+  ++ N            + LFK+DYS+    +  +
Sbjct: 38  RQGSIRSELFTSRNNSNRNKIYSELAARNNLTTINSSNTNVKESLFKKDYSMGRHPNTVN 97

Query: 102 AXXXXXXXXXXXXDLIGMPNVAGLKLDSRAQAIMSPGPSSATVEHS-----KLEASISPE 156
                        +     +++     +   +  S GPS+ATVE S     +L+    P 
Sbjct: 98  HVKNRVDFTRNSSNEYSSSSLSSNTDSAYTPSFFSLGPSTATVEQSTEKVIRLDEQHHPH 157

Query: 157 --LAAQV-------HRPSIVALKQNLIQGHMGHPLHSPLRXXXXXXXXXXXTAPSSSYVP 207
             LA++        HRPSI+ALKQNL +   G PL+               +  S     
Sbjct: 158 QNLASKKDIVINHEHRPSILALKQNLYESSSGVPLYDSQPSSEVPSELHSPSTRSFERQK 217

Query: 208 SATIDIPYSN 217
           S +IDIP  N
Sbjct: 218 SVSIDIPQDN 227

>Kwal_23.4958 s23 complement(941715..943664) [1950 bp, 649 aa] {ON}
           YIL105C - Hypothetical ORF [contig 7] FULL
          Length = 649

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 393 PTRKRKKIPMVYLEQEQCWAAEDLKLPAGIYKLMFFI--NGQVRHSNYLPTATDSLSNIV 450
           P RKR  +P++ L    C  AE  K  +  YK +     NG +   +      +S  +++
Sbjct: 460 PDRKRDLVPVMSLSLNDCTVAEHSKKGSSDYKFILHAKQNGIIHRGHNWVFRAESYESML 519

Query: 451 NWFE 454
           NWFE
Sbjct: 520 NWFE 523

>NCAS0A00900 Chr1 (178813..181767) [2955 bp, 984 aa] {ON} Anc_2.8
           YNL236W
          Length = 984

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 67/159 (42%), Gaps = 24/159 (15%)

Query: 229 QHQEDYSTRSSAVSISTQDLDGYIENSDVVLSEALVDSVVKNDMRRKRQ---LQKQSAEA 285
           QH  D    + A+ ++++ LDG++        +  + S  +ND + + +    Q Q  + 
Sbjct: 439 QHHTDIKLENKAIYVTSEMLDGFVT---FYFEDGSIASFNQNDWKLETERLIYQPQQGKY 495

Query: 286 SEAINENKNEANQQPDVKKAKVPMSNLLKPS------KQMGTVTGTFLP--QSELKD--- 334
           S  I    +   Q P +          + PS      KQ+G VT  FLP  QS + D   
Sbjct: 496 SNIITSTLSANFQYPGIPNVSTLEWIRVSPSLSGVLFKQIGKVTPDFLPIIQSNVADPTK 555

Query: 335 ----SGSFEYGSV--QHVEVAADDNYSDDCPERVQVIIK 367
               + +  +G V   H ++A +D +S  C   +  I++
Sbjct: 556 DEVNATALAFGFVVSTHRQLANED-FSIACKTHILKILQ 593

>Skud_15.493 Chr15 (865472..870196) [4725 bp, 1574 aa] {ON} YOR326W
            (REAL)
          Length = 1574

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 270  NDMRR--KRQLQKQSAEASEAINENKNEANQQPDVKKAKVPMSNLLKPSKQMGTVTGTFL 327
            N+M+   K+QL++     S  I       + Q +VK  K  +  L + +  +GTVT + L
Sbjct: 1036 NEMKEESKKQLEELEETKSSLIEHQTLNGDLQNEVKSLKEEIGRL-QTAISLGTVTTSVL 1094

Query: 328  PQSELKD---SGSFEYGSV 343
            PQ+ LKD   S +  YGS+
Sbjct: 1095 PQTPLKDLMGSSAANYGSM 1113

>KAFR0L00930 Chr12 complement(170929..172278) [1350 bp, 449 aa] {ON}
           Anc_7.246 YER064C
          Length = 449

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 645 LNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEIISVGCTTRYEG 704
           +N++  ++I NK +   A+G +  R S   +I   N NHL    I D + S  C  +   
Sbjct: 256 INTSKDDDILNKFKNLEALGQMSIRSSFAFVIER-NFNHLSDIKIED-LRSKACNEKSRS 313

Query: 705 KFITQIM 711
           KF   + 
Sbjct: 314 KFFKDLF 320

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,833,868
Number of extensions: 3140016
Number of successful extensions: 10369
Number of sequences better than 10.0: 138
Number of HSP's gapped: 10805
Number of HSP's successfully gapped: 183
Length of query: 721
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 604
Effective length of database: 40,065,477
Effective search space: 24199548108
Effective search space used: 24199548108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)