Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40645.528ON42642616420.0
ADR195C5.528ON288812132e-18
ZYRO0D12584g5.528ON579821926e-15
Kwal_47.186315.528ON584791873e-14
KLLA0A01760g5.528ON583841873e-14
KLTH0G03784g5.528ON569791845e-14
SAKL0G04950g5.528ON567841802e-13
TDEL0A039205.528ON4661191721e-12
Suva_13.1555.528ON6451601562e-10
TBLA0G009305.528ON608801525e-10
Smik_13.1445.528ON6391631526e-10
KNAG0B036805.528ON4821541508e-10
NCAS0F011005.528ON475811454e-09
KAFR0C054005.528ON4811421436e-09
Kpol_1023.975.528ON591751402e-08
NDAI0C010605.528ON637781321e-07
YML007W (YAP1)5.528ON650451322e-07
NCAS0H025605.528ON587981312e-07
Skud_13.1475.528ON665451276e-07
TPHA0D023405.528ON506441222e-06
Kpol_1004.225.528ON475751222e-06
TPHA0K005205.528ON560991152e-05
CAGL0H04631g5.528ON588871142e-05
KAFR0E032905.528ON265781033e-04
YDR423C (CAD1)5.528ON40986900.017
NDAI0H016105.528ON51941870.036
CAGL0F03069g5.528ON48682860.047
TBLA0D016405.528ON59942820.15
TBLA0A064405.453ON169037770.77
Smik_4.6985.528ON39386750.91
KNAG0C062105.619ON38044751.1
Kpol_440.25.453ON98556751.1
KNAG0A067902.493ON30855703.9
CAGL0C01309g2.257ON111038688.2
NOTE: 2 genes in the same pillar as Ecym_4064 were not hit in these BLAST results
LIST: KNAG0C03210 Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4064
         (426 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...   637   0.0  
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    87   2e-18
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...    79   6e-15
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...    77   3e-14
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...    77   3e-14
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...    75   5e-14
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...    74   2e-13
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...    71   1e-12
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...    65   2e-10
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...    63   5e-10
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...    63   6e-10
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...    62   8e-10
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    60   4e-09
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...    60   6e-09
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...    59   2e-08
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...    55   1e-07
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...    55   2e-07
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...    55   2e-07
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...    54   6e-07
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    52   2e-06
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...    52   2e-06
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    49   2e-05
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...    49   2e-05
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    44   3e-04
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    39   0.017
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    38   0.036
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    38   0.047
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    36   0.15 
TBLA0A06440 Chr1 complement(1580326..1585398) [5073 bp, 1690 aa]...    34   0.77 
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    33   0.91 
KNAG0C06210 Chr3 complement(1205132..1206274) [1143 bp, 380 aa] ...    33   1.1  
Kpol_440.2 s440 (2833..3288,3290..5791) [2958 bp, 985 aa] {ON} (...    33   1.1  
KNAG0A06790 Chr1 complement(1059841..1060767) [927 bp, 308 aa] {...    32   3.9  
CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} simil...    31   8.2  

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/426 (77%), Positives = 329/426 (77%)

Query: 1   MSLAHNRLKRSLEDDDMTXXXXXXXXTATQLVFEGGGSRRKGNKPGRKPLDTEXXXXXXX 60
           MSLAHNRLKRSLEDDDMT        TATQLVFEGGGSRRKGNKPGRKPLDTE       
Sbjct: 1   MSLAHNRLKRSLEDDDMTSSSSSGGSTATQLVFEGGGSRRKGNKPGRKPLDTEAKNRRTA 60

Query: 61  XXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYRPGSP 120
                       KERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYRPGSP
Sbjct: 61  QNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYRPGSP 120

Query: 121 VLQEPEPTGDEEIQGKFGLNFPWEQSSGEEDEDSLSMVITQVPSPKSSNCSISXXXXXXX 180
           VLQEPEPTGDEEIQGKFGLNFPWEQSSGEEDEDSLSMVITQVPSPKSSNCSIS       
Sbjct: 121 VLQEPEPTGDEEIQGKFGLNFPWEQSSGEEDEDSLSMVITQVPSPKSSNCSISQQDQDQE 180

Query: 181 XXCXXXXXXXXXXXXXXXXXGILMTGSGVQPXXXXXXXXXXXXXXXXVIAALTASSNGKL 240
             C                 GILMTGSGVQP                VIAALTASSNGKL
Sbjct: 181 QQCVSAVAAAAAAAATSSTSGILMTGSGVQPSLGCGHCSGSGSDGDSVIAALTASSNGKL 240

Query: 241 GNANGSLKDIIPDSCSTPSLNLLSDSERNSICDTFQLNNDFGGACHQXXXXXXXXXXXXI 300
           GNANGSLKDIIPDSCSTPSLNLLSDSERNSICDTFQLNNDFGGACHQ            I
Sbjct: 241 GNANGSLKDIIPDSCSTPSLNLLSDSERNSICDTFQLNNDFGGACHQSSSSSLLSGCSLI 300

Query: 301 PQQTLKLDPQESTDDFSNTWVSTTPDSSYGSRSATESMPSFTTLLSGNSNVNEQWSVQDW 360
           PQQTLKLDPQESTDDFSNTWVSTTPDSSYGSRSATESMPSFTTLLSGNSNVNEQWSVQDW
Sbjct: 301 PQQTLKLDPQESTDDFSNTWVSTTPDSSYGSRSATESMPSFTTLLSGNSNVNEQWSVQDW 360

Query: 361 AMNGVPSLAXXXXXXXXXXXXXXXXPSFVDPSLTFSISARSVPAAAGYTTVSSNDLQEDD 420
           AMNGVPSLA                PSFVDPSLTFSISARSVPAAAGYTTVSSNDLQEDD
Sbjct: 361 AMNGVPSLAQHQQQNQKQQKQKQQQPSFVDPSLTFSISARSVPAAAGYTTVSSNDLQEDD 420

Query: 421 VLSYFQ 426
           VLSYFQ
Sbjct: 421 VLSYFQ 426

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 86.7 bits (213), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/81 (51%), Positives = 56/81 (69%)

Query: 36  GGSRRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSE 95
           G ++R+GNKPGRKPLDTE                   KERKM+DLED+VR+LEE+R  +E
Sbjct: 20  GETKRRGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRLEEERSSAE 79

Query: 96  REVQSLRNQVVSLLRELKKYR 116
            EVQSLR  V++L+REL+++R
Sbjct: 80  CEVQSLRGHVIALVRELRRWR 100

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/82 (48%), Positives = 51/82 (62%)

Query: 39  RRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREV 98
           R+KG KPGRKPLD+E                   KE+KMK+LEDKV  LEE   QS  E 
Sbjct: 33  RKKGGKPGRKPLDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVHALEELNQQSLVET 92

Query: 99  QSLRNQVVSLLRELKKYRPGSP 120
           + LR+Q+V+L+ ELK+YRP +P
Sbjct: 93  EFLRSQLVTLVTELKRYRPENP 114

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 50/79 (63%)

Query: 39  RRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREV 98
           +RKG+KPGRKPLDTE                   KERKM++LE++V +LE  R QSE E 
Sbjct: 19  KRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSELES 78

Query: 99  QSLRNQVVSLLRELKKYRP 117
           + LR+Q+  LL E++KYRP
Sbjct: 79  EFLRSQLQKLLAEIQKYRP 97

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 49/84 (58%)

Query: 37  GSRRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSER 96
            S+R+  KPGRKPL+TE                   +ERKMK+LEDKV +LE    QSE 
Sbjct: 36  ASKRRERKPGRKPLETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSEL 95

Query: 97  EVQSLRNQVVSLLRELKKYRPGSP 120
           E + LRNQV +LL ELK+Y P  P
Sbjct: 96  ETKFLRNQVTNLLSELKRYNPELP 119

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/79 (46%), Positives = 51/79 (64%)

Query: 39  RRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREV 98
           +RKG+KPGRKPLDTE                   KERKM++LE++V +LE+ R QSE E 
Sbjct: 19  KRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEKVREQSEMES 78

Query: 99  QSLRNQVVSLLRELKKYRP 117
           + LR+Q+  L+ E++KYRP
Sbjct: 79  EFLRSQLQMLIAEIQKYRP 97

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 51/84 (60%), Gaps = 4/84 (4%)

Query: 38  SRRKG----NKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQ 93
           ++RKG    +KPGRKPL TE                   KERKMK+LEDKV  LE  R Q
Sbjct: 38  AKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQRAFRERKERKMKELEDKVTHLETVREQ 97

Query: 94  SEREVQSLRNQVVSLLRELKKYRP 117
           +E E + LR+Q+++L+ ELKKYRP
Sbjct: 98  NEVETEFLRSQLMTLISELKKYRP 121

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 62/119 (52%), Gaps = 15/119 (12%)

Query: 41  KGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREVQS 100
           KG+KPGRKPLD E                   KE+KMK+LEDKV+ LE+    +  E + 
Sbjct: 45  KGSKPGRKPLDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQANRDTVVESEF 104

Query: 101 LRNQVVSLLRELKKYRPGSP----VL------QEPEPTGDE---EIQGK--FGLNFPWE 144
           LR+Q+++L+ ELKKYRP       VL      +  EPT  E    +Q K  F   FPW+
Sbjct: 105 LRSQLLTLVNELKKYRPAKANDLQVLDYLAKHERTEPTDKEIEQSVQKKMDFTFAFPWK 163

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 75/160 (46%), Gaps = 28/160 (17%)

Query: 39  RRKGNKPGRKP-LDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSERE 97
           RRKG+K  +K  LD E                   KERKMK+LE KV  LE  + ++E E
Sbjct: 50  RRKGSKTSKKQDLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQENEVE 109

Query: 98  VQSLRNQVVSLLRELKKYRP----GSPVLQ--------------------EPEPTGDEEI 133
              LR+Q+V+L+ ELKKYRP     S VL+                    EP  T +++I
Sbjct: 110 ATFLRDQLVTLVSELKKYRPETRNDSKVLEYLARRDPNLHPPNSNTNNNSEPIVTPNDDI 169

Query: 134 QG--KFGLNFPWEQSSGEEDEDSLSMVITQVPSPKSSNCS 171
           Q   K  +NF ++     +D D  +M   Q+PSP   N S
Sbjct: 170 QKNVKQKMNFTFQYPLDNDDNDGKNME-KQLPSPNDPNHS 208

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 46/80 (57%)

Query: 38  SRRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSERE 97
           +++K NK GRK  D E                   +ERKM++LEDKV+ LEE   +SE E
Sbjct: 33  TKKKSNKVGRKLSDQEAKSKRTAQNRAAQRAFRERRERKMQELEDKVKSLEEVHKKSEIE 92

Query: 98  VQSLRNQVVSLLRELKKYRP 117
            Q LR+Q+  LL EL++YRP
Sbjct: 93  SQFLRDQLKVLLGELQRYRP 112

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 74/163 (45%), Gaps = 29/163 (17%)

Query: 39  RRKGNKPGRKP-LDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSERE 97
           +RKG K  +K  LD E                   KERKMK+LE KV+ LE  + Q+E E
Sbjct: 50  KRKGTKTSKKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVE 109

Query: 98  VQSLRNQVVSLLRELKKYRP----GSPVLQ---------------------EPEPTGDEE 132
              LR+Q+V+L+ ELKKYRP     S VL+                      P  T ++E
Sbjct: 110 ATFLRDQLVTLVNELKKYRPETRNDSKVLEYLAKRDPNLHSSSIKANHNNSRPIITPNDE 169

Query: 133 IQG--KFGLNFPWEQSSGEEDEDSLSMVITQVPSPKSSNCSIS 173
           IQ   K  +NF + Q   + D D       Q+PSP   N S+S
Sbjct: 170 IQENVKQKMNFTF-QYPLDNDSDENKNKERQLPSPNDPNHSVS 211

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 69/154 (44%), Gaps = 16/154 (10%)

Query: 30  QLVFEGGGSRRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEE 89
           ++V  G    +K      KPLD E                   KERKMK+LE KV KL  
Sbjct: 25  EVVDSGAEPLKKRTHTASKPLDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTR 84

Query: 90  QRLQSEREVQSLRNQVVSLLRELKKYRP----GSPVLQE--------PEPTGDEEI---Q 134
            + Q+E E + LR Q+V+L+ ELKKYRP     S VL+         P   G       +
Sbjct: 85  IQKQNEVESEFLRGQLVTLVHELKKYRPETSNDSKVLEYLAKHDNVPPNQQGQAPAARDR 144

Query: 135 GKFGLNFPWE-QSSGEEDEDSLSMVITQVPSPKS 167
           G F   FPW+ +++ E D  +     T  PSP S
Sbjct: 145 GDFSFEFPWKGRTAPEFDNSTTQETTTATPSPVS 178

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (55%)

Query: 39  RRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREV 98
           +R+  +PGRKPLDT                    KERKMK+LEDK+  LE  +  +E E 
Sbjct: 18  KRRVGRPGRKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVES 77

Query: 99  QSLRNQVVSLLRELKKYRPGS 119
             LR+ ++ L+ +++KYRP +
Sbjct: 78  TFLRDYMMDLICDMQKYRPNN 98

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 67/142 (47%), Gaps = 12/142 (8%)

Query: 39  RRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREV 98
           +   +K  R  LD E                   KERKMK+LE KV  L   + Q+E E 
Sbjct: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVDHLSNIQKQNEIES 90

Query: 99  QSLRNQVVSLLRELKKYRP----GSPVL----QEPEPTGDEEIQGK--FGLNFPWEQSSG 148
           + LR+Q+++L++ELKKYRP     S VL    +      +E +  K  F   FPW+ ++ 
Sbjct: 91  EFLRSQLITLVKELKKYRPETANDSQVLNYLAKHENGNFNENLSKKSNFSFAFPWDDNNA 150

Query: 149 EED--EDSLSMVITQVPSPKSS 168
             D  ++  +     +PSP +S
Sbjct: 151 TTDKSDNLNTTTNNNIPSPDNS 172

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 44  KPGRKPL-DTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREVQSLR 102
           K GRK L D E                   KERKMK+LEDKV +LE+ + Q++ E + LR
Sbjct: 45  KVGRKLLGDHEVKNKRTAQNRAAQRAFRERKERKMKELEDKVHELEKVKQQNDVESEFLR 104

Query: 103 NQVVSLLRELKKYRP 117
           NQ+  ++ ELKKYRP
Sbjct: 105 NQLTLMIDELKKYRP 119

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%)

Query: 42  GNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREVQSL 101
           GN   ++ LD E                   KERKMK+LE+KV  L + + Q+E E + L
Sbjct: 64  GNSKKKQLLDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEIESEFL 123

Query: 102 RNQVVSLLRELKKYRPGS 119
           R+Q+++L+ ELKKY+P +
Sbjct: 124 RSQLITLVNELKKYKPNN 141

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/45 (57%), Positives = 35/45 (77%)

Query: 73  KERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYRP 117
           KERKMK+LE KV+ LE  + Q+E E   LR+Q+++L+ ELKKYRP
Sbjct: 85  KERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLVNELKKYRP 129

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 48/98 (48%), Gaps = 11/98 (11%)

Query: 34  EGGGSRRKGNKPG-----------RKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLED 82
           E  GSR+K    G           +K LD E                   KERKMK+LE+
Sbjct: 36  EDAGSRKKQEVSGTSNAAATTNMTKKQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEE 95

Query: 83  KVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYRPGSP 120
           KV  L + + Q+E E + LR Q+++L+ ELKKYR  +P
Sbjct: 96  KVNNLTKIQKQNEIESEFLRGQLITLVNELKKYRDPNP 133

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/45 (57%), Positives = 34/45 (75%)

Query: 73  KERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYRP 117
           KERKM +LE KV+ LE  + Q+E E   LR+Q+V+L+ ELKKYRP
Sbjct: 85  KERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTLVNELKKYRP 129

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 34/44 (77%)

Query: 73  KERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYR 116
           KE+KMK+L++KVRKLE    ++E E   LR Q++SL+ ELKKYR
Sbjct: 37  KEKKMKELQEKVRKLENINEKNEIETVFLRTQLLSLVNELKKYR 80

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 40/75 (53%)

Query: 42  GNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREVQSL 101
            NK  +  +D E                   KE+KMK+LE+KV  LE    ++E E + L
Sbjct: 31  SNKIRKNDIDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETEFL 90

Query: 102 RNQVVSLLRELKKYR 116
           R+QV++L+ ELKKYR
Sbjct: 91  RSQVLTLVNELKKYR 105

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 48/99 (48%), Gaps = 2/99 (2%)

Query: 44  KPGRKPL-DTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREVQSLR 102
           K GRK L D++                   KERK+K+LEDKV  LE+     E E   LR
Sbjct: 29  KVGRKLLNDSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNFLR 88

Query: 103 NQVVSLLRELKKYRPG-SPVLQEPEPTGDEEIQGKFGLN 140
           +++ S+  ELKKYRP  S  L+  E    +E   K+  N
Sbjct: 89  SRLKSMADELKKYRPAQSSDLEVLEYLAKKEQLAKYNHN 127

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 32  VFEGGGSRRKGNKPGR-KPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQ 90
           V  GG  +   ++  R + LD E                   KERKMK+LE KV  LE  
Sbjct: 4   VDNGGAQKSSASRKKRYQELDPETRMKRVAQNRAAQKAFRERKERKMKELERKVVDLENL 63

Query: 91  RLQSEREVQSLRNQVVSLLRELKKYRP 117
              +E E   LR+Q+  L++EL+KYRP
Sbjct: 64  TKLNEVETNFLRDQLSILVKELRKYRP 90

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%)

Query: 39  RRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSEREV 98
           +R+  +PGRK LD +                   KE K+K LE++V KL+ + L     +
Sbjct: 6   KRRVGRPGRKKLDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAEII 65

Query: 99  QSLRNQVVSLLRELKKYR 116
           + L+  V++LL E+K YR
Sbjct: 66  EFLKQNVMTLLGEIKNYR 83

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%)

Query: 31  LVFEGGGSRRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQ 90
           L+ + G  +RK  +PGRK +D+E                   KE KMK L+++V  LE++
Sbjct: 22  LLNKDGTPKRKVGRPGRKRIDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVELLEQK 81

Query: 91  RLQSEREVQSLRNQVVSLLRELKKYR 116
             Q++     L   + SLL E+ KYR
Sbjct: 82  DAQNKTTTDFLLCSLKSLLSEITKYR 107

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (65%)

Query: 77  MKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYRP 117
           MK+LEDK+  LE+ + ++  E   LR+ +  L+ E+ K+RP
Sbjct: 1   MKELEDKISSLEKIKDENSIETSFLRSYMTDLINEVNKFRP 41

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%)

Query: 38  SRRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQRLQSERE 97
           S+    K GRK +DTE                   KE K++ LE+ +  L+    +   E
Sbjct: 5   SKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSE 64

Query: 98  VQSLRNQVVSLLRELKKYRPGS 119
            + L+  +  LL E+ KYRP +
Sbjct: 65  TEYLKECLSELLTEVTKYRPAN 86

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%)

Query: 73  KERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKK 114
           KE+KMK LE+KV +LE+     E E   LR+Q++    EL+K
Sbjct: 51  KEKKMKSLEEKVVELEKVCRAHESETSFLRSQLILFGTELRK 92

>TBLA0A06440 Chr1 complement(1580326..1585398) [5073 bp, 1690 aa] {ON}
            Anc_5.453 YDR379W
          Length = 1690

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 25/37 (67%)

Query: 80   LEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYR 116
            L+ +VR+L+E + Q +RE+  LRN+  SL+ E+   R
Sbjct: 1268 LKSEVRELQEMKFQLKREIDLLRNERNSLVSEINSLR 1304

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 33.5 bits (75), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 31  LVFEGGGSRRKGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMKDLEDKVRKLEEQ 90
           L  + G  +RK  +PGRK +D+E                   KE ++K L +++  LE++
Sbjct: 6   LANKDGIPKRKVGRPGRKRVDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIELLEQK 65

Query: 91  RLQSEREVQSLRNQVVSLLRELKKYR 116
             Q++  +  L++ + SLL E+ KYR
Sbjct: 66  DAQNKSVIDFLQSSLKSLLSEVTKYR 91

>KNAG0C06210 Chr3 complement(1205132..1206274) [1143 bp, 380 aa]
           {ON} Anc_5.619 YOR028C
          Length = 380

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 3/44 (6%)

Query: 73  KERKMKDLEDKVRKLEEQRLQSE---REVQSLRNQVVSLLRELK 113
           KE+ M+ LEDK  K E+   + E   RE+ +LRN++  L ++L+
Sbjct: 322 KEKYMRLLEDKAMKYEQLYREHEALQREILNLRNRIYQLEQQLR 365

>Kpol_440.2 s440 (2833..3288,3290..5791) [2958 bp, 985 aa] {ON}
           (2833..3288,3290..5791) [2958 nt, 986 aa]
          Length = 985

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 36/56 (64%), Gaps = 6/56 (10%)

Query: 74  ERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYRPGSPVLQEPEPTG 129
           E ++K L+ ++++LEE +LQ  ++V+SL++   +LL + +      PV+ E  P+G
Sbjct: 606 EFRLKKLQLQIKELEETKLQLRKDVESLQSAKDNLLSDTR------PVIHEGLPSG 655

>KNAG0A06790 Chr1 complement(1059841..1060767) [927 bp, 308 aa] {ON}
           Anc_2.493 YHL009C
          Length = 308

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 8/55 (14%)

Query: 73  KERKMKDLEDKVRKLEEQRLQSEREVQSLRN---QVVSLLREL-----KKYRPGS 119
           KE +MKDLE K+R+ E  R +  REV+ LR    Q+ +  R L     KK R G+
Sbjct: 158 KEARMKDLEYKLRESELHREKLYREVEELRRANFQIQTTNRHLLQQCEKKQREGA 212

>CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112w
          Length = 1110

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 28/38 (73%), Gaps = 3/38 (7%)

Query: 78  KDLEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKKY 115
           + LED+ RK+EE++++ ++E+++L+ Q      +LKKY
Sbjct: 63  RKLEDERRKVEEEKIRKQQEIEALKKQHEE---QLKKY 97

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,076,495
Number of extensions: 1394932
Number of successful extensions: 6315
Number of sequences better than 10.0: 79
Number of HSP's gapped: 6419
Number of HSP's successfully gapped: 79
Length of query: 426
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 314
Effective length of database: 40,638,807
Effective search space: 12760585398
Effective search space used: 12760585398
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)