Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40615.526ON66366334880.0
KLTH0G03740g5.526ON6316345341e-58
Kwal_47.186465.526ON6354384734e-50
ZYRO0D12540g5.526ON5484444315e-45
SAKL0G04906g5.526ON6083713744e-37
ADR198C5.526ON5494203024e-28
Kpol_1023.995.526ON551902848e-26
TDEL0A039005.526ON671892832e-25
NCAS0H025505.526ON743902823e-25
NDAI0C010705.526ON757902771e-24
CAGL0K07271g5.526ON776892709e-24
Suva_13.1565.526ON772892709e-24
TBLA0D016605.526ON8661072691e-23
Smik_13.1455.526ON774892672e-23
YML006C (GIS4)5.526ON7741142663e-23
Skud_13.1485.526ON779892654e-23
KLLA0A01782g5.526ON528782464e-21
KNAG0B037105.526ON711952209e-18
NCAS0F010805.526ON3794302079e-17
NDAI0H015905.526ON371891936e-15
KAFR0C053905.526ON455911938e-15
TPHA0K005405.526ON675891932e-14
KNAG0C032405.526ON324731152e-05
TBLA0G009405.526ON78295830.22
SAKL0H11616g8.483ON36691751.5
AFL182C6.301ON12771702.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4061
         (663 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...  1348   0.0  
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   210   1e-58
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   186   4e-50
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   170   5e-45
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   148   4e-37
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...   120   4e-28
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...   114   8e-26
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...   113   2e-25
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...   113   3e-25
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...   111   1e-24
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...   108   9e-24
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...   108   9e-24
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...   108   1e-23
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...   107   2e-23
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...   107   3e-23
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...   106   4e-23
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...    99   4e-21
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...    89   9e-18
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    84   9e-17
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               79   6e-15
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...    79   8e-15
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    79   2e-14
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      49   2e-05
TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...    37   0.22 
SAKL0H11616g Chr8 (992829..993929) [1101 bp, 366 aa] {ON} simila...    33   1.5  
AFL182C Chr6 complement(99493..99876) [384 bp, 127 aa] {ON} Synt...    32   2.6  

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score = 1348 bits (3488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/663 (98%), Positives = 651/663 (98%)

Query: 1   MVENSGCLLDDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNRVL 60
           MVENSGCLLDDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNRVL
Sbjct: 1   MVENSGCLLDDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNRVL 60

Query: 61  LVSVPDDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDTKGGVA 120
           LVSVPDDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDTKGGVA
Sbjct: 61  LVSVPDDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDTKGGVA 120

Query: 121 GVGLTANRPVESFGSHFQRQDQCDNEFSFGHSNASLEETLNVSLCANTGLENVAGISTQL 180
           GVGLTANRPVESFGSHFQRQDQCDNEFSFGHSNASLEETLNVSLCANTGLENVAGISTQL
Sbjct: 121 GVGLTANRPVESFGSHFQRQDQCDNEFSFGHSNASLEETLNVSLCANTGLENVAGISTQL 180

Query: 181 KGIGFDPVSNDISYMQQNIDVDRREHTLDGGGVGDTEVASEKPRNGERFTTSFKANSLTA 240
           KGIGFDPVSNDISYMQQNIDVDRREHTLDGGGVGDTEVASEKPRNGERFTTSFKANSLTA
Sbjct: 181 KGIGFDPVSNDISYMQQNIDVDRREHTLDGGGVGDTEVASEKPRNGERFTTSFKANSLTA 240

Query: 241 VDNSKLFTFGLSSSAISTCKNSEEVSIRSSESYQSYDGEVLARTLTREEHIQGSCCPTEH 300
           VDNSKLFTFGLSSSAISTCKNSEEVSIRSSESYQSYDGEVLARTLTREEHIQGSCCPTEH
Sbjct: 241 VDNSKLFTFGLSSSAISTCKNSEEVSIRSSESYQSYDGEVLARTLTREEHIQGSCCPTEH 300

Query: 301 RHEELYNEGDSTSELXXXXXXXXXXXXIFPSISISGDEGDFRIVLQSILIYNTTLDQLLT 360
           RHEELYNEGDSTSEL            IFPSISISGDEGDFRIVLQSILIYNTTLDQLLT
Sbjct: 301 RHEELYNEGDSTSELSSACNSVSSDCSIFPSISISGDEGDFRIVLQSILIYNTTLDQLLT 360

Query: 361 AVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAIPCNN 420
           AVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAIPCNN
Sbjct: 361 AVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAIPCNN 420

Query: 421 TASKEANSCAEIGKKNASNISNWIYSCISQNTLSQQATTADSAFVFGGPRHYRWHSSERE 480
           TASKEANSCAEIGKKNASNISNWIYSCISQNTLSQQATTADSAFVFGGPRHYRWHSSERE
Sbjct: 421 TASKEANSCAEIGKKNASNISNWIYSCISQNTLSQQATTADSAFVFGGPRHYRWHSSERE 480

Query: 481 EHEPLAGDGDSVHREGNRASPLTSGAEIVTNNIPMLSTLPVHSKAFSRTGSVSEPTKTRV 540
           EHEPLAGDGDSVHREGNRASPLTSGAEIVTNNIPMLSTLPVHSKAFSRTGSVSEPTKTRV
Sbjct: 481 EHEPLAGDGDSVHREGNRASPLTSGAEIVTNNIPMLSTLPVHSKAFSRTGSVSEPTKTRV 540

Query: 541 NSNREIHKCESHSSITESRRKLSDDNEDMFRSKYIISKNPSKNGLTKISSLGSLSLAHRE 600
           NSNREIHKCESHSSITESRRKLSDDNEDMFRSKYIISKNPSKNGLTKISSLGSLSLAHRE
Sbjct: 541 NSNREIHKCESHSSITESRRKLSDDNEDMFRSKYIISKNPSKNGLTKISSLGSLSLAHRE 600

Query: 601 RMFSCSLPGMLHTVFNGTYASDEHPLAVPRKKVRMPSWRRLHKQSCGKQSCGKRQGFVCC 660
           RMFSCSLPGMLHTVFNGTYASDEHPLAVPRKKVRMPSWRRLHKQSCGKQSCGKRQGFVCC
Sbjct: 601 RMFSCSLPGMLHTVFNGTYASDEHPLAVPRKKVRMPSWRRLHKQSCGKQSCGKRQGFVCC 660

Query: 661 AVM 663
           AVM
Sbjct: 661 AVM 663

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  210 bits (534), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 203/634 (32%), Positives = 290/634 (45%), Gaps = 76/634 (11%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKE-YSGGTMSASNRVLLVSVPDDI 68
           +D NGLWSWYL NLR G FEEL+++ +K  L++R + E     ++  + ++LLVS+PD I
Sbjct: 14  NDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFNKKLLLVSIPDAI 73

Query: 69  RQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDTKGGVAGVGLTANR 128
            +  ++LE FLR     + +++   I KLT  +   N E+HYLI+D+           ++
Sbjct: 74  HENTNLLENFLRDYF-NLDDLQFIQIQKLTQDR-CYNHENHYLISDSLSNFN------DK 125

Query: 129 PVESFGSHFQRQDQCDNEFSFGHSNASLEETLNVSLCANTGLENVAGISTQLKGIGFDPV 188
               FG+   R+ + D E   G  + +    ++    A+  L   A IS++       P 
Sbjct: 126 SFLEFGAK-SRRPRDDTEI-LGQDSNNQYSIISGETEADPALP--AAISSE------SPA 175

Query: 189 SNDISYMQQNIDVDRREHTLDGGG--VGDTEVAS---EKPRNGERFTTSFKANSLTAVDN 243
           S  +S + Q  DV  R H        V + E AS   E           F+   +     
Sbjct: 176 SVHLSKVVQE-DVPLRTHNSSSRLLIVDNQECASSTDESDDASTELVLKFEHRGMLGKQR 234

Query: 244 SKLFTFGLSSSAISTCKNSEEVSIRSSESYQSYDGEVLARTLTREEHIQGSCCPTEHRHE 303
                  ++S+  +    S  VS+RS +   SYDGEVL +T+TR+E              
Sbjct: 235 LHPEVRKMASTEEAIDTPSTGVSLRSDD-VSSYDGEVLTQTITRDEDSVS---------- 283

Query: 304 ELYNEGDSTSELXXXXXX-------------XXXXXXIFPSISISGDEGDFRIVLQSILI 350
            L  E DS SEL                         IFPSISIS   G FR+VLQSIL+
Sbjct: 284 -LMIEDDSISELSSVDHSLKSLSYDSEYSQGSSSLTSIFPSISISEKFGRFRLVLQSILV 342

Query: 351 YNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPKILF 410
           +     QL TAVRQSNND TVA +NDDWLLYD++FSMNN+Q+++L D+ EMN  FPKILF
Sbjct: 343 HQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILF 402

Query: 411 YSVVAIPCNNTASKEANSCAEIGKKNASNISNWIYSCISQNTLSQQATTADSAFVFGGPR 470
           YS+V I     A  +    ++  K      SN   S IS+NTL  Q T   S        
Sbjct: 403 YSLVMISEEVAADAQDYYPSKPSKSPQPTASN---STISENTLKVQPTLTHS---LTNTN 456

Query: 471 HYRWHSSEREEHEPLAGDGDSVHREGNRASPLTSGAEIVTNNIPMLSTLPVHSKAFSRTG 530
            Y    +      P        H +G                +P+ S         +RT 
Sbjct: 457 SYLSTGAYNSSLSPFYSSVQHNHEQGEEDDYYDDDKNSEGVVVPLYSA--------TRTN 508

Query: 531 SVSEPTKTRVNSNREIHKCESHSSITESRRKLSDDN---EDMFRS-----KYIISKNPSK 582
           S        + + + I     H     S RKLS ++   ED ++S       + SK+  K
Sbjct: 509 SNKSTAHRSIRTIKSIGDWAFHHD--SSSRKLSPNDSTLEDSYQSVEGNLMKVRSKSSVK 566

Query: 583 NGLTKISSLGSLSLAHRERMFSCSLPGMLHTVFN 616
           +GLTK  +LGSLS   R +  S  LP +L ++ N
Sbjct: 567 SGLTKTLTLGSLSTVERSK--SVPLPSVLKSLSN 598

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  186 bits (473), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 156/438 (35%), Positives = 214/438 (48%), Gaps = 52/438 (11%)

Query: 1   MVENSGCLLD----DCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKE-YSGGTMSA 55
           M ENS  + D    D NGLWSWYL NLR G FEEL+++ +K  L++R + E     T+  
Sbjct: 1   MPENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPF 60

Query: 56  SNRVLLVSVPDDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDT 115
           + ++LLVS+PD I +  ++LE FLR     + +++   I KLT  K   N E+HYLI D 
Sbjct: 61  NKKLLLVSIPDAIHENTNLLENFLRDYF-HLDDLQYIQIRKLTQEK-CYNHENHYLICDN 118

Query: 116 KGGVAGVGLTANRPVESFGSHFQRQDQCD-NEFSFGHSNASLEETLNVSLCANTGLENVA 174
                      ++    FG   +R   C+ NE S   SN         S+ +     +V 
Sbjct: 119 LSNF------NDKSFLEFG--IKRVGACNGNELSGETSNN------QYSIISGETSTDVT 164

Query: 175 GISTQL----------KGIGFDPVSNDISYMQQNIDVDRREHTLDGGGVGDTE---VASE 221
             S ++          K    DP     S   +++ ++            DTE   V   
Sbjct: 165 KSSLEIPLSPEFIRDSKVTQEDPALQTQSTSSRSLRIENSGSLNSSDESDDTESEIVLRF 224

Query: 222 KPRNGERFTTSFKANSLTAVDNSKLFTFGLSSSAISTCKNSEEVSIRSSESYQSYDGEVL 281
           KPR      T  K    + V  S L    + + +      SE+VS        SYDGE L
Sbjct: 225 KPRG-----TVGKRQLYSEVKRSPLANDYIDTPSTGMSLRSEDVS--------SYDGEEL 271

Query: 282 ARTLTREEHIQGSCCPTEHRHEELYNEGDSTSELXXXXX---XXXXXXXIFPSISISGDE 338
           A   +R+E    S    E    EL +   S + L               IFPSISIS   
Sbjct: 272 AHIASRDED-SASLSADEDNISELSSVDHSLNSLSYDSECTPGSSSMTSIFPSISISEKF 330

Query: 339 GDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDI 398
           G FR+VLQSILI  T   QL TAVRQSNND TVA +NDDWLLYD++FSMNN+Q+++L D+
Sbjct: 331 GRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDV 390

Query: 399 FEMNGVFPKILFYSVVAI 416
            E+N  FPK+LFYS++ +
Sbjct: 391 LEINKFFPKVLFYSLIVV 408

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  170 bits (431), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 133/444 (29%), Positives = 211/444 (47%), Gaps = 57/444 (12%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMS--ASNRVLLVSVPDD 67
           +D NGLWSWYL N+R G+FEEL+ + +K  L KR ++ Y   T++     +VL+VS+P+D
Sbjct: 13  NDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERKDTKVLIVSIPED 72

Query: 68  IRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDTKGGVAGVGLTAN 127
           +R+  ++LE FL   L     + +  ITKLT  + + N E+HY++ D +           
Sbjct: 73  VRRDITLLEYFLGDYL----NLDNMEITKLTTSR-IYNHENHYVVMDKENNFKNSNFL-- 125

Query: 128 RPVESFGSHFQRQD-QCDNEFSFG---------HSNASLEETLNVSLCANTGLENVAGIS 177
                   HF   + Q    F+ G          +  ++  T +    A  GLE      
Sbjct: 126 --------HFASTNIQTGKGFTGGELAGTTVAAQAEKNISPTESAKFRAGQGLEPSDDTE 177

Query: 178 TQLKGIGFDPVSNDISYMQQNIDVDRREHTLDGGGVGDTEVASEKPRNGERFTTSFKANS 237
              + + F+    D  ++   +  + +E   +  GV      S  P+  +R      +N 
Sbjct: 178 GDEESLVFNFTHRD-HHLTHPLRANGKEQE-EAVGVS----PSWNPQQQQRLQEHNASND 231

Query: 238 LTAVDNSKLFTFGLSSSAISTCKNSEEVSIRSSESYQSYDGEVLARTLTREEHIQGSCCP 297
             A  +S  +  G +SS +                 +S+ GE L  T+TR E    S   
Sbjct: 232 EMASIDS--YNLGSNSSRV----------------VESFKGEPLTLTMTRTEDFSSSDEY 273

Query: 298 TEHRHEELYNEGDSTSELXXXXXXXXXXXXIFPSISISGDEGDFRIVLQSILIYNTTLDQ 357
                    ++ D +S              I PSISI+   G FR+VLQS+L  N T ++
Sbjct: 274 DSLASSPSSSDTDLSS------FESCSLMSILPSISIADSFGHFRLVLQSVLFINPTSNE 327

Query: 358 LLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAIP 417
           + TA+RQSNN  T AD++DDWLLYD +FSM+N+QM++L D+ E+N   PK+LFYS+V + 
Sbjct: 328 IFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVV 387

Query: 418 CNNTASKEANSCAEIGKKNASNIS 441
              +       CA I    ++++S
Sbjct: 388 DTPSLEDADTECATISNTASTSLS 411

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  148 bits (374), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 130/371 (35%), Positives = 174/371 (46%), Gaps = 49/371 (13%)

Query: 262 SEEVSIRSSESYQSYDGEVLARTLTREEHIQGS---------CCPTEHRHEELYNEGDST 312
           SE+VSI +SE   SYDGE L +T+TR+E    +             +H    L    D +
Sbjct: 232 SEDVSI-NSEDASSYDGEALIQTITRDEDASSADEDNSNISELSSVDHSLNSLSYNSDIS 290

Query: 313 SELXXXXXXXXXXXXIFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVA 372
           S+             IFP+ISIS   G FR+VLQSILI N    ++ TAVRQSNND  VA
Sbjct: 291 SD-------DYSMASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVA 343

Query: 373 DINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAIPCNNTASKEANSCAEI 432
            INDDWLLYDE+FSM+N+QM+SL D+ E+N  FPKILFY++V +     A +        
Sbjct: 344 HINDDWLLYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPND 403

Query: 433 GKKNASNISNWIYSCISQNTLSQQATTADSAFVFGGPRHYRW------HSSEREEHEPLA 486
                 +      S +SQNTL +   TA S   +   RH          + + E + P  
Sbjct: 404 PHLPPPSQGIASTSTLSQNTL-RLLPTATSNVTYT--RHNELLNAAATSAQDAENYFPED 460

Query: 487 GDGDSVHREGNRASPLTSGAEIVTNNIPMLSTLPVHSKAFSRTGSVSEPTKTRVNSNRE- 545
              D   +E N   PL +               P  + + S T   S  T   VNS  E 
Sbjct: 461 NHDDEDDQEVNGVMPLYA---------------PTRTNSNSTTAHRSILT---VNSIGEW 502

Query: 546 -IHKCESHSSITESRRKLSDDNEDMF-RSKYIISKNPSKNGLTKISSLGSLSLAHRERMF 603
             H  E +     S    +D N     + K + SK  SKN L K +++GSLS   R +  
Sbjct: 503 AFHHNEPYPQNNHSNISFADQNTSTAGKMKRVSSKGSSKNTLQKTTTVGSLSAVERSK-- 560

Query: 604 SCSLPGMLHTV 614
           S  LP +L T+
Sbjct: 561 STPLPTLLRTL 571

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 72/106 (67%), Gaps = 3/106 (2%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASN-RVLLVSVPDDI 68
           +D NGLWSWYL NLR G FEEL+++++K  L+KR + E+    +   N ++LLVS+PD+I
Sbjct: 13  NDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNKKMLLVSIPDNI 72

Query: 69  RQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114
            Q  +ILE FLRS    + +++   I KLT  + + N E+HYLI+D
Sbjct: 73  HQDITILENFLRSYF-HLDDLQYIQIKKLTDSQ-IYNHENHYLISD 116

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score =  120 bits (302), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 121/420 (28%), Positives = 195/420 (46%), Gaps = 66/420 (15%)

Query: 263 EEVSIRSSESYQSYDGEVLARTLTREEHIQG-SCCPTEHR-HEELYNEGDSTSELXXXXX 320
           +++SIRS+ES +S+ G+ L R LT E   Q   C  TE R   E Y++  S S+      
Sbjct: 177 DDMSIRSNESCESFSGQELVRVLTHEGDSQEYQCDSTETRIFRESYSDISSLSQFSNHS- 235

Query: 321 XXXXXXXIFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLL 380
                  +FPS+SI+ D   FR+VLQSIL+Y+   D++ TAVRQ NN+  +A+ +DD LL
Sbjct: 236 -------VFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLL 288

Query: 381 YDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAIPCNNTASKEANSCAEIGKK----- 435
           YD + S+   +++SL+D+ E+N   PK+LFYSV  I  ++     A  CA++        
Sbjct: 289 YDNKISLITFRILSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHSQPQLL 348

Query: 436 -----NASNIS----NWIYSCISQNTLSQQATT--ADSAFVFGGPRHYRWHSSEREEHEP 484
                +AS +S      + +  S NT+ +   T  AD   +   P  + W  S   ++  
Sbjct: 349 QRNSFSASTLSRHSLRLLPTVTSANTIERHVRTDVADKGKIPNSPA-FCWQKS--VDYTE 405

Query: 485 LAGDGDSVHREGNRASPLTSGAEIVTNNIPMLSTLPVHSKAFSRTGSVSEPTKTRVNSNR 544
              D       G   +P  S     +   P    LP  SKA +            +  +R
Sbjct: 406 YYQDQLFTRELGLAHNPSYSSRSSNSEQ-PSERLLPTDSKAVN-----------PIQLSR 453

Query: 545 EIHKCESHSSITESRRKLSDDNEDMFRSKYIISKNPSKNGLTKISSLGSLSLAHRERMFS 604
            +      + +  S  + S D +   R+  + +K  S++GL KIS+ GS S A   ++ +
Sbjct: 454 HV------TPVIFSSIQASADVDFEMRAS-VATKASSRSGLDKISTRGSFSTA--RQINT 504

Query: 605 CSLPGMLHTVFNGTYASDEHPLAVPR-KKVRMPSWRRLHKQSCGKQSCGKRQGFVCCAVM 663
            +LP +LH++ +  Y      L+ P+  K     W+R              QG + C +M
Sbjct: 505 DTLPTLLHSISHRKYG-----LSKPQIGKTLKHKWQRW----------SSSQGHMTCLIM 549

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (47%), Gaps = 13/126 (10%)

Query: 8   LLDDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNRVLLVSVPDD 67
           +L D +GLWSWYL NLR G FE+L  D  +   +K  +++    +     R+ L+S P  
Sbjct: 1   MLQDYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERRLQLLSFPAS 60

Query: 68  IRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLI--NDTKGGVAG--VG 123
           +     ILEEF+R         + GNI+    R      E HYL+  N     + G  + 
Sbjct: 61  VPCDYKILEEFIR---------QQGNISVAIPRVHATGTEKHYLVDGNYMVHALEGCNLA 111

Query: 124 LTANRP 129
           LT N P
Sbjct: 112 LTENEP 117

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score =  114 bits (284), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 72/90 (80%)

Query: 328 IFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSM 387
           + P++++     +F++VLQSILIYN+  D+L+TA+RQSNN+   ADI+DDWLLYD +FSM
Sbjct: 247 VLPTVNLPDPYANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFSM 306

Query: 388 NNIQMVSLIDIFEMNGVFPKILFYSVVAIP 417
            N+Q++SL ++  +N  +PKILFYS+V+IP
Sbjct: 307 TNLQILSLNELLHINKDYPKILFYSLVSIP 336

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 69/89 (77%)

Query: 328 IFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSM 387
           I PSISIS   G +R+V+QS L+ +    ++ TA+RQSNN  TVAD++DDWLLYD +FSM
Sbjct: 386 ILPSISISDARGHYRLVMQSSLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSM 445

Query: 388 NNIQMVSLIDIFEMNGVFPKILFYSVVAI 416
           NN+QM++L ++ +MN  FPKI+FYS++ +
Sbjct: 446 NNLQMLTLQELLDMNRSFPKIIFYSMIVV 474

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 64/108 (59%), Gaps = 5/108 (4%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMS---ASNRVLLVSVPD 66
           +D NGLWSWYL ++R G+FEE S + +K  L++R +  +     S    + ++L VS+PD
Sbjct: 13  NDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHFDSNRSHYGQNTKILFVSIPD 72

Query: 67  DIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114
            + +  S+LE FLR     +  +    ITKLT +  + N E+HY++ D
Sbjct: 73  KVHRDLSLLENFLRDYF-HLEHLEHIEITKLT-QSPVYNHENHYILID 118

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score =  113 bits (282), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/90 (58%), Positives = 70/90 (77%), Gaps = 1/90 (1%)

Query: 328 IFPSISIS-GDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFS 386
           I PSISIS   EG FR+VLQSILI +    ++ TA+RQSNN+ T+ADI DDWLLYD +FS
Sbjct: 422 ILPSISISDAIEGHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDSQFS 481

Query: 387 MNNIQMVSLIDIFEMNGVFPKILFYSVVAI 416
           M+N+Q+++L D+ + N  FPKILFYS+V +
Sbjct: 482 MDNLQILTLQDLLDTNRSFPKILFYSMVIV 511

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 68/132 (51%), Gaps = 28/132 (21%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKE--YSGGTMSASN---------- 57
           +D NGLWSWYL N+R G+FEE++ + +K  L+KR +    YS   ++A+           
Sbjct: 13  NDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTATESPQQHNNNNN 72

Query: 58  --------------RVLLVSVPDDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDL 103
                         ++LLVS+PD + +  SILE FLR     +  +    I +LT  K  
Sbjct: 73  TNNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYF-HLEHLEGIQIQRLTQSK-C 130

Query: 104 LNGEDHYLINDT 115
            N E+HYL+ DT
Sbjct: 131 YNHENHYLLTDT 142

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score =  111 bits (277), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 328 IFPSISISG-DEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFS 386
           I PSISIS  +EG FR+VLQS LI N    ++ TA+RQSNN+ T+A I DDWLLYD +F+
Sbjct: 461 ILPSISISDRNEGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFA 520

Query: 387 MNNIQMVSLIDIFEMNGVFPKILFYSVVAI 416
           M+N+Q+++L D+ + N  FPKILFYS+V +
Sbjct: 521 MDNLQILTLQDLLDSNRTFPKILFYSMVIV 550

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 69/125 (55%), Gaps = 22/125 (17%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKE--YSGGTMSAS----------- 56
           +D NGLWSWYL N+R G+FEEL+ + +K  L+KR +    YS  T + +           
Sbjct: 13  NDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTDTAIDDNNNTNSV 72

Query: 57  -------NRVLLVSVPDDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDH 109
                   ++LLVS+PD +    S+LE FLR     + ++ +  ITKLT + +  N E+H
Sbjct: 73  NDIKPTVKKILLVSIPDKVHSDISLLELFLRDYF-HLEDLENIQITKLT-QSECYNHENH 130

Query: 110 YLIND 114
           YL+ D
Sbjct: 131 YLLTD 135

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score =  108 bits (270), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%)

Query: 328 IFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSM 387
           I PSISI    G FR+VLQSILI +    ++ TAVRQSNN  T+ADI DDWLLYD  FSM
Sbjct: 454 ILPSISIFDTLGYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSM 513

Query: 388 NNIQMVSLIDIFEMNGVFPKILFYSVVAI 416
           +N+Q+++L DI  +   +PKILFY++V I
Sbjct: 514 HNLQILTLQDIMTIKKDYPKILFYTMVVI 542

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 65/112 (58%), Gaps = 9/112 (8%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSA-------SNRVLLV 62
           +D NG+WSWYL NLR G+FEE+  + +K  L+KR +     G  S        + +++ V
Sbjct: 13  NDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLGNFSPESPTRFINKKLIFV 72

Query: 63  SVPDDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114
           S+P+D+ Q  SILE FLR     ++ + +  I KLT  K + + E+HY + D
Sbjct: 73  SIPEDVHQDISILELFLRDYF-HLKVLDNNQIHKLTQDK-VYHHENHYFLMD 122

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score =  108 bits (270), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%)

Query: 328 IFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSM 387
           I PSISI    G FR+VLQSILI N    ++ TA+RQSNN+ TVA + DDWLLYD  FSM
Sbjct: 435 ILPSISICDSLGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSM 494

Query: 388 NNIQMVSLIDIFEMNGVFPKILFYSVVAI 416
           NN+Q+++L D+ ++   FPKIL Y++V +
Sbjct: 495 NNLQILTLQDLLDIKRSFPKILLYTMVIV 523

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 67/109 (61%), Gaps = 6/109 (5%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGG----TMSASNRVLLVSVP 65
           +D NGLWSWYL NLR G+FEEL  + +K  L+KR +  +  G    ++  + ++LLVS+P
Sbjct: 13  NDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIRPNKKILLVSIP 72

Query: 66  DDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114
           +++ +  SILE FL+     + ++    I+KLT      N E+HYL+ D
Sbjct: 73  ENVHEDISILEIFLKDYF-HLEKLEHIQISKLT-HSHCYNHENHYLLTD 119

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score =  108 bits (269), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 78/107 (72%)

Query: 328 IFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSM 387
           I PSISIS   G FR+VLQ ILIY+   ++  TA+RQS+++  VADI DDWLLYD +FSM
Sbjct: 499 ILPSISISDSLGHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSM 558

Query: 388 NNIQMVSLIDIFEMNGVFPKILFYSVVAIPCNNTASKEANSCAEIGK 434
           +N+++++L ++ + N  +PKILFY++VAI  N++  +   + +EI +
Sbjct: 559 DNLEILTLQELLDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINE 605

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 66/112 (58%), Gaps = 9/112 (8%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASN-------RVLLV 62
           +D NGLWSWYL N+R G FEEL+ +I+K  L+KR +KE     +++++       ++L  
Sbjct: 17  NDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHSTNCTKILFT 76

Query: 63  SVPDDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114
           S+PD+I Q   ILE  L+     +  + +  I KLT  +   N E+HY++ D
Sbjct: 77  SIPDNIHQDLPILENLLKDYF-DLDNLDNIQILKLTQNR-CYNHENHYILKD 126

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score =  107 bits (267), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 65/89 (73%)

Query: 328 IFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSM 387
           I PSISI    G FR+VLQSILI +    ++ TA+RQSNN  T+A + DDWLLYD  FSM
Sbjct: 439 ILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSM 498

Query: 388 NNIQMVSLIDIFEMNGVFPKILFYSVVAI 416
           NN+Q+++L D+ ++   FPKILFY++V +
Sbjct: 499 NNLQILTLQDLLDIKRSFPKILFYTMVIV 527

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 66/109 (60%), Gaps = 6/109 (5%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNR----VLLVSVP 65
           +D NGLWSWYL NLR G+FEEL  + +K  L+KR +  +  G  S S R    +LLVS+P
Sbjct: 13  NDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILLVSIP 72

Query: 66  DDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114
           +++ +  SILE FL+     + ++    I+KLT      N E+HYL+ D
Sbjct: 73  ENVHEDISILEIFLKDYF-HLEKLEHIQISKLT-HSHCYNHENHYLLTD 119

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score =  107 bits (266), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 74/114 (64%), Gaps = 7/114 (6%)

Query: 303 EELYNEGDSTSELXXXXXXXXXXXXIFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAV 362
           EE+Y++ D +S              I PSISI    G FR+VLQSILI +    ++ TA+
Sbjct: 418 EEVYDDEDLSS-------SDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAI 470

Query: 363 RQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAI 416
           RQSNN  T+A + DDWLLYD  FSMNN+Q+++L D+ ++   FPKILFY++V +
Sbjct: 471 RQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIV 524

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 67/109 (61%), Gaps = 6/109 (5%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKE--YSGGTMSA--SNRVLLVSVP 65
           +D NGLWSWYL NLR G+FEEL  + +K  L+KR +    Y    +SA  + ++LLVS+P
Sbjct: 13  NDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISARPNKKILLVSIP 72

Query: 66  DDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114
           +++ +  SILE FL+     + ++    I+KLT      N E+HYL+ D
Sbjct: 73  ENVHEDISILEIFLKDYF-HLEKLEHIQISKLT-HSHCYNHENHYLLTD 119

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score =  106 bits (265), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 48/89 (53%), Positives = 65/89 (73%)

Query: 328 IFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSM 387
           I PSISI    G FR+VLQSILI +    ++ TA+RQSNN  T+A + DDWLLYD  FSM
Sbjct: 443 ILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSM 502

Query: 388 NNIQMVSLIDIFEMNGVFPKILFYSVVAI 416
           NN+Q+++L D+ ++   FPKILFY++V +
Sbjct: 503 NNLQILTLQDLLDIKRSFPKILFYTMVIV 531

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 66/109 (60%), Gaps = 6/109 (5%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNR----VLLVSVP 65
           +D NGLWSWYL NLR G+FEEL  + +K  L+KR +  +  G  + S R    +LLVS+P
Sbjct: 13  NDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSARPNKKILLVSIP 72

Query: 66  DDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114
           +++ +  SILE FL+     + ++    I+KLT      N E+HYL+ D
Sbjct: 73  ENVHEDISILEIFLKDYF-HLEKLEHIQISKLT-HSHCYNHENHYLLTD 119

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score = 99.4 bits (246), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%)

Query: 339 GDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDI 398
           G FR+VLQSILI N   +Q+ T +RQS ND + ADINDDWLLYD  F++ N+QM+SL DI
Sbjct: 287 GTFRLVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFNLGNLQMLSLYDI 346

Query: 399 FEMNGVFPKILFYSVVAI 416
            + +   PKILFYS++ +
Sbjct: 347 LDFSKFLPKILFYSMIHV 364

 Score = 89.0 bits (219), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNRVLLVSVPDDIR 69
           +D NGLWSWYL NLR GEFEEL+ + +K  L+KR +++    T   + ++LLVS+PD+I 
Sbjct: 13  NDYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQFQATGPLNKKLLLVSIPDEIH 72

Query: 70  QGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114
           Q   +LEEFL        +  +  I KLT R  +   E+HYLI D
Sbjct: 73  QDIKVLEEFLSEYFHLKDDHTNIVIDKLT-RGTVYKHENHYLIQD 116

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 1/95 (1%)

Query: 328 IFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSM 387
           I PSI+I   EG FR+VLQS+L+       + TA+RQSNN    A + DDW+LYD  FSM
Sbjct: 461 ILPSITIKDTEGHFRLVLQSVLLQRED-KAIFTAIRQSNNKVDRATVQDDWILYDSDFSM 519

Query: 388 NNIQMVSLIDIFEMNGVFPKILFYSVVAIPCNNTA 422
           NN+ M++L  +F  +    KILFYS++ +    TA
Sbjct: 520 NNLMMMTLRGLFNFSENMSKILFYSMIIVDDAETA 554

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNRVLLVSVPDDIR 69
           +D NGLWSWYL N+R G+FEEL+ + +K  L+KR +K +       ++++L +S+PD + 
Sbjct: 13  NDDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHFTSLEGINSKILFISIPDKVH 72

Query: 70  QGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDT 115
              S+LE FL+     + ++++  I KLT   +  N E+HYL+ DT
Sbjct: 73  SDISVLETFLKDYF-HLEDLQNIKIQKLT-TSNCYNHENHYLLTDT 116

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 84.3 bits (207), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 112/430 (26%), Positives = 182/430 (42%), Gaps = 86/430 (20%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVK-EYSGGTMSASNRVLLVSVPDDI 68
           DD + +WSWYL NL+ G FE L +  V+ + ++   K +++ G  +  ++ +L+SVP  +
Sbjct: 11  DDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSG--NEGSKKILLSVPSML 68

Query: 69  RQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDTKGGVAGVGLTANR 128
            Q  SI   FL S     R ++  N+ + + +      + HYL+ D     A  G     
Sbjct: 69  CQEVSIKRLFLGSIFNEER-LQYINVMEFS-KSPKQTEKKHYLLTD-----ALSGFNEAA 121

Query: 129 PVESFGSHFQRQDQCDNEFSFGHSNASLEETLNVSLCANTGLENVAGISTQLKGIGFDP- 187
            +ES             EF+    N   E+++ +      G+E    I+  +  I   P 
Sbjct: 122 FIESM------------EFNQTEEN---EQSVYIE-----GME----INKSISSICLWPQ 157

Query: 188 --VSNDISYMQQNIDVDRREHTLDGGGVGDTEVASEKPRNGERFTTSFKANSLTAVDNSK 245
              + D+ Y   ++D     HT++    G   +A     N                ++SK
Sbjct: 158 EETNMDLFYASNSMD-----HTMENEEEGAIILAFPSLLN----------------NHSK 196

Query: 246 LFTFGLSSSAISTCKNSEEVSIRSSESYQSYDGEVLARTLTREEHIQGSCC-----PTEH 300
           L  +     +  T   SE++SI  SE Y   D  + A +L R   +  +C      P+E 
Sbjct: 197 LHNY----VSHRTPATSEDISI-DSEKYDDVDSYIHAMSLMR---VNANCANQIQSPSEM 248

Query: 301 RHEEL------------YNEGDS--TSELXXXXXXXXXXXXIFPSISISGDEGDFRIVLQ 346
             E +              E DS  T E             I P+ + S   G  R VL 
Sbjct: 249 MDESIDSLTESIISSDEIKEDDSKLTREENLRSASCNFHSNI-PTQTFSYKSGQLRFVLH 307

Query: 347 SILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFP 406
           S+LI N    +  TA+RQ ++D   A+I D+WLLYD +FS++N++M +L DI   N    
Sbjct: 308 SLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDILLSNKGNS 367

Query: 407 KILFYSVVAI 416
            +L Y  + I
Sbjct: 368 MLLLYKTILI 377

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 57/89 (64%)

Query: 328 IFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSM 387
           + PSIS     G  R VLQSI+  +    +LLTA+RQS+ D  VA  +D+WLLYD  FS+
Sbjct: 282 VVPSISCHHPYGQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSL 341

Query: 388 NNIQMVSLIDIFEMNGVFPKILFYSVVAI 416
           NN+++ +L DI   N   P+ILFY++  +
Sbjct: 342 NNLEISTLQDILYPNYENPRILFYTMSVV 370

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 50/122 (40%), Gaps = 9/122 (7%)

Query: 11  DCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKE--YSGGTMSASNRVLLVSVPDDI 68
           D N + SWYL NLR G FE +  D  K   +  ++    +      A+N++ LVS    I
Sbjct: 9   DDNEVLSWYLRNLREGRFENIIEDRAKNYHLNTILDRQLFDNKQYGATNKI-LVSTLTSI 67

Query: 69  RQGASILEEFLRSSLPG--MREVRDGNITKLTGRKDLLNGEDHYLINDTKGGVAGVGLTA 126
            +  SI + FL        ++ +    +  L G     N E HY + D       + L  
Sbjct: 68  DEIVSIKDIFLGQLFDHERLQYIEVEELKSLKGD----NKETHYFLTDHLNSFNDLLLEE 123

Query: 127 NR 128
            R
Sbjct: 124 ER 125

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score = 79.0 bits (193), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 62/91 (68%), Gaps = 2/91 (2%)

Query: 328 IFPSISISGDE-GDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFS 386
           I P +SI+ +  G +R+VLQS+LI N     L T VRQSNN    A+INDDW+LYDE+FS
Sbjct: 252 ILPCVSINNEAIGHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKFS 311

Query: 387 MNNIQMVSLIDIFEMNGVFP-KILFYSVVAI 416
           M N+ ++SL D+  +  V   KILFYS++ +
Sbjct: 312 MRNLNILSLKDLSIIGNVDSIKILFYSMIDV 342

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 65/106 (61%), Gaps = 3/106 (2%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNRVLLVSVPDDIR 69
           +D NGLWSWYL NLR G FEEL ++ +K  L+KR ++           ++LL+S+PD I 
Sbjct: 13  NDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRN-QVDINDQIKKILLISIPDHIF 71

Query: 70  QGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDT 115
              ++LE FL S    + ++ +  I KLT + ++ N E+HYL+ D+
Sbjct: 72  SDINVLEIFL-SDYFHLNDLSNIKIIKLT-KFNVYNHENHYLLIDS 115

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 60/89 (67%)

Query: 328 IFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSM 387
           + PSI +    G+F++VLQS+++ N    +  TAVRQSN+    A  +D+WLLYD +FSM
Sbjct: 326 LLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSM 385

Query: 388 NNIQMVSLIDIFEMNGVFPKILFYSVVAI 416
           +N+++V+L  + ++   F KI FYS+V I
Sbjct: 386 DNLEIVTLNYLMDIYADFVKIFFYSMVII 414

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 59/125 (47%), Gaps = 23/125 (18%)

Query: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEY------------SGGTMSASN 57
           D  + LW+WYL+ +R GEFEEL  +  K R +   ++E                 +S  N
Sbjct: 10  DKYSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGN 69

Query: 58  RVLLVSVPDDIRQGASILEEFLRSSLPG-------MREVRDGNITKLTGRKDLLNGEDHY 110
            +L +S+   + +   I+++FL  + P        +RE+ + NI     +KD    E +Y
Sbjct: 70  -ILFLSLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKD---HETYY 125

Query: 111 LINDT 115
           ++ D+
Sbjct: 126 MVIDS 130

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}
          
          Length = 324

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query: 13 NGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGG--TMSASNRVLLVSVPDDIRQ 70
          N  W WY+ NL  G FEEL+ +++K   +   +  Y GG  T     R+LLV+ P  +R 
Sbjct: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSPYGLRN 77

Query: 71 GASILEEFLRSSL 83
          G+  L+E L   L
Sbjct: 78 GS--LDEHLSKKL 88

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 340 DFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIF 399
           D  I + S+L  +    +L  AVRQ  +D        DW++YD  FS+NN++   L DI 
Sbjct: 256 DLTINVVSLLGKDDASGKLWHAVRQLQDD--------DWVIYDADFSLNNLENCKLEDIL 307

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 44/95 (46%), Gaps = 15/95 (15%)

Query: 337 DEGDFRIVLQSIL---IYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMV 393
           D+ + R+ L  I+   I NT  D   TA+++ N      ++   WL++D  F     Q+V
Sbjct: 559 DQENRRMNLNCIILKKIGNTNGD-FFTAIKEYN------ELYSKWLIFDSTFQTEKSQLV 611

Query: 394 SLIDIFEMNGVFPKILFYSVVAIPCNNTASKEANS 428
           S   + E+   F KI FYS      NNT  K   S
Sbjct: 612 SFDKLLEIAKSFSKIFFYSY-----NNTVVKNETS 641

>SAKL0H11616g Chr8 (992829..993929) [1101 bp, 366 aa] {ON} similar
           to gnl|GLV|KLLA0D11968g Kluyveromyces lactis
           KLLA0D11968g and weakly similar to YDR249C
           uniprot|Q03787 Saccharomyces cerevisiae YDR249C
           Hypothetical ORF
          Length = 366

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 12/91 (13%)

Query: 147 FSFGHSNASLEETLNVSLCANTGLENVAGISTQLKGIGFDPVSNDISYMQQNIDVDRREH 206
           ++  H   ++   L++SL  N+ L+NV  ++  LK +  + VS DIS +           
Sbjct: 250 YNINHLFHAINLVLHISLLPNSRLDNVDPLNHLLKNLYLE-VSPDISNL----------- 297

Query: 207 TLDGGGVGDTEVASEKPRNGERFTTSFKANS 237
            L  G   DT++   K R  E+F   F  +S
Sbjct: 298 LLLDGNEDDTQLNERKARIVEKFIRKFYKDS 328

>AFL182C Chr6 complement(99493..99876) [384 bp, 127 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNR010W
           (CSE2)
          Length = 127

 Score = 31.6 bits (70), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 35/71 (49%)

Query: 574 YIISKNPSKNGLTKISSLGSLSLAHRERMFSCSLPGMLHTVFNGTYASDEHPLAVPRKKV 633
           Y + +  + NG T      + ++ HR ++   ++ G  H V   +   DE P  V +K+ 
Sbjct: 39  YALHQLKNDNGHTNTFETATSNIRHRLKLCKAAIAGDAHAVEMLSRPCDEWPAVVCQKEQ 98

Query: 634 RMPSWRRLHKQ 644
            + + +R+H+Q
Sbjct: 99  EIEAKKRVHRQ 109

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,024,224
Number of extensions: 3063635
Number of successful extensions: 10355
Number of sequences better than 10.0: 62
Number of HSP's gapped: 10794
Number of HSP's successfully gapped: 84
Length of query: 663
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 547
Effective length of database: 40,180,143
Effective search space: 21978538221
Effective search space used: 21978538221
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)