Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40605.524ON2201220193590.0
ADR200C5.524ON233891212671e-141
SAKL0G04862g5.524ON24446037283e-76
TDEL0A038805.524ON16965074777e-47
Suva_2.5975.524ON17976784696e-46
YDR420W (HKR1)5.524ON18026674553e-44
ZYRO0D12496g5.524ON23855314214e-40
Kwal_47.186505.524ON21592574186e-40
KNAG0C032605.524ON15304494042e-38
KLTH0G03696g5.524ON20852673749e-35
Skud_4.6945.524ON15042633551e-32
KLLA0A01826g5.524ON14642783523e-32
Smik_4.6955.524ON15552343382e-30
KAFR0E033205.524ON11904353156e-28
CAGL0F03003g5.524ON11852473032e-26
TPHA0L003605.524ON11615452592e-21
Kpol_363.145.524ON7612502529e-21
KNAG0D035904.150ON9942182539e-21
TDEL0D030104.150ON11231152521e-20
NCAS0A052304.150ON7851312403e-19
TBLA0G012104.150ON18252292396e-19
Smik_7.3024.150ON11892282342e-18
SAKL0H23188g4.150ON1262892314e-18
YGR014W (MSB2)4.150ON13061142306e-18
KLTH0E08844g4.150ON1520872281e-17
NDAI0K025804.150ON9851362262e-17
Kwal_47.177034.150ON15681202226e-17
Suva_7.2964.150ON11351142217e-17
KLLA0C17985g4.150ON908842153e-16
ZYRO0G11242g4.150ON14871732136e-16
Ecym_73494.150ON1129932119e-16
Skud_7.2994.150ON11691142072e-15
TPHA0K013904.150ON826831964e-14
AGR019C4.150ON11052281894e-13
KAFR0F034704.150ON9492401795e-12
TBLA0G009505.524ON22531081591e-09
Kpol_1062.374.150ON9731141572e-09
CAGL0F08833g4.150ON936841392e-07
SAKL0F12958g7.413ON1027126880.27
Skud_7.5975.41ON75175830.81
YGR264C (MES1)5.41ON75175811.6
Smik_16.435.41ON75175765.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4060
         (2201 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...  3609   0.0  
ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...   492   e-141
SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...   285   3e-76
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....   188   7e-47
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...   185   6e-46
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...   179   3e-44
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...   166   4e-40
Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...   165   6e-40
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...   160   2e-38
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   148   9e-35
Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...   141   1e-32
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...   140   3e-32
Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...   134   2e-30
KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...   125   6e-28
CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...   121   2e-26
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...   104   2e-21
Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...   101   9e-21
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...   102   9e-21
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...   101   1e-20
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...    97   3e-19
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....    97   6e-19
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...    95   2e-18
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...    94   4e-18
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...    93   6e-18
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...    92   1e-17
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...    92   2e-17
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...    90   6e-17
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    90   7e-17
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...    87   3e-16
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...    87   6e-16
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...    86   9e-16
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...    84   2e-15
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...    80   4e-14
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...    77   4e-13
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...    74   5e-12
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    66   1e-09
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...    65   2e-09
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...    58   2e-07
SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa...    39   0.27 
Skud_7.597 Chr7 complement(994091..996343) [2253 bp, 751 aa] {ON...    37   0.81 
YGR264C Chr7 complement(1019598..1021853) [2256 bp, 751 aa] {ON}...    36   1.6  
Smik_16.43 Chr16 (75638..77893) [2256 bp, 751 aa] {ON} YGR264C (...    34   5.5  

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score = 3609 bits (9359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1859/2201 (84%), Positives = 1859/2201 (84%)

Query: 1    MRMLGSGFARLLNMDLRGGWXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIADSKMMVYGA 60
            MRMLGSGFARLLNMDLRGGW                            LIADSKMMVYGA
Sbjct: 1    MRMLGSGFARLLNMDLRGGWLVLVLLVFCRCVCGAGEVVLGGGGSPGGLIADSKMMVYGA 60

Query: 61   GVGGVRCPSAGETDMCSLGGVMGLEEVCSDARYSKTVLXXXXXXXXXXXXXXXXXGFDRS 120
            GVGGVRCPSAGETDMCSLGGVMGLEEVCSDARYSKTVL                 GFDRS
Sbjct: 61   GVGGVRCPSAGETDMCSLGGVMGLEEVCSDARYSKTVLSARSNTAAAAARATAASGFDRS 120

Query: 121  PLRRRDSVNMTSLDSPGLPIVDATEVSGTSIGLSVGWLTFSAAFMSITSAPSATVSLEGS 180
            PLRRRDSVNMTSLDSPGLPIVDATEVSGTSIGLSVGWLTFSAAFMSITSAPSATVSLEGS
Sbjct: 121  PLRRRDSVNMTSLDSPGLPIVDATEVSGTSIGLSVGWLTFSAAFMSITSAPSATVSLEGS 180

Query: 181  IGLESSVFDADLSTDGXXXXXXXXXXXXXXXXXXXXLGDVHATASVSGDIYVSGFDSSDH 240
            IGLESSVFDADLSTDG                    LGDVHATASVSGDIYVSGFDSSDH
Sbjct: 181  IGLESSVFDADLSTDGVSLSVTATVAATVAATQSASLGDVHATASVSGDIYVSGFDSSDH 240

Query: 241  LQSTSMSYFVPTLLSPIPSISASVDPFSSMQHSSFSTAVDVKDVTGSRLSSDQISQTAFT 300
            LQSTSMSYFVPTLLSPIPSISASVDPFSSMQHSSFSTAVDVKDVTGSRLSSDQISQTAFT
Sbjct: 241  LQSTSMSYFVPTLLSPIPSISASVDPFSSMQHSSFSTAVDVKDVTGSRLSSDQISQTAFT 300

Query: 301  SPDPLDISMSLGDQENTFTFSIPSGSVADPVPSTSFPSEFVTSQDAPLDLSMISVSTESQ 360
            SPDPLDISMSLGDQENTFTFSIPSGSVADPVPSTSFPSEFVTSQDAPLDLSMISVSTESQ
Sbjct: 301  SPDPLDISMSLGDQENTFTFSIPSGSVADPVPSTSFPSEFVTSQDAPLDLSMISVSTESQ 360

Query: 361  SLLLSAPSMTDVSDYSISATDMTLDRESSVLLTTQASLSYTLSGQDDRSFTISRSLGSIF 420
            SLLLSAPSMTDVSDYSISATDMTLDRESSVLLTTQASLSYTLSGQDDRSFTISRSLGSIF
Sbjct: 361  SLLLSAPSMTDVSDYSISATDMTLDRESSVLLTTQASLSYTLSGQDDRSFTISRSLGSIF 420

Query: 421  SAGGSFSLPNAAGSTMITSEGNPGLSFSIMSRDXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
            SAGGSFSLPNAAGSTMITSEGNPGLSFSIMSRD                           
Sbjct: 421  SAGGSFSLPNAAGSTMITSEGNPGLSFSIMSRDLPSTSGILTISSPSLISSGHTLSLSPS 480

Query: 481  XXXXXXXXXXXXXXXXXXXXXXXXXXTVNTDTVQADSSNSIYKXXXXXXXXXXXXXXXXF 540
                                      TVNTDTVQADSSNSIYK                F
Sbjct: 481  HVSISSLSVEPPSSIIQSSYIQPSASTVNTDTVQADSSNSIYKSPTPSLPSGSHGPLSSF 540

Query: 541  TGTIHTTGVTHLSDATSQQSARISTENSPMTEQTQPSDAXXXXXXXXXXXXEQTRXXXXX 600
            TGTIHTTGVTHLSDATSQQSARISTENSPMTEQTQPSDA            EQTR     
Sbjct: 541  TGTIHTTGVTHLSDATSQQSARISTENSPMTEQTQPSDASTGTSGGNSPTTEQTRSPAAT 600

Query: 601  XXXXXXXXXXXEQTQSPAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNSPTTEQTQP 660
                       EQTQSPAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNSPTTEQTQP
Sbjct: 601  TGTSGGNNPTTEQTQSPAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNSPTTEQTQP 660

Query: 661  SDASTGASGGNNPTTEQTRXXXXXXXXXXXXXXXXEQTRSPAATTGASGGNSPTTEQTQS 720
            SDASTGASGGNNPTTEQTR                EQTRSPAATTGASGGNSPTTEQTQS
Sbjct: 661  SDASTGASGGNNPTTEQTRSPAATTGTSGGNNPTTEQTRSPAATTGASGGNSPTTEQTQS 720

Query: 721  PAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNSPTTEQTQPSDASTGASGGNNPTTE 780
            PAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNSPTTEQTQPSDASTGASGGNNPTTE
Sbjct: 721  PAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNSPTTEQTQPSDASTGASGGNNPTTE 780

Query: 781  QTRXXXXXXXXXXXXXXXXEQTQSPAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNS 840
            QTR                EQTQSPAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNS
Sbjct: 781  QTRSPAATTGTSGGNNPTTEQTQSPAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNS 840

Query: 841  PTTEQTQPSDASTGASGGNNPTTEQTRXXXXXXXXXXXXXXXXEQTRSPAATTGASGGNS 900
            PTTEQTQPSDASTGASGGNNPTTEQTR                EQTRSPAATTGASGGNS
Sbjct: 841  PTTEQTQPSDASTGASGGNNPTTEQTRSPAATTGTSGGNNPTTEQTRSPAATTGASGGNS 900

Query: 901  PTTEQTQSPAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNSPTTEQTQPSDASTGAS 960
            PTTEQTQSPAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNSPTTEQTQPSDASTGAS
Sbjct: 901  PTTEQTQSPAATTGASGGNSPTTEQTRSPALSTQQFTAGSTGNSPTTEQTQPSDASTGAS 960

Query: 961  GGNNPTTEQTRSPDATTQQSMEGSTGNTPTITGSLTATFEXXXXXXXXXXXXXXXXXXXX 1020
            GGNNPTTEQTRSPDATTQQSMEGSTGNTPTITGSLTATFE                    
Sbjct: 961  GGNNPTTEQTRSPDATTQQSMEGSTGNTPTITGSLTATFESSSVSDHAAASSILVSSSAA 1020

Query: 1021 PQSLTSNTLDGTSLSPISFELSGSSPSTILMRGTPSITATGESWSDVNSRKLTSSAQFHD 1080
            PQSLTSNTLDGTSLSPISFELSGSSPSTILMRGTPSITATGESWSDVNSRKLTSSAQFHD
Sbjct: 1021 PQSLTSNTLDGTSLSPISFELSGSSPSTILMRGTPSITATGESWSDVNSRKLTSSAQFHD 1080

Query: 1081 XXXXXXXXXXXXGDFLTFSSPTPPSAADTRYPSETRVESLSSTYANSIQVLTLLSGFTTN 1140
                        GDFLTFSSPTPPSAADTRYPSETRVESLSSTYANSIQVLTLLSGFTTN
Sbjct: 1081 SSSSLTTSKISLGDFLTFSSPTPPSAADTRYPSETRVESLSSTYANSIQVLTLLSGFTTN 1140

Query: 1141 DGYSVSALPESASDRVLTSQPTSLTITGFSQQVSGSISPIPTSRIETSGLYSQASVFSES 1200
            DGYSVSALPESASDRVLTSQPTSLTITGFSQQVSGSISPIPTSRIETSGLYSQASVFSES
Sbjct: 1141 DGYSVSALPESASDRVLTSQPTSLTITGFSQQVSGSISPIPTSRIETSGLYSQASVFSES 1200

Query: 1201 AETFGSNSIYGDXXXXXXXXXXXXXXXXXXQKTASSNFASVTTIVPMTSDAGMSSSNIIS 1260
            AETFGSNSIYGD                  QKTASSNFASVTTIVPMTSDAGMSSSNIIS
Sbjct: 1201 AETFGSNSIYGDSSAPSSTSSSETENAFSSQKTASSNFASVTTIVPMTSDAGMSSSNIIS 1260

Query: 1261 KQDTIFXXXXXXXXXXXXXXXXXXXXVVNPVGGTNSPLGSSNVVPSPSFIAPKSNPSSTS 1320
            KQDTIF                    VVNPVGGTNSPLGSSNVVPSPSFIAPKSNPSSTS
Sbjct: 1261 KQDTIFSPSTTSYISLILSESSTSTSVVNPVGGTNSPLGSSNVVPSPSFIAPKSNPSSTS 1320

Query: 1321 IDEKTGWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQ 1380
            IDEKTGWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQ
Sbjct: 1321 IDEKTGWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQ 1380

Query: 1381 GLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYF 1440
            GLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYF
Sbjct: 1381 GLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYF 1440

Query: 1441 NIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGADYTASVAEV 1500
            NIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGADYTASVAEV
Sbjct: 1441 NIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGADYTASVAEV 1500

Query: 1501 YFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTITSGSSPSFSNTDPXX 1560
            YFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTITSGSSPSFSNTDP  
Sbjct: 1501 YFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTITSGSSPSFSNTDPDH 1560

Query: 1561 XXXXXXXXXXXXXXXXXXTLDLGAHRHMSPATRKRILIFSLAFSFGVXXXXXXXXXXXKR 1620
                              TLDLGAHRHMSPATRKRILIFSLAFSFGV           KR
Sbjct: 1561 SGDTSGSSNNNSSDHKGGTLDLGAHRHMSPATRKRILIFSLAFSFGVLLWILIFLFLLKR 1620

Query: 1621 LYKVSKIRSKIVLREKSIPNNLGISYNHQFNDRLSDLKTDAFYDGDPERXXXXXXXXXXX 1680
            LYKVSKIRSKIVLREKSIPNNLGISYNHQFNDRLSDLKTDAFYDGDPER           
Sbjct: 1621 LYKVSKIRSKIVLREKSIPNNLGISYNHQFNDRLSDLKTDAFYDGDPERNFNSQSTNSSS 1680

Query: 1681 XXXXVPDSFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQ 1740
                VPDSFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQ
Sbjct: 1681 NHDSVPDSFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQ 1740

Query: 1741 ESGGETININEAQYMSSGIDLEDIDQEGNIEISELEFHHPELLSHLQKDDGIIEHYNKNQ 1800
            ESGGETININEAQYMSSGIDLEDIDQEGNIEISELEFHHPELLSHLQKDDGIIEHYNKNQ
Sbjct: 1741 ESGGETININEAQYMSSGIDLEDIDQEGNIEISELEFHHPELLSHLQKDDGIIEHYNKNQ 1800

Query: 1801 YYNMSTIVTESSNPQCNTVGLSSEPGMSVNVEDLSNENSVGFIRLHGSSSXXXXXXXXXX 1860
            YYNMSTIVTESSNPQCNTVGLSSEPGMSVNVEDLSNENSVGFIRLHGSSS          
Sbjct: 1801 YYNMSTIVTESSNPQCNTVGLSSEPGMSVNVEDLSNENSVGFIRLHGSSSDNYDDYLYEG 1860

Query: 1861 XXXXXXLVNDDAIAIPISTSRGSVTRSLIITEPSGFRLGEVEAIEEIMPECDEFTDADYD 1920
                  LVNDDAIAIPISTSRGSVTRSLIITEPSGFRLGEVEAIEEIMPECDEFTDADYD
Sbjct: 1861 DEDDIELVNDDAIAIPISTSRGSVTRSLIITEPSGFRLGEVEAIEEIMPECDEFTDADYD 1920

Query: 1921 KDPTEDSNGDENDVSDIMVEEFDALDEEMYRHLSVINNRYYSSSSNVASFHEGYYGYRSN 1980
            KDPTEDSNGDENDVSDIMVEEFDALDEEMYRHLSVINNRYYSSSSNVASFHEGYYGYRSN
Sbjct: 1921 KDPTEDSNGDENDVSDIMVEEFDALDEEMYRHLSVINNRYYSSSSNVASFHEGYYGYRSN 1980

Query: 1981 AAVGTSTSKSSSVNYNPTGSKFMAQHHTYNTSTINSGYTSRSGYLQVPTTVSNNYPTPNN 2040
            AAVGTSTSKSSSVNYNPTGSKFMAQHHTYNTSTINSGYTSRSGYLQVPTTVSNNYPTPNN
Sbjct: 1981 AAVGTSTSKSSSVNYNPTGSKFMAQHHTYNTSTINSGYTSRSGYLQVPTTVSNNYPTPNN 2040

Query: 2041 TEFSSGHNSALLSSLLSKTQRPASAFDFENCPNILGSSPQVSNVGAHKGVMHRRSKTEGS 2100
            TEFSSGHNSALLSSLLSKTQRPASAFDFENCPNILGSSPQVSNVGAHKGVMHRRSKTEGS
Sbjct: 2041 TEFSSGHNSALLSSLLSKTQRPASAFDFENCPNILGSSPQVSNVGAHKGVMHRRSKTEGS 2100

Query: 2101 VISVPNRMSSTMHWDFENTAPGSTTSHALRTEAGVLRKNSSAHEVDPSLHATKPHGWKHL 2160
            VISVPNRMSSTMHWDFENTAPGSTTSHALRTEAGVLRKNSSAHEVDPSLHATKPHGWKHL
Sbjct: 2101 VISVPNRMSSTMHWDFENTAPGSTTSHALRTEAGVLRKNSSAHEVDPSLHATKPHGWKHL 2160

Query: 2161 VPGVRHRQELETRRKKDEKISKSQISGPIHTANSLGWGITK 2201
            VPGVRHRQELETRRKKDEKISKSQISGPIHTANSLGWGITK
Sbjct: 2161 VPGVRHRQELETRRKKDEKISKSQISGPIHTANSLGWGITK 2201

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score =  492 bits (1267), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 351/912 (38%), Positives = 488/912 (53%), Gaps = 70/912 (7%)

Query: 1304 VPSPSFIAPKSNPSSTSIDEKTGWLPTTIVTASMQTS-PKESTTVGSAATYTLPRAITPA 1362
             P+P+  +  +  +S+ + EKT WLP TI+T S+Q   P  ++T G  +T  LP AI P 
Sbjct: 1475 APTPAAGSSNAVAASSKVFEKTDWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQ 1534

Query: 1363 TPVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHIN 1422
            + V   D YDLI+IGF++GLNY F+ S  ++SAQIF+FLP +L YP+  + E  +  H +
Sbjct: 1535 SLVEGSDGYDLISIGFLKGLNYVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIH-D 1593

Query: 1423 ESNNNILGNRGSVSGSYFNIYGNLSLEHKHTNSTEPVKRRQ--NNEEDTSDEHGYSQIVV 1480
             +    L     VS      Y   S   + T +       Q    +++TSD    S + V
Sbjct: 1594 PTEKRQLERPPPVS-----FYSRAS---RDTTTLSSFTHSQVIAVQKETSDVPDLSFVKV 1645

Query: 1481 KQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRI 1540
            KQ+ P + +   Y A++A VYFPS+ V  L++++ D  S LY NP   L   ASL+DP I
Sbjct: 1646 KQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTI 1705

Query: 1541 PVLTITSGSSPSFSNTDPXX---XXXXXXXXXXXXXXXXXXTLDLGAHRHMSPATRKRIL 1597
             V  I    S    N  P                       +LD      ++    KR+L
Sbjct: 1706 KVRIIQHDRS----NPRPAQGGGTSGSDGYSPSGYANHGDGSLDNSKSPKITFKITKRLL 1761

Query: 1598 IFSLAFSFGVXXXXXXXXXXXKRLYKVSKIRSKIVLREKSIPNNLGISYNHQFNDRLSDL 1657
            IF    +FGV           +RLY+++K++SKIVL EK IP +LG+ Y+HQFN+RLSDL
Sbjct: 1762 IFLTVLTFGVFLWRLVFLYLFRRLYRINKVKSKIVLGEKKIPPSLGLFYSHQFNNRLSDL 1821

Query: 1658 KTDAFYDGDPERXXXXXXXXXXXXXXXVPDSFTDDDMIVTGENTVYSLSQGITYHIDEEG 1717
            K  A Y+GDPE+               V    TDDD+IVTGENTVYSLSQGI YHIDEEG
Sbjct: 1822 KPSALYEGDPEKQDGTATDGSSGS---VHGYATDDDIIVTGENTVYSLSQGIAYHIDEEG 1878

Query: 1718 NYYYARINPFSNSFEPEADIMYQESGGETININEAQYMSSGIDLEDIDQEGNIEISELEF 1777
            NYYYA I+PF+++FE EAD +Y ES  E++N+N   ++SS I  E+ID +GNIE+ + +F
Sbjct: 1879 NYYYAGIDPFTDAFEQEADCLYHESEVESVNVNNLDHLSSDIKEENIDLDGNIELYDSDF 1938

Query: 1778 HHPELLSHLQKDDGIIEHYNKNQYYNMSTIVTESSNPQCNTVGLSSEPG-MSVNVEDLSN 1836
             H   L  + K    IE YN NQYY M+T++T+SSN Q NTV LSS+ G  SV+VE++SN
Sbjct: 1939 DHTS-LDQVPKATETIEKYNNNQYYKMNTLITDSSNCQGNTVALSSDYGTTSVHVENVSN 1997

Query: 1837 ENSVGFIRLHGSSSXXXXXXXXXXXXXXXXLVNDDAIAIPISTSRGSVTRSLIITEPSGF 1896
            ENS+GFIRL G                     ND + A  ++      ++        G 
Sbjct: 1998 ENSLGFIRLQG--DIPENYDDYLYEGDEDDFDNDSSAAAQLTQVSNLASQ--------GI 2047

Query: 1897 RLGEVEAIEEIMPECDEFTDADYDKDPTEDSNGDENDVSDIMVEEFDALDEEMYRHLSVI 1956
             L    +++E  PE ++F   D+ +      + D++DVSD+M+ +FD LDEEMYRHLS+I
Sbjct: 2048 HLA--ASVQE--PEYEDF---DFAR------SEDDDDVSDVMLGDFDELDEEMYRHLSMI 2094

Query: 1957 N--NRYYSSSSNVASFHEGYYGYRSNAAVGTSTSKSSSVNYNPTGSKFMAQHHTYNTSTI 2014
            N  +  +   +N+A+     Y  R+     T+ SK SS NYN T    M Q++T NTST 
Sbjct: 2095 NAFDSRFGGFNNMAAQDSSVY-QRTFQPGNTTLSKGSSSNYNGTYPHVMMQYNTMNTSTT 2153

Query: 2015 NSGYTSRSGYLQVPTTVSNNYPTPNNTEFSSGHNSALLSSLLSKTQRPASAFDFENCPNI 2074
            +SG T  SG L  P T +    T N    SS H S    +   + QRP S F+F+     
Sbjct: 2154 DSGCTFPSGAL--PGTTTYFTNTFNTVG-SSSHASGRTPAPPMRPQRPPSLFNFDEYSVT 2210

Query: 2075 LGSSPQVSNVGAHKGVMHR-RSKTE-GSVISVPNRMSSTMHWDFENTAPGSTTSHALRTE 2132
            +    + +   A +  M R  SKT+  +V S  NR+SST+ WD E  AP     +   + 
Sbjct: 2211 VQ---ETATAVAERNTMLRSNSKTDLSAVASASNRLSSTL-WDLEKAAP----EYLAPST 2262

Query: 2133 AGVLRK---NSSAHEVDPSLHATKPHGWKHLVPGVRHRQELETRRKK----DEKISKSQI 2185
             G   K   +       PS H    H WKH+V GVR  + L    +K     +KISK +I
Sbjct: 2263 GGSASKGSSDRRLSSRSPSSHKHHRHSWKHIVTGVRSSKSLSKMHQKQSSRKDKISKLRI 2322

Query: 2186 SGPIHTANSLGW 2197
            SGPIHT +SLGW
Sbjct: 2323 SGPIHTEHSLGW 2334

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score =  285 bits (728), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 210/603 (34%), Positives = 301/603 (49%), Gaps = 79/603 (13%)

Query: 1310 IAPKSN--PSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAK 1367
            + P SN  P  TS      WLP +++  S  TS + STTV   AT TLP+AITP T V +
Sbjct: 1455 VTPSSNDGPLHTSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQ 1514

Query: 1368 PDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPY--------IENKE----- 1414
            P  + LITIGF + LNY FL+S+P++SAQIFSFLP +L YP+        I  ++     
Sbjct: 1515 PAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVM 1574

Query: 1415 ALLLRHINESNNNILGNRGSVSGSYFNIYGNLSLEH------KHTNSTEP----VKRRQN 1464
             LL R +  S   I  +  S+S   F  Y  + L        K TN T+     + RR  
Sbjct: 1575 TLLQRRLTSSAAEI--DTCSLS---FQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSV 1629

Query: 1465 NEE-----DTSDEHG--YSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADK 1517
            N++      TSD     YSQIVVKQI+P +    +Y  SVAEVYFP  ++ +L+++V ++
Sbjct: 1630 NDKVSVMNSTSDSSNIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQ 1689

Query: 1518 NSKLYLNPVATLNQLASLVDPRIPVLTITSGSSPSFSNTDPXXXXXXXXXXXXXXXXXXX 1577
            NS+LY NP  +L  LASL+DP +P+  +      S +N +                    
Sbjct: 1690 NSELYKNPENSLKALASLIDPSVPLTGLVDSDGNSVTNEEGGNSGSSGSNSSGDSDPSSG 1749

Query: 1578 X----------------TLDLGAHRHMSPATRKRILIFSLAFSFGVXXXXXXXXXXXKRL 1621
                             +LD GA+  MS A  KR++I+ L FSF             KRL
Sbjct: 1750 GSGESQGGANGDGSALGSLDDGAYGKMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRL 1809

Query: 1622 YKVSKIRSKIVLREKSIPNNLGISYNHQFNDRLSDLKTDAFYDGDPERXXXXXXXXXXXX 1681
            Y +  I  ++   +K+  ++ G  YNH +N   SD   + FY  DPER            
Sbjct: 1810 YGIEVIGKRLKPNDKTWSSSPGAFYNHHYNSHYSD-PNNPFY--DPERSLREKCSFDERY 1866

Query: 1682 XXXV----PDSFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPEADI 1737
                     D +  DD++VTG+NTVYS S+G++Y IDE GNYYYA ++   N  E   + 
Sbjct: 1867 DYDYDTEEQDGYLYDDLVVTGDNTVYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEF 1926

Query: 1738 MYQESGGETININEAQYMSSG---IDLE--------DIDQEGNIEISELEFHHPELLSHL 1786
            +         +I E     +G   ID E        D+D+EGNIE+ + +F+ P  ++ +
Sbjct: 1927 VDHNQLQSMEHIYEGHDSIAGGALIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDV 1986

Query: 1787 Q--KDDGIIEHYNKNQYYNMSTIV-TESSNPQC-NTVGLSSEPGMSVNVEDLSNENSVGF 1842
            +  K D  +E YN NQYY M+T++ TESS  Q  N++ +S   G  + +   SNE S G 
Sbjct: 1987 EGGKTD-TVESYNNNQYYKMNTLITTESSEQQVGNSLSVS---GAGLALVSSSNEGSNGI 2042

Query: 1843 IRL 1845
            I+L
Sbjct: 2043 IQL 2045

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 122/334 (36%), Gaps = 90/334 (26%)

Query: 1941 EFDALDEEMYRHLSVIN------NRYYSSSSNVASFHEGYYGYRSNAAVGTSTSKSSSVN 1994
            E D LDEEMYR LS  N      NR   +++  ++ ++  +     A+  T+TS  S+ +
Sbjct: 2128 ELDELDEEMYRRLSNFNELHGLQNRSSGTNTYESTVNQQIFAQLPTAS--TATSSYSTPH 2185

Query: 1995 YNPTGSKFMAQHHTYNTSTINSGYTSRSGYLQVPTTVSNNYPTPNNTEFSSGHNSALLS- 2053
            +     K ++     N  +     TS S       T S   P+      S+G  S  LS 
Sbjct: 2186 FK--SQKTLSTSRPDNQDSAGDWSTSNS-------TASFMSPSVVIVGASAGEASLALST 2236

Query: 2054 -SLLSKTQRPASAFDFENCPNILGSSPQVSNVGAHKGVMHRRSKTEGSVISVPNRMSSTM 2112
             S   +  RP+S  +F+   N +   P V+   A     + R+     V     + +S++
Sbjct: 2237 PSKPKRPDRPSSTLNFDELMNNI--PPDVAMAAAESTSRYLRTTPRSDV----KKYNSSI 2290

Query: 2113 HWDFE------------NTAPGSTTSHALRTEAGVLRKNSSAHEV-DPSLHAT------- 2152
            HWDFE            N       S+ L + +     N +   V +P +HAT       
Sbjct: 2291 HWDFEKHPHNEVGDKPRNNQSLDNFSNKLTSSSISSANNVAVASVFNPEVHATTAKTPSV 2350

Query: 2153 ----KPH-----------------------GW-KHLVPGVRHRQELET------------ 2172
                K H                        W K +   VRH   L T            
Sbjct: 2351 ALDSKDHRQAEFQVDAISRKSTKNGHKSRSSWTKSITESVRHSVVLSTSHSRRGSLSKVI 2410

Query: 2173 -----RRKKDEKISKSQISGPIHTANSLGWGITK 2201
                 R    E++ K +ISGPI + NSLGW   K
Sbjct: 2411 PATGPRGHTREELKKIRISGPIFSENSLGWSAMK 2444

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score =  188 bits (477), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 153/507 (30%), Positives = 230/507 (45%), Gaps = 57/507 (11%)

Query: 1325 TGWLPTTIVTASMQTSPKESTT--VGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGL 1382
            T WLP++I    +Q+ P  S T     A T TLP+ I P T V  P+N   IT+GF + L
Sbjct: 1067 TFWLPSSI---QVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNL 1123

Query: 1383 NYAFLVSNPVASAQIFSFLPHLLNYPYIEN--KEALLLRHINESNNNILGNRGS--VSGS 1438
            NY FLVS+   +AQIF FLP +L++P+ EN  K+    R            RG+  VS  
Sbjct: 1124 NYEFLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKR------------RGTLLVSSF 1171

Query: 1439 YFNIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGADYTASVA 1498
             FN    L     H  +   + +R ++E         S + V QI+P +++  +Y  S+A
Sbjct: 1172 EFNNTTTLMPAQFHQETVTGISKRSDSEF----PFNASAVDVIQIMPMIIKDRNYLTSIA 1227

Query: 1499 EVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTITSGSSPSFSNTDP 1558
             +YFPS  V+ L+ MV+D  S+L+ NP  TL+ LA+L+DP IP+  +  GS+ S +  +P
Sbjct: 1228 VLYFPSAYVSELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLIDGSTGSLNGGNP 1287

Query: 1559 XXXXXX-XXXXXXXXXXXXXXTLDLGAHRHMSPATRKRILIFSLAFSFGVXXXXXXXXXX 1617
                                 +L    +  +S A +KR++I+     FG           
Sbjct: 1288 STQSHSPSSPYKSQSSDDNSGSLGTATNSGLSSAVKKRLVIYLTCLVFGTLLWILVFMFL 1347

Query: 1618 XKRLYKVSKIRSKIVLREKSIPNNLGISYNHQFNDRLSDLKTDAFYDGDPERXXXXXXXX 1677
             K LY    I  +   R+ +        YN      +   +T+   D   +         
Sbjct: 1348 YKHLYGGRVIAKRAYQRDAAQEEKQH--YNFADITSVHSAETEPANDKSDDVPQEKDVAS 1405

Query: 1678 XXXXXXXVPDSFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPE--- 1734
                   +P     +D+++TGENTVYS+SQG+ Y + E+G++YYA   P  ++ E     
Sbjct: 1406 ASQSRYSLP-----EDLMITGENTVYSVSQGLQYFVAEDGSFYYA--GPLQSTSEENETT 1458

Query: 1735 ----ADI------MYQESGGETININEAQYMSSGIDLEDIDQEGNIEISEL---EFHHPE 1781
                ADI      +Y      +I  NE    S  I    ID+EGN  +S+    E  H E
Sbjct: 1459 KGDSADIEDINDYLYSADQERSIVTNEQS--SCDIGSLQIDEEGNFVVSDPSPNEEEH-E 1515

Query: 1782 LLSHLQKDDGIIEHYNKNQYYNMSTIV 1808
            + S    +   IE YN N  Y M+  V
Sbjct: 1516 ITS---SNSATIELYNNNNLYKMTRTV 1539

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score =  185 bits (469), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 197/678 (29%), Positives = 302/678 (44%), Gaps = 115/678 (16%)

Query: 1314 SNPSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDL 1373
            +NP +TS D    WLPT I+    + S   +T+   + T +LP  I PA  V +P N+ L
Sbjct: 1194 TNPYTTSNDY--AWLPTAIIVEPTK-SDTSTTSFNPSITASLPNVIAPAIAVTEPANHTL 1250

Query: 1374 ITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRG 1433
            ITIGF  GLNY FLV NP++SAQIF+FLP +L YP+ +           ES+   +G+  
Sbjct: 1251 ITIGFTAGLNYVFLVQNPLSSAQIFNFLPLVLKYPFSDTTS-----QQEESSTYEMGSSS 1305

Query: 1434 SVSGSYFNIYGNLSLEHKHTNSTEPVKRRQ------NNEEDTSD----EHGYSQIVVKQI 1483
             V  SY +     +L  +  +S  P+ R++      N+   T++      G S IVVKQI
Sbjct: 1306 FV-LSYQSGSSTTTLSPESVSSI-PIVRKKKKKGGKNSVMSTANLDLPSIGNSSIVVKQI 1363

Query: 1484 VPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVL 1543
            VP +     Y  +VAEVYFP+EA++SL++++ D NS LY NP  +L  LA L+D  +P+ 
Sbjct: 1364 VPMIDSSRSYVIAVAEVYFPTEAISSLQELILDTNSTLYNNPQTSLQTLAGLIDSSVPLG 1423

Query: 1544 TIT-SGSSPSFSNTDPXXXXXXXXXXXXXXX---XXXXXTLDLGAHR---HMSPATRKRI 1596
             +T  GS+   S  D                         LD   +    HM     KR 
Sbjct: 1424 GLTLYGSNNGCSICDSSSSSVSEVSNTNSTKNGGTNKYGALDDFTNSLTDHMPWRITKRF 1483

Query: 1597 LIFSLAFSFGVXXXXXXXXXXXK-RLYKVSKIRSKIVLREKSIPNN------LGISY--- 1646
            +I+    + GV           + R   + +  S  +  EK+ PNN      +G+S    
Sbjct: 1484 IIYLTCLTAGVLLWLLLALFAFRHRNVLLGRRPSNCI--EKT-PNNERGLEGVGVSTSRS 1540

Query: 1647 ---NHQFNDRLSDLKTDAFYDGDPERXXXXXXXXXXXXXXXVPDSFTDDDMIVTGENTVY 1703
               NH +N++  + ++++FY                        S  DD  I TGENTVY
Sbjct: 1541 SSDNHNYNEKKPNTESESFY------------------------SMEDDQYIPTGENTVY 1576

Query: 1704 SLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQESGGETININEAQYMSSGID--L 1761
            S + G+ Y +DE+G+ +Y +  P         DI       + IN NE     SGID  L
Sbjct: 1577 SATHGLHYTVDEDGDLFYRKSMP--------NDI-------DEINENE----DSGIDSIL 1617

Query: 1762 EDIDQEGNIEISELEFHHPELLSHLQKDDGIIEHYNKNQYYNMSTIVTESSNPQCNTVGL 1821
             +   + + + +E+  +  E +S +   D   E+ N   Y + S    E   P C     
Sbjct: 1618 RECVYDRHQDTTEVYLNDEESMSSILDVD---ENGNIRLYDSYS----EDDEPNC----- 1665

Query: 1822 SSEPGMSVNVEDLSNENSVGFIRLHGSSSXXXXXXXXXXXXXXXXLVNDDAIAIPISTSR 1881
               P +   V +  N + V  ++L G                      ++ IA   S+  
Sbjct: 1666 ---PHLQEEVIEDYNNSHVYKMQLQGLEIGSYTTEDDPDT--------ENLIANEFSSGS 1714

Query: 1882 GSVTRSLIITEP---SGFRLGEVEAIEEIMPECDEFTDADYDKDPTEDSNGDENDVSDIM 1938
             +   S   T P   +  +L  +      + + D+   +++D+   ED + D   VSDI 
Sbjct: 1715 QTCLPSTAYTTPLDTNSIKLHILGHAGSSLQKPDQAFISNHDELEIEDID-DNGSVSDIQ 1773

Query: 1939 VEEFDALDEEMYRHLSVI 1956
            VEE DALDEE+Y+ +S I
Sbjct: 1774 VEELDALDEELYKRMSKI 1791

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score =  179 bits (455), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 182/667 (27%), Positives = 281/667 (42%), Gaps = 120/667 (17%)

Query: 1326 GWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYA 1385
             WLPT I+  S +T P  + +   + T +LP AI PA  V++P N+ LITIGF   LNY 
Sbjct: 1209 AWLPTAIIVESSETGPT-TASFNPSITGSLPNAIEPAVAVSEPINHTLITIGFTAALNYV 1267

Query: 1386 FLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYFNIYGN 1445
            FLV NP++SAQIF+FLP +L YP+  N  + L   I E +  IL  R   SGS       
Sbjct: 1268 FLVQNPLSSAQIFNFLPLVLKYPF-SNTSSELDNSIGELSTFILSYR---SGSSTTTLSP 1323

Query: 1446 LSLEHKHTNSTEPVKRRQNNEEDTSDEH----GYSQIVVKQIVPFLLQGADYTASVAEVY 1501
             S+        +  ++++N  + T D H      S I VK+IVP +     Y  SVAEVY
Sbjct: 1324 KSISSLSVVKKKKNQQKKNATKSTEDLHPPQVDTSSIAVKKIVPMVDSSKAYIVSVAEVY 1383

Query: 1502 FPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPV--LTIT----SGSSPSFSN 1555
            FP+EAVT L++++ D+NS LY NP   L  LA L+D  IP+  LT+      G  PS ++
Sbjct: 1384 FPTEAVTYLQQLILDENSTLYSNPQTPLRSLAGLIDSGIPLGGLTLYGSGDGGYVPSLTS 1443

Query: 1556 TDPXXXXXXXXXXXXXXXXXXXXTLDLGAHRHMSPATRK--RILIFSLAFSFGVXXXXXX 1613
            +                         + +    + A +   +I+IF +  + GV      
Sbjct: 1444 SSVLDSSKGNSQNIDGTYKYGALDDFINSFTDSASAGKYAVKIIIFLIVLTIGV------ 1497

Query: 1614 XXXXXKRLYKVSKIRSKIVLREKSIPNNLGISYNHQFNDRLSDLKT----DAFYDGDPER 1669
                          R + +L ++   N +G S N++     ++L      +  Y+  P  
Sbjct: 1498 ---LLWLFVAFFAFRHRNILLKRHPRNCIGKSLNNERELESTELSRSSSGNQVYNEKPPE 1554

Query: 1670 XXXXXXXXXXXXXXXVPDSFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSN 1729
                              S  DD  IVTGENTVY+    + Y I+++G+  Y    P   
Sbjct: 1555 SENESVY-----------SAVDDHYIVTGENTVYNTIHRLHYTINDDGDLLYRDAIPL-- 1601

Query: 1730 SFEPE------------ADIMYQESGGETININEAQYMSSGIDLEDIDQEGNIEISELEF 1777
             F+               D +Y ++   T      +   SGI   D+D+ G+I + +  +
Sbjct: 1602 DFDQTNGDDGSGIDSIVRDCVYDKNQDATEAFLNDEESISGI--LDVDENGDIRLYD-SY 1658

Query: 1778 HHPELLSHLQKDDGIIEHYNKNQYYNMSTIVTESSNPQCNTV--GLSSEPGMSVNVED-- 1833
               E  +     D +IE+YNKN                C T   GL +E   S   +D  
Sbjct: 1659 SDNEESNSFHLPDEVIENYNKNHL--------------CETKLHGLGTE---SCTTDDPD 1701

Query: 1834 ----LSNENSVGFIRLHGSSSXXXXXXXXXXXXXXXXLVNDDAIAIPISTSRGSVTRSLI 1889
                ++NE S G                          +   A   P+ T          
Sbjct: 1702 TGNQITNEFSTG----------------------SQTCLPSTAYTTPLHT---------- 1729

Query: 1890 ITEPSGFRLGEVEAIEEIMPECDEFTDADYDKDPTEDSNGDENDVSDIMVEEFDALDEEM 1949
                +  +L  +   E  +P+ ++   ++ +    ED + D   VSD+ +EE DALDEE+
Sbjct: 1730 ----NSIKLHTLRYTESSLPKPNQTLFSNLEDLEIEDID-DNGSVSDVHIEELDALDEEL 1784

Query: 1950 YRHLSVI 1956
            Y+ +S +
Sbjct: 1785 YKRMSKV 1791

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score =  166 bits (421), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 148/531 (27%), Positives = 231/531 (43%), Gaps = 73/531 (13%)

Query: 1316 PSSTS--IDEKTGWLPTTIVTASMQTSPKESTT--VGSAATYTLPRAITPATPVAKPDNY 1371
            PS+TS   +  T WLP +I+   MQ++P  S+        T TLP AI P TPV++P N 
Sbjct: 1635 PSATSAPTESNTNWLPYSII---MQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNS 1691

Query: 1372 DLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGN 1431
              ITIGF + ++Y FLV+NP++SAQIF+FLP +L YP+  ++      H NES       
Sbjct: 1692 STITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNES------- 1744

Query: 1432 RGSVSGSYFNIYGNLSLEHKHTNSTEPVK--RRQNNEEDTSDEHGYSQIVVKQIVPFLLQ 1489
                           S   + T + +P +    + N++        + + V QI+P L +
Sbjct: 1745 ---------------SHYKRKTTTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSR 1789

Query: 1490 GADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTITSGS 1549
               Y  +VAE+YFP++ V  L+  + + NS LY N   TL  LA L+DP IP+  +   +
Sbjct: 1790 DKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMVDDN 1849

Query: 1550 SPSFSNTDPXXXXXXXXXXXXXXXXXXXXTLDLG------AHRHMSPATRKRILIFSLAF 1603
                +                          D G      +  H++    KR+ IF   F
Sbjct: 1850 GDVNNGGSGSGSSGEGNHASQSPHSFQNGNEDNGNLETANSTSHITGVITKRLAIFLNCF 1909

Query: 1604 SFGVXXXXXXXXXXXKRLYKVSKIR----------SKIVLREKS---IPNNLGISYNHQF 1650
            +FGV           +++ KV              S  VL+  S     N  G S   QF
Sbjct: 1910 AFGVLLWILSFLFIFRKIRKVQPPEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQF 1969

Query: 1651 NDRLSDLKTDAFYDGDPERXXXXXXXXXXXXXXXVPDSFTDDDMIVTGENTVYSLSQGIT 1710
                +    D+      +R                  S   DD+IVTGENTVYS   G+ 
Sbjct: 1970 FQEKA-TNNDSQNQETVDRNATPKLENSNEGIGGNAQSPISDDLIVTGENTVYSTLHGLE 2028

Query: 1711 YHIDEEGNYYYA---RINPFSNSFEPEADIM-----YQESGGETININEAQYMSSGIDLE 1762
            Y +DE+G ++YA   +I+  S + + E D +     Y  +G E ++++ ++     +   
Sbjct: 2029 YFVDEDGQFHYAGNRQISDESGTTKDEHDEIDDFDKYMYAGSEEMSVHVSEAPEVDMSSL 2088

Query: 1763 DIDQEGNIEISELEFHHPELLSHLQ---------KDDGIIEHYNKNQYYNM 1804
            ++D+EGN  +      + E+  +LQ         K+   +E YN N  Y M
Sbjct: 2089 EVDEEGNFVL-----MNDEIYDNLQENSRSGSGNKNSDTVESYNNNHLYKM 2134

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score =  165 bits (418), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 140/257 (54%), Gaps = 33/257 (12%)

Query: 1304 VPSPSFIAPKSNPSSTSIDEKTG--WLPTTIVTASMQTSPKESTTVGSAATYTLPRAITP 1361
             P+ +F+   S PS +    +T   WLPT +VTAS   S    ++  +AAT TLP+ I P
Sbjct: 1282 APTSTFL---SKPSQSVAGSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFIVP 1338

Query: 1362 ATPVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIEN-------KE 1414
            +TPV+ P NY  ITIGF + LNY FL+ NP+ASAQIF FLP +L YP++          E
Sbjct: 1339 STPVSIPANYSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSE 1398

Query: 1415 ALLLRHINE-------SNNNILGNRGSVSGSYFN-IYGN-LSLEHKHTNSTEPVKRRQNN 1465
            +   R+  E        N N+  +   +     N I+ +  +L+++  N T         
Sbjct: 1399 SQPWRYFKEFPRDGHLENTNLSEDERKLKNGLTNHIFEDGQALQYRMHNRTGAFS----- 1453

Query: 1466 EEDTSDEHGYSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNP 1525
                     +S++VV  I+P ++ G DY ASVA VYFP+ AV  L+KM+ +  S LY NP
Sbjct: 1454 -------ANFSEVVVSSIIPLIISGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNP 1506

Query: 1526 VATLNQLASLVDPRIPV 1542
             +T   LA L+DP+IP+
Sbjct: 1507 DSTQESLALLIDPKIPI 1523

 Score = 60.5 bits (145), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 68/136 (50%), Gaps = 24/136 (17%)

Query: 1691 DDDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQ--ESGGETIN 1748
            ++D++  G    +S S G+TY +  +GN+YYA     ++   P+    +Q   +G +  N
Sbjct: 1671 EEDLLAVGNGLFFSRSTGLTYQVGPDGNFYYAG---RTDDVYPKNQGAFQATNTGDQDKN 1727

Query: 1749 I-------------NEAQYMSS-GIDLEDI--DQEGNIEISELEFHHPELLSHLQKDDGI 1792
            +             NEA ++S  G DL++I  D++GN+   EL     E LS  + +   
Sbjct: 1728 LNAVTTLFKEGEVNNEALHLSQVGQDLDEIIVDEDGNV---ELPLADLEQLSFEENNTDT 1784

Query: 1793 IEHYNKNQYYNMSTIV 1808
            IE YN  QYY M+ ++
Sbjct: 1785 IESYNNQQYYKMNQLL 1800

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%)

Query: 1934 VSDIMVEEFDALDEEMYRHLSVI 1956
            V+DI + EFD LDEEMYR LS +
Sbjct: 1916 VNDIHIGEFDELDEEMYRRLSSV 1938

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1530

 Score =  160 bits (404), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 136/449 (30%), Positives = 201/449 (44%), Gaps = 53/449 (11%)

Query: 1291 VGGTNSPLGSSNVVPSPSFIAPKSNPSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSA 1350
            V  T +PLG S      S + P S P+S S    T WLPT I+ AS   S   + T  + 
Sbjct: 859  VVQTPNPLGGS------SILNPAS-PTSGSDSTDTVWLPTNIIIASNADS---THTARAE 908

Query: 1351 ATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYI 1410
            +T +LP AI PA  +  P +++LITIGF+ GLNYAFLV NP++SAQ+F FLPH+L +P  
Sbjct: 909  STASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIE 968

Query: 1411 ENKEALLLRHINESNNNIL--------GNRGSVSGSYFNIYGNLSLEHKHTNSTEPVKRR 1462
            +  E    + I   +++I          NR +V+        N+  +++ T+S+  +   
Sbjct: 969  DAAEK--SKAIQPQSSDITTTLVAPLRKNRKTVTDM---TRANVVNQNEATSSSLNLAVS 1023

Query: 1463 QNNEEDTSDEHGYSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLY 1522
                     E  +  I VKQI+P +++G DY  SVAEVYFP+  + SL  +++D NS LY
Sbjct: 1024 SEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLY 1083

Query: 1523 LNPVATLNQLASLVDPRIPVLTITSGSSPSFSNTDPXXXXXXXXXXXXXXXXXXXXTLDL 1582
             NP      LASL+D  IP+ ++      S ++TD                      L +
Sbjct: 1084 SNPKKNFATLASLIDKAIPLTSLRKNDGQSNTSTDSSSDVNSNESTGDDAFQNAEEYLRV 1143

Query: 1583 GAHRHMS--------PATRKRILIFSLAFSFGVXXXXXXXXXXXKRLYKVSKIRSKIVLR 1634
                 +S           R RI++F    + GV           +   K  K++    L+
Sbjct: 1144 SGAMDLSNIKVSKVNHTIRNRIIVFLFTLTTGVFLWISTFLIIFRITNKSRKLKDS-NLK 1202

Query: 1635 EKSIPNNLGISY--NHQFNDRLSDLKTDAFYDGDPERXXXXXXXXXXXXXXXVPDSFTDD 1692
            + S+P      Y  N QF+   S+   D  Y  +                          
Sbjct: 1203 KGSLPLYQQNPYRENKQFSAESSESYIDIHYTTEKYSDYSASSPP--------------- 1247

Query: 1693 DMIVTGENTVYSLSQGITYHIDEEGNYYY 1721
                 GEN +   +QGI Y +D EGNYYY
Sbjct: 1248 ----IGENIIVDSAQGIQYKVDNEGNYYY 1272

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  148 bits (374), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 100/267 (37%), Positives = 142/267 (53%), Gaps = 21/267 (7%)

Query: 1290 PVGGTNSPLGSSNVVPSPSF---IAPKSNPS--STSIDEKTGWLPTTIVTASMQTSPKES 1344
            P+   +   GS     +PS    +AP S  S  STS+D    WLP+ IVTAS   S    
Sbjct: 1190 PISSQSESFGSVQPSRTPSLATVLAPSSTNSEGSTSMD----WLPSNIVTASYTGSAHTQ 1245

Query: 1345 TTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHL 1404
            ++  + AT TLP+AI P TPV  P NY  ITIGF + LNY FL+ NP+ASAQIF FLP +
Sbjct: 1246 SSFDADATATLPQAIMPPTPVTMPPNYSQITIGFKESLNYPFLIENPLASAQIFGFLPEI 1305

Query: 1405 LNYPY------IENKEALLLRHINESNNNILGNRGSVSGSYFNIYGNLSLEHKHTNSTEP 1458
            L YP+        +  + + R +   + N+L +  ++      I   L+ +    NS   
Sbjct: 1306 LRYPFSVRASRSNSSTSSVKRDLVGDSGNLLLDNSTL------ILDKLNWKTSIMNSLSS 1359

Query: 1459 VKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKN 1518
                  N    +    +S + V  IVP ++ G DY  SVA VYFP+EAV  L+KM+ +  
Sbjct: 1360 NVSVSRNGSHNAFRANFSGVAVSSIVPLIVSGNDYITSVAVVYFPTEAVEVLQKMIINGA 1419

Query: 1519 SKLYLNPVATLNQLASLVDPRIPVLTI 1545
            S++Y NP  +L  +A L+D +IP+  I
Sbjct: 1420 SRIYKNPDQSLRDMALLIDSKIPITGI 1446

 Score = 71.2 bits (173), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 119/295 (40%), Gaps = 63/295 (21%)

Query: 1694 MIVTGENTVYSLSQGITYHIDEEGNYYYA-----RINPFSNSFEPEADIMYQESGGETIN 1748
            ++  G    +S S G+TYH+D EGN++YA      + P  +    + +       GE+  
Sbjct: 1599 LLAVGNGMFFSKSTGLTYHVDREGNFFYAGTANKAVLPLKSKSTSKLEASNMVPNGESDP 1658

Query: 1749 INEAQY---------------------MSSG-------IDLEDIDQEGNIEISELEFHHP 1780
             NEA                        S+G       ++  D+D++GN+E+S  +    
Sbjct: 1659 KNEANEANEAKEEGEENEERKENEEKPCSNGEFRDDAEVEEFDVDEDGNVELSVSDL--- 1715

Query: 1781 ELLSHLQKDDGIIEHYNKNQYYNMSTIVTESSNPQCNTVGLSSEPGMSVNVEDLSNENSV 1840
            E LS  + +   IE YN  QYY M  ++   +N        +   G + N+    NE+ +
Sbjct: 1716 ERLSLDEHNSDTIESYNNQQYYKMKQLLQNLNNDDIEGAFSTENEGAAGNISSTGNESKL 1775

Query: 1841 GFIRLHGSSSXXXXXXXXXXXXXXXXLVNDDAIAIPISTSRGSVTRSLIITEPSGFRLGE 1900
              + L   SS                      + + +ST   ++       E     +G+
Sbjct: 1776 --MPLSSESSK---------------------LLVQLSTDDDNLEEYFYSEEAQLEGIGK 1812

Query: 1901 VEAIEEIMPECDEFTDA-DYDKDPTEDSNGDENDVSDIMVEEFDALDEEMYRHLS 1954
              +  +  PE ++  D  D++ D   DS  +  DV+D+ V EFD LDE MYR  S
Sbjct: 1813 TTS-PQPEPESEDNDDVEDFNID--SDSEEEGEDVNDVHVGEFDELDEVMYRRFS 1864

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score =  141 bits (355), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 102/263 (38%), Positives = 139/263 (52%), Gaps = 43/263 (16%)

Query: 1299 GSSNVVPSPSFIAPKSNPSSTSIDEKTGWLPTTIVTASMQT----SPKESTTVGSAATYT 1354
            GS +V+P  SF  P + P + S D    WLPTTI+    QT    +P   +  GS     
Sbjct: 894  GSDSVIPV-SFTHP-TTPYTYSNDY--AWLPTTIIVEPSQTGSSTAPFNPSITGS----- 944

Query: 1355 LPRAITPATPVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKE 1414
            LP  I PA  V++P N+ LIT+GF  GLNY FLV NP++SAQIF+FLP +L YP+     
Sbjct: 945  LPSLIEPAVAVSEPANHTLITVGFTAGLNYEFLVQNPLSSAQIFNFLPLVLGYPF----- 999

Query: 1415 ALLLRHINESNNNILGNRGSVSG------SYFNIYGNLSLEHKHTNSTEPVK-----RRQ 1463
                      +N  L  + S  G      SY +     +L  K  +S   VK      ++
Sbjct: 1000 ----------SNTRLEVQSSTQGLSSFVLSYQSGTSTTTLSPKSVSSLSIVKKKKKGEKR 1049

Query: 1464 NNEEDTSDEH----GYSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNS 1519
            N    T+D +      S IVVKQIVP +     Y  +VAEVYFP+EA++ L+K++ D +S
Sbjct: 1050 NATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASS 1109

Query: 1520 KLYLNPVATLNQLASLVDPRIPV 1542
             +Y NP   L  LA L+D RIP+
Sbjct: 1110 PIYNNPQTPLRTLAGLIDSRIPL 1132

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 112/279 (40%), Gaps = 59/279 (21%)

Query: 1688 SFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYYAR-----INPFSNSFEPEADIMYQES 1742
            S   D  IVTGENT+YS + G+ Y ++++G+ +Y       +N  +   + E D++ +E 
Sbjct: 1269 SIVGDHYIVTGENTIYSTTHGLHYTMNDDGDLFYREAVPNDLNQLNGGEDLEIDVIVREC 1328

Query: 1743 GGETININEAQYMSSGIDLE---DIDQEGNIEISELEFHHPELLSHLQKDDGIIEHYNKN 1799
              +        Y++ G  +    D+D+ GNI + +              DDG       N
Sbjct: 1329 VYDKDQDTTEAYLNDGESVSSILDVDENGNIRLHDS-----------YSDDG-----ESN 1372

Query: 1800 QYYNMSTIVTESSNPQCNTVGLSSEPGMSVNVEDLSNENSVGFIRLHGSSSXXXXXXXXX 1859
            +Y+    ++ + +N     + L      S   +D    N V  +   GS +         
Sbjct: 1373 RYHLQDEVIDDYNNSHLYKIQLHGLGTRSCTTDDPDTVNLVTNVFSSGSQT--------- 1423

Query: 1860 XXXXXXXLVNDDAIAIPISTSRGSVTRSLIITEPSGFRLGEVEAIEEIMPECDE--FTDA 1917
                    +   A   P+ T+                +   +   E  + E ++  F+ A
Sbjct: 1424 -------FLPSTAYTTPLHTN--------------SIKFHTLHHAESSLQEPNQAFFSAA 1462

Query: 1918 DYDKDPTEDSNGDENDVSDIMVEEFDALDEEMYRHLSVI 1956
            +  K    D NG    VSD+ VEE DALDEE+Y+ +S +
Sbjct: 1463 EELKIDDIDDNGS---VSDVQVEELDALDEELYKRMSKV 1498

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] {ON}
            some similarities with uniprot|P41809 Saccharomyces
            cerevisiae YDR420W HKR1 Serine/threonine rich cell
            surface protein that contains an EF hand motif involved
            in the regulation of cell wall beta-1 3 glucan synthesis
            and bud site selection overexpression confers resistance
            to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score =  140 bits (352), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/278 (34%), Positives = 140/278 (50%), Gaps = 57/278 (20%)

Query: 1292 GGTNSPLGSSNVV-------PSPSFIAPKSNPSSTSID-------------EKTGWLPTT 1331
              T+  L SS+++        S SFI+    P +TS+                  WLPTT
Sbjct: 667  ASTHHSLASSSIITQTINSGASASFISETRQPMATSVSATLDGSIVNSGLTSNNNWLPTT 726

Query: 1332 IVTA-SMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYAFLVSN 1390
            +V   +   +   +T+    AT TLP+AI PA+ V  PD Y +IT+GF + LNY FL++N
Sbjct: 727  LVIEPTAAHATSAATSADLGATSTLPQAINPASDVPLPDGYTVITVGFKEPLNYPFLIAN 786

Query: 1391 PVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGS--VSGSYFNIYGNLSL 1448
            P+ASAQIF+FLP +L  P+                   L   G+  V    +NI+     
Sbjct: 787  PLASAQIFNFLPKVLVRPF------------------QLTTTGAAPVYRRSWNIF----- 823

Query: 1449 EHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVT 1508
                       K+  N    +S    Y  + VK IVP ++Q   Y  S+AEVYFP+E+V 
Sbjct: 824  -----------KKGINTHLLSSSLPTYDDVQVKSIVPLVIQNVSYIVSIAEVYFPTESVH 872

Query: 1509 SLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTIT 1546
            +L+++V D +S LY NPV+ L  LASL++P IP+  +T
Sbjct: 873  TLQELVLDSSSILYSNPVSYLADLASLINPAIPLTGLT 910

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 80/169 (47%), Gaps = 20/169 (11%)

Query: 1619 KRLYKVSKIRSKIVLREKSIPNNLGISYNHQFNDRLSDLKTDAFYDGDPERXXXXXXXXX 1678
            K LYK +    ++ L EK+ P  +   Y+H  N        + FY G             
Sbjct: 998  KNLYKRTNCAQRMHLTEKNWPE-IPTFYSHHMNGSTDSPMRNMFYSGSQFSDSDTTEEDS 1056

Query: 1679 XXXXXXVPDSFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPEA--D 1736
                      + DDD+I+TGENTVYS+SQGITY++DE+GN+++A +    ++ EPE    
Sbjct: 1057 HSA------EYIDDDLIITGENTVYSISQGITYYVDEDGNFFFAGVGKDVHTSEPEKLEK 1110

Query: 1737 IMYQESGGETININEAQYMSSGIDLED-----------IDQEGNIEISE 1774
            I++ ++   T+      Y     DL D           +D++GNI + E
Sbjct: 1111 IIHDKTETVTVEPILPYYNEKDDDLTDETEPFDMGELEVDEDGNIALPE 1159

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score =  134 bits (338), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 130/234 (55%), Gaps = 19/234 (8%)

Query: 1326 GWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYA 1385
             WLPT I+  S +T    +T      T +LP  I PA   ++P N+ LIT+GF   LNY 
Sbjct: 967  AWLPTAIIVQSSETD-TSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYV 1025

Query: 1386 FLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYFNIYGN 1445
            FLV NP++SAQIF+FLP +L YP+ +    +      ES+N   G   S   SY +    
Sbjct: 1026 FLVQNPLSSAQIFNFLPLVLKYPFSDTSSGV------ESSN---GELSSFILSYRSGTST 1076

Query: 1446 LSLEHKHTNSTEPVKRRQNNEED---TSDEHGY------SQIVVKQIVPFLLQGADYTAS 1496
             +L  +  +S   V++++  +++   TS    Y      S I VKQIVP +     Y  +
Sbjct: 1077 TTLSPQSKSSLSIVRKKKKGDKEKPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIA 1136

Query: 1497 VAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTITSGSS 1550
            VAEVYFP+EAV+ L++++ D NS LY NP + L  LA L+D  IP+ ++T  SS
Sbjct: 1137 VAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYSS 1190

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 66/128 (51%), Gaps = 15/128 (11%)

Query: 1688 SFTDDDMIVTGENTVYSLSQGITYHIDEEGNYYY--ARINPFSNSFEPE--------ADI 1737
            S TDD  I+TGENTVYS + G+ Y I+++G+ +Y  A +N    + E E         D 
Sbjct: 1320 SVTDDHYIITGENTVYSTTHGLHYTINDDGDLFYKEATLNDLEETAEREDSGIDSILRDC 1379

Query: 1738 MYQESGGET-ININEAQYMSSGIDLEDIDQEGNIEISELEFHHPELLSHLQKDDGIIEHY 1796
            +Y E    T   +N+ + +SS +   D+D+ GNI + +  +   E  +     + +IE Y
Sbjct: 1380 VYDEHQESTEAYLNDEESISSIV---DVDENGNIRLYD-SYSDDEEPNSFYLPNEVIEEY 1435

Query: 1797 NKNQYYNM 1804
            N N  Y +
Sbjct: 1436 NNNNVYKI 1443

 Score = 39.3 bits (90), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 19/23 (82%)

Query: 1934 VSDIMVEEFDALDEEMYRHLSVI 1956
            VSDI +EE DALDEE+Y+ +S I
Sbjct: 1527 VSDIQIEELDALDEELYKRISKI 1549

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1190

 Score =  125 bits (315), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 123/435 (28%), Positives = 180/435 (41%), Gaps = 42/435 (9%)

Query: 1316 PSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLIT 1375
            P+ST       WLP +++ AS Q S    +++    T TLP  I   T   +P N  L+T
Sbjct: 581  PASTGTQNTNDWLPNSMIFASDQ-SDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVT 639

Query: 1376 IGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYI------ENKEALLL----RHINESN 1425
            IGF + LNY FL+ NP+ASAQIF FLP  L+YP++       ++E   L     +  +  
Sbjct: 640  IGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPFLLTQYNASSEEITSLCSSSLYYEDDG 699

Query: 1426 NNILGNRGS--VSGSYF--NIYG----NLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQ 1477
              IL    S  V  + F   I G     L+ +   + S+ P +R    E         S 
Sbjct: 700  RTILTTHESTTVDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPRESSPPPFFNSSN 759

Query: 1478 IVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVD 1537
            +VVK I+P +    DY  SVAEVYFP++ +  L+K +   NS LY NP    + L  L+D
Sbjct: 760  VVVKHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLID 819

Query: 1538 PRIPVLTITSGSSP---------SFSNTDPXXXXXXXXXXXXXXXXXXXXTLDL--GAHR 1586
            P I +  +   +           S S+ D                     +LDL  G   
Sbjct: 820  PWISLTDLFQQNGMNNQGNNQDGSLSSNDSSFNTKTNPSNLTSTETERSGSLDLNSGYTS 879

Query: 1587 HMSPATRKRILIFSLAFSFGVXXXXXXXXXXXKRLYKVSKIRSKIVLREKSIPNNLGISY 1646
              S   + R+ IF+  F F V           K   K  + +    L  K++P       
Sbjct: 880  KFSSKIKDRLAIFTTVFLFVVFFWIWLFLVAFKHWNKRIENKKAKKLLNKTLP------- 932

Query: 1647 NHQFNDRLSDLKTDAFYDGDPERXXXXXXXXXXXXXXXVPDSFTDDDMIVTGENTVYSLS 1706
              +FN R+ DL T                         + + F D   + + E  VY  S
Sbjct: 933  TARFN-RV-DLVT---LSTASSMSSSSISPNEKQTYSSLENPFKDGTTVNSKEGVVYDQS 987

Query: 1707 QGITYHIDEEGNYYY 1721
             G+ Y +D +GN+YY
Sbjct: 988  NGMQYTVDYDGNFYY 1002

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 or uniprot|P41809 Saccharomyces cerevisiae
            YDR420w HKR1
          Length = 1185

 Score =  121 bits (303), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 89/247 (36%), Positives = 125/247 (50%), Gaps = 49/247 (19%)

Query: 1316 PSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSA----ATYTLPRAITPATPVAKPDNY 1371
            P + S DE   WLP+ I+  S       +TTV S+    AT +LP+ I P     K  N 
Sbjct: 708  PKTLSSDE--NWLPSGIIFQS-----DFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNT 760

Query: 1372 DLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGN 1431
             L+TIG  QGLNY FL+ NP++SAQIF+FLP +L YP+            N+   N L +
Sbjct: 761  TLVTIGLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAP-------NDFPINSLID 813

Query: 1432 RGSVSGSYFNIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGA 1491
              +++    N++                         T   HG        IVP L+ G 
Sbjct: 814  DNALAFLDSNLFN----------------------ASTISVHG--------IVPLLIPGH 843

Query: 1492 DYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTITSGSS- 1550
            ++  SV EVYFP++ + SL  ++ D+NS LY NP  +L+ LA L+DP IP+  + SGSS 
Sbjct: 844  EFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPLTGLISGSSI 903

Query: 1551 PSFSNTD 1557
             S SN+D
Sbjct: 904  ESTSNSD 910

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score =  104 bits (259), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 136/545 (24%), Positives = 221/545 (40%), Gaps = 95/545 (17%)

Query: 1327 WLPTTIVTASMQT--SPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNY 1384
            WLP+ I   S  T  S + S  + ++    LP  IT  T +  P N  LIT+ F + LNY
Sbjct: 516  WLPSEIAIQSDSTAESMEPSFLIDTSG---LPNIITAPTAITIPSNTTLITVAFKRELNY 572

Query: 1385 AFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESN------------------- 1425
            AFLV+N  +SAQIF+FLP ++ +P+     AL+    N+ +                   
Sbjct: 573  AFLVNNFYSSAQIFNFLPIIIKHPF----TALVSESCNDDSVCSPLFTEYILNSYASSAA 628

Query: 1426 ----NNILGNRGSVSGSYFNIYGNLSLEHK-----------HTNSTEPV----KRRQNNE 1466
                 + + N    SG   ++  NLSL               TN T  +    K+  +  
Sbjct: 629  SSMSTSSVNNVDFQSGGKHSVNINLSLHSTIVQTAISPTGFQTNMTSQIPSLAKKDLSKN 688

Query: 1467 EDTSDEHGYSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPV 1526
                 +     I V +I+P+++Q   Y  S+AEVY P+E V +L++++ +  S  Y +  
Sbjct: 689  ASLQKQEISMDITVARIIPYIVQNNKYIISIAEVYVPNEIVETLQELILNPASSFYNSES 748

Query: 1527 ATLNQLASLVDPRIPVL--------TITSGSSPSFSNTDPXXXXXX--XXXXXXXXXXXX 1576
            ++L  LA L+DP IP+          I+ G S S  N                       
Sbjct: 749  SSLKTLAFLIDPNIPLTGMLDSNGNLISGGLSSSNGNIQNSSTKHSHGSGISDISSQTLK 808

Query: 1577 XXTLDLGAHRHMSPATRKRILIFSLAFSFGVXXXXXXXXXXXKRLYKVSKIRSKIVLREK 1636
              TLD  A++ +S   +KR+ IF + F+ G              +YK   +++     + 
Sbjct: 809  LGTLDSSAYKGLSTNLKKRLSIFIVCFTVGAVLYIQLSLFGLNFMYKKLSMKADPESDKS 868

Query: 1637 SIPNNLGISYNHQFNDRLSDLK---TDAFYD-GDPERXXXXXXXXXXXXXXXVPDSFTDD 1692
            S+P        H   D  S+++   + +F    +P                 +P      
Sbjct: 869  SLPQ------YHITRDSTSNIEGRSSKSFSTPSNPFSDKYQKSSSDSSKSITLPGK---- 918

Query: 1693 DMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQESG---GETINI 1749
                     VY+ SQ +TY +DE+GN+YY  ++   N       IM    G    + ++ 
Sbjct: 919  --------AVYNRSQDMTYLVDEQGNFYYTNLD---NVQGRTVHIMRTPEGSIYSKDVSY 967

Query: 1750 NEAQYMS----SGIDLEDIDQEGNIEI-SELEFHHPELLSHLQKDD--GIIEH---YNKN 1799
            N+  Y S    S   L+D   E  +    +LE  +P+ L +  K+    IIE+   +N N
Sbjct: 968  NKYVYDSNNSTSNTYLDDQYHENTVNKGDDLEITYPDFLLNEVKESHTNIIENVKRFNNN 1027

Query: 1800 QYYNM 1804
              Y M
Sbjct: 1028 GLYKM 1032

 Score = 38.1 bits (87), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 9/56 (16%)

Query: 1911 CDEFTDADYDKDPTEDSNGDENDVSDIMVEEFDALDEEMYRHLS-------VINNR 1959
            C   T+  YD+    D   DE  V+D+ V E D LDEE+Y+ ++        INNR
Sbjct: 1097 CQGNTNITYDQSSVSDIEDDE--VNDVHVGELDELDEEIYKRITRNLSRNEFINNR 1150

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
            (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score =  101 bits (252), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 116/250 (46%), Gaps = 39/250 (15%)

Query: 1326 GWLPTTIVTAS----MQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQG 1381
             WLPT IV  S    M  SP+ +T         LP  I P T V +P +  LI+IGF   
Sbjct: 519  AWLPTNIVVQSSNTDMTNSPETNTNTSG-----LPVRIAP-TAVTQPADSILISIGFKIE 572

Query: 1382 LNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLR-HIN-ESNNNILGNRGSVSGSY 1439
            LNY FL+    ASAQIF+FLP +L YP+ ++     L   I+ +S+ +++        S 
Sbjct: 573  LNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSI 632

Query: 1440 FNIYGNLS--------LEHKHTNSTEP---VKRRQNNEEDTSDEHGYSQIVVKQIVPFLL 1488
            F+    LS        L    T+  E    V      + DTS       I VKQI+P L+
Sbjct: 633  FSYETTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTS------SISVKQIIPILI 686

Query: 1489 QGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTITSG 1548
             G  Y  S+AE  FP E V  L+  + +  S +Y NP   L  +A+L+D  IP+      
Sbjct: 687  PGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPI------ 740

Query: 1549 SSPSFSNTDP 1558
                FS  DP
Sbjct: 741  ----FSTIDP 746

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
            YGR014W
          Length = 994

 Score =  102 bits (253), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 100/218 (45%), Gaps = 64/218 (29%)

Query: 1327 WLPTTIVT--ASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNY 1384
            W+PT ++T  A+++T+    +T+  +AT  +P+ I     V   + Y LITIGF + L+Y
Sbjct: 646  WIPTRLLTETAAVETASNTVSTLSPSATKYMPQVIMAPGDVTVAEGYTLITIGFKKPLHY 705

Query: 1385 AFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYFNIYG 1444
             F+V+ P +SAQI SFLP+LLN P                                  YG
Sbjct: 706  EFVVTQPKSSAQIISFLPNLLNQP----------------------------------YG 731

Query: 1445 NLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGADYTASVAEVYFPS 1504
            N+                            +S I V Q+VP       Y  +VAEVYFP+
Sbjct: 732  NI----------------------------FSNISVLQLVPLQDSSISYYVTVAEVYFPT 763

Query: 1505 EAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPV 1542
              +T+L ++V D +S LY     +L  LA ++DP IP+
Sbjct: 764  AEITNLSQLVKDTSSILYTEVSESLKTLADMIDPSIPI 801

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
            Anc_4.150 YGR014W
          Length = 1123

 Score =  101 bits (252), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 75/115 (65%), Gaps = 3/115 (2%)

Query: 1326 GWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYA 1385
             W+PT IVT + QT+   S TVG A T TLP+AI  AT VA+PD Y LIT+GF + LNY 
Sbjct: 795  WWVPTQIVTQTSQTT--SSGTVGQA-TATLPQAIAAATQVARPDGYTLITLGFKRALNYN 851

Query: 1386 FLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYF 1440
            F+VSNP++SAQIF+FLP +L  P+  + E + ++ +    +  +    +V+  YF
Sbjct: 852  FVVSNPISSAQIFAFLPEMLRTPFENSYENITVQQLVPLQSKAVSYLATVAEVYF 906

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 44/71 (61%)

Query: 1472 EHGYSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQ 1531
            E+ Y  I V+Q+VP   +   Y A+VAEVYFP+  +++L K++++ +S LY +       
Sbjct: 876  ENSYENITVQQLVPLQSKAVSYLATVAEVYFPTSEISALSKLISNTSSNLYTDVEGPAKY 935

Query: 1532 LASLVDPRIPV 1542
            LA L+D  IP+
Sbjct: 936  LAYLIDASIPL 946

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4.150
          Length = 785

 Score = 97.1 bits (240), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 80/131 (61%), Gaps = 4/131 (3%)

Query: 1327 WLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYAF 1386
            W+PT ++TAS Q +   S  V SAAT TLP+ I  AT V  P+ Y +ITIGF + LNY F
Sbjct: 452  WIPTQLITASTQVT--GSAMVSSAATKTLPQVIGAATSVPTPEGYTVITIGFKEALNYEF 509

Query: 1387 LVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYF--NIYG 1444
            +VS+P +SAQIFSFLP++LN P+ +  + + +  +       +G   +V+   F  +   
Sbjct: 510  IVSSPKSSAQIFSFLPYVLNTPFDDIYDNITVSRLVPLQKKDIGYFITVAEVLFPESAIA 569

Query: 1445 NLSLEHKHTNS 1455
            NLS+  K TNS
Sbjct: 570  NLSVYIKDTNS 580

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 36/68 (52%)

Query: 1475 YSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLAS 1534
            Y  I V ++VP   +   Y  +VAEV FP  A+ +L   + D NS LY      L  LA 
Sbjct: 536  YDNITVSRLVPLQKKDIGYFITVAEVLFPESAIANLSVYIKDTNSSLYTKNDDALRSLAL 595

Query: 1535 LVDPRIPV 1542
            L+DP IP+
Sbjct: 596  LIDPSIPL 603

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score = 96.7 bits (239), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 100/229 (43%), Gaps = 66/229 (28%)

Query: 1314 SNPSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDL 1373
            S PSST   +   W+PT++  AS   S   ST      T  +P+AI        P+N+ L
Sbjct: 1485 SAPSSTITRQSNWWIPTSLAVASTMNSTDTST----LPTQAIPQAIGSVEQPPAPENHSL 1540

Query: 1374 ITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRG 1433
            ITIGF + LNY F+VS+P++ AQI ++LP                        N L N  
Sbjct: 1541 ITIGFKKELNYEFVVSHPMSGAQIINYLP------------------------NTLVNA- 1575

Query: 1434 SVSGSYFNIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGADY 1493
                     +GN++                              I V  +VP+    +DY
Sbjct: 1576 --------FFGNVT-----------------------------NISVNNLVPYNDTKSDY 1598

Query: 1494 TASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPV 1542
              ++A VYFP++ +  LR+++ DK+S  Y        QLA+LVDP IP+
Sbjct: 1599 LITIATVYFPTDEIKHLRELIHDKSSSFYTASQDVARQLANLVDPSIPL 1647

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
            (REAL)
          Length = 1189

 Score = 94.7 bits (234), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 98/228 (42%), Gaps = 62/228 (27%)

Query: 1315 NPSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLI 1374
            N SS +  +   W+PT ++T + + +   S+T     T TLP AI  AT +   + Y LI
Sbjct: 830  NYSSVTSSDNNWWIPTELITQAPEAASTASSTASGTQTMTLPHAIAAATQIPASEGYSLI 889

Query: 1375 TIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGS 1434
            T+GF + LNY F+VS P +SAQIF +LP  LN P+                         
Sbjct: 890  TVGFKRALNYEFVVSEPKSSAQIFGYLPEALNTPFK------------------------ 925

Query: 1435 VSGSYFNIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGADYT 1494
                  N++ N+S+                            QIV     P       Y 
Sbjct: 926  ------NVFTNISVL---------------------------QIV-----PLQDDSLSYL 947

Query: 1495 ASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPV 1542
             SVAEVYFP+  +  L  ++ + +S  Y +   T   +A++VDP IP+
Sbjct: 948  VSVAEVYFPTAELEELSNLITNTSSTFYTSGTGTAKSMAAMVDPSIPL 995

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1262

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/89 (50%), Positives = 63/89 (70%), Gaps = 6/89 (6%)

Query: 1327 WLPTTIVTASMQTSPKES------TTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQ 1380
            WLPT ++  S  T   ++      T + + AT TLP+AI  AT V++PD Y LITIGF +
Sbjct: 902  WLPTAMLVESTATDNGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIGFKK 961

Query: 1381 GLNYAFLVSNPVASAQIFSFLPHLLNYPY 1409
             LNY F+VS+PV+SAQ+FS+LP++LNYP+
Sbjct: 962  SLNYPFVVSHPVSSAQLFSYLPNVLNYPF 990

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score = 93.2 bits (230), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 67/114 (58%)

Query: 1327 WLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYAF 1386
            W+PT ++T + + +   S+TVG   T TLP AI  AT V +P+ Y LITIGF + LNY F
Sbjct: 961  WIPTELITQAPEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIGFKKALNYEF 1020

Query: 1387 LVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYF 1440
            +VS P +SAQIF +LP  LN P+      + +  I    ++ L    SV+  YF
Sbjct: 1021 VVSEPKSSAQIFGYLPEALNTPFKNVFTNITVLQIVPLQDDSLNYLVSVAEVYF 1074

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score = 92.4 bits (228), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/87 (52%), Positives = 60/87 (68%), Gaps = 4/87 (4%)

Query: 1327 WLPTTIVTASMQTSPKESTTVGS----AATYTLPRAITPATPVAKPDNYDLITIGFVQGL 1382
            WLPT +VTAS  T+  +S +  S     AT TLP+AI   T V++P+ Y LITIGF Q L
Sbjct: 1179 WLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEGYTLITIGFKQAL 1238

Query: 1383 NYAFLVSNPVASAQIFSFLPHLLNYPY 1409
            NY F+V+N V SAQIF++LP  LN+P+
Sbjct: 1239 NYPFVVTNAVTSAQIFAYLPETLNFPF 1265

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
            Anc_4.150
          Length = 985

 Score = 91.7 bits (226), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 76/136 (55%), Gaps = 3/136 (2%)

Query: 1308 SFIAPK--SNPSSTSIDEKTGW-LPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATP 1364
            SFI+P   + P+ T     T W +PT ++T S Q S   S    + AT TLP+ I   T 
Sbjct: 584  SFISPSVTTTPTQTRASSDTNWWIPTVLITQSNQPSESASVPTSNTATKTLPQVIAVGTT 643

Query: 1365 VAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINES 1424
            + +P+ Y LITIGF + LNY F+V+NP +SAQIFSFLP +LN P+      + +  +   
Sbjct: 644  IPEPEGYSLITIGFKKPLNYEFIVANPKSSAQIFSFLPDVLNAPFNNTFNNITVLQLVPL 703

Query: 1425 NNNILGNRGSVSGSYF 1440
             N  L    +V+  YF
Sbjct: 704  QNPSLNYLVTVAKVYF 719

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score = 90.1 bits (222), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 55/120 (45%), Positives = 74/120 (61%), Gaps = 12/120 (10%)

Query: 1301 SNVVPSPSFIAPK------SNPSSTSIDEKTGWLPTTIVTASMQT---SPKESTTVGSA- 1350
            ++V PSPS   P       S P+++S    + WLPT ++TA+  T   SP +S+    A 
Sbjct: 1193 ASVAPSPSSPYPALTTDLISTPTASSA-TSSNWLPTAMITANANTESASPTDSSDPKDAQ 1251

Query: 1351 -ATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPY 1409
             AT TLP+AI   T V +P+ Y LIT+GF + LNY F+V NPV SAQIF+FLP  LN P+
Sbjct: 1252 QATKTLPQAIGAPTEVVQPEGYTLITVGFKKALNYPFVVGNPVTSAQIFAFLPDTLNSPF 1311

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
            (REAL)
          Length = 1135

 Score = 89.7 bits (221), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 68/114 (59%)

Query: 1327 WLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYAF 1386
            W+PT ++T   + +   STT G   T TLP AI  AT +A+PD Y LITIGF + LNY F
Sbjct: 790  WIPTQLITQETEAASSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFKKALNYEF 849

Query: 1387 LVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYF 1440
            +VS P +SAQIF++LP  LN P+ +    + +  I    +++     SV+  YF
Sbjct: 850  VVSEPKSSAQIFAYLPEALNTPFKDVFTNISVLQIVPLQDDLFSYLVSVAEVYF 903

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa] {ON}
            some similarities with uniprot|P32334 Saccharomyces
            cerevisiae YGR014W MSB2 Mucin family member at the head
            of the Cdc42p- and MAP kinase-dependent filamentous
            growth signaling pathway also functions as an osmosensor
            in parallel to the Sho1p-mediated pathway potential
            Cdc28p substrate
          Length = 908

 Score = 87.4 bits (215), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 57/84 (67%), Gaps = 1/84 (1%)

Query: 1327 WLPTTIVTA-SMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYA 1385
            WLPTT+V       +   STT    AT TLP+AIT AT + +P  Y LIT+GF + LNY 
Sbjct: 535  WLPTTMVAEFETSGTQSTSTTSSKIATETLPQAITAATEIVQPAGYTLITVGFKKELNYP 594

Query: 1386 FLVSNPVASAQIFSFLPHLLNYPY 1409
            F V+NPV++AQIF FLP +LNYP+
Sbjct: 595  FTVNNPVSNAQIFEFLPKVLNYPF 618

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score = 86.7 bits (213), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 90/173 (52%), Gaps = 14/173 (8%)

Query: 1316 PSSTSIDEKTGWLPTTIVTASMQTSPKE-STTVGSAATYTLPRAITPATPVAKPDNYDLI 1374
            PSS++ ++   W+PT I+T   Q +P   +++  S AT TLP+AI  AT   +P  Y L+
Sbjct: 1149 PSSSTTNDN-WWVPTKIIT---QPAPNTTASSTSSQATATLPQAIAAATQQVRPKGYSLL 1204

Query: 1375 TIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGS 1434
            TIGF   LNY FL+S+P++SAQIF+FLP +LN P+      + +  I    +  L    +
Sbjct: 1205 TIGFKSALNYNFLISSPLSSAQIFAFLPSILNDPFQNQFNNVSIYQIVPLKSESLDYLAT 1264

Query: 1435 VSGSYFNIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFL 1487
            V+  YF       L    TN         N     +D HG ++ + + I P +
Sbjct: 1265 VAEVYFPTKHISDLNSLITN---------NASSLYTDAHGSAKYLAELIDPTI 1308

 Score = 60.8 bits (146), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 44/71 (61%)

Query: 1472 EHGYSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQ 1531
            ++ ++ + + QIVP   +  DY A+VAEVYFP++ ++ L  ++ +  S LY +   +   
Sbjct: 1240 QNQFNNVSIYQIVPLKSESLDYLATVAEVYFPTKHISDLNSLITNNASSLYTDAHGSAKY 1299

Query: 1532 LASLVDPRIPV 1542
            LA L+DP IP+
Sbjct: 1300 LAELIDPTIPL 1310

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
            similar to Ashbya gossypii AGR019C
          Length = 1129

 Score = 85.9 bits (211), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 10/93 (10%)

Query: 1327 WLPTTIVTAS----------MQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITI 1376
            WLPT I+T S            T  K +T++ S A  TLP+ I+ A       NY LIT+
Sbjct: 776  WLPTAILTESDADSEPTVTVTDTETKPTTSMASTAIQTLPKFISSANGKIPEGNYTLITV 835

Query: 1377 GFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPY 1409
            GF + LNY F+VSNPV+SAQIF FLP++LNYPY
Sbjct: 836  GFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYPY 868

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
            (REAL)
          Length = 1169

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 67/114 (58%)

Query: 1327 WLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYAF 1386
            W+PT ++T + +T+   S+ +G   T TLP+A+  AT + + + Y LIT+GF + LNY F
Sbjct: 823  WIPTELITQAPETASTISSAIGGTQTMTLPQAVAAATQIPESEGYSLITVGFKKPLNYEF 882

Query: 1387 LVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYF 1440
            +VS P +SAQIF +LP  LN P+      + +  I    ++ L    SV+  YF
Sbjct: 883  VVSEPKSSAQIFGYLPAALNTPFKNVFTNITVLQIVPLQDDSLNYLISVAEVYF 936

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
            Anc_4.150 YGR014W
          Length = 826

 Score = 80.1 bits (196), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/83 (46%), Positives = 53/83 (63%)

Query: 1327 WLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYAF 1386
            W+PT I+T S +T    S+T   + T   P+AI   T +  P  Y LITIGF + LNY F
Sbjct: 488  WVPTRIITESDKTQNSVSSTQTVSTTRIKPKAIAAPTTIPVPSGYTLITIGFKEALNYDF 547

Query: 1387 LVSNPVASAQIFSFLPHLLNYPY 1409
            ++ NPV+SAQIF+FLP  L+ P+
Sbjct: 548  VLDNPVSSAQIFAFLPEALDLPF 570

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGR014W
            (MSB2)
          Length = 1105

 Score = 77.4 bits (189), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 87/228 (38%), Gaps = 77/228 (33%)

Query: 1327 WLPTTIVTAS------------MQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLI 1374
            WLPT I+TA+             Q+ PK + T       TLP+ I     V    +Y LI
Sbjct: 757  WLPTVIITATEQEVVSTESPQNTQSKPKPTATPN---IQTLPQVIAAPDRVTPKKDYTLI 813

Query: 1375 TIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGS 1434
            TIGF + L                       NYP+I             +N  I      
Sbjct: 814  TIGFKKQL-----------------------NYPFIAMNPF--------ANAQIFDYLPG 842

Query: 1435 VSGSYFNIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQIVPFLLQGADYT 1494
            +    FN                                 Y+ I V Q+VP      DY 
Sbjct: 843  ILNYPFNFE-------------------------------YADISVIQLVPLKANSKDYI 871

Query: 1495 ASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPV 1542
            A++A+VYFPSE V  L K+V D NS+LY +  A +   ASL+DP++P+
Sbjct: 872  ATIAQVYFPSEKVDELAKLVVDTNSELYSSYDANMKVFASLIDPQLPL 919

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
            YGR014W
          Length = 949

 Score = 73.6 bits (179), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 101/240 (42%), Gaps = 63/240 (26%)

Query: 1304 VPSPSFIAPKSNPSSTSIDEKTGWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPAT 1363
            VP  S I   ++ ++TS      W+ + ++TAS + S   +    + AT +LP+AI   T
Sbjct: 568  VPVSSSITLVTSATTTSHSNPNWWVASDLMTASEEAS-TTTRASATTATGSLPQAIAAPT 626

Query: 1364 PVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINE 1423
             V  PD+Y LITIGF + L                       NY ++ N          E
Sbjct: 627  EVTAPDDYSLITIGFKKAL-----------------------NYEFVVNTP--------E 655

Query: 1424 SNNNILGNRGSVSGSYFNIYGNLSLEHKHTNSTEPVKRRQNNEEDTSDEHGYSQIVVKQI 1483
            S+  +         SY  I  N    +  TN                       I V QI
Sbjct: 656  SSAQLF--------SYLPIALNTPFNNSFTN-----------------------ISVYQI 684

Query: 1484 VPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVL 1543
            VP +    +Y  +VAEVYFP + + SL++M+ D +S L+   V     L SL+DP IP++
Sbjct: 685  VPLVESSLNYYITVAEVYFPEQEIASLQQMIKDNSSALFTENVGAPKTLVSLIDPSIPLV 744

 Score = 53.5 bits (127), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 70/169 (41%), Gaps = 55/169 (32%)

Query: 1296 SPLGSSNVVPSPSFIAPKSNPSSTSIDEKTGWLP----------------------TTIV 1333
            S + +++V  S + + P +   ST  +  TG +P                      TT++
Sbjct: 504  SDIYTNDVTSSMTSVVPSAVTESTISELSTGSVPSSTSTTKTLPLLTTSESQSTEQTTVL 563

Query: 1334 TASMQTSPKESTTVGSAATY---------------------------------TLPRAIT 1360
             AS        T V SA T                                  +LP+AI 
Sbjct: 564  PASNVPVSSSITLVTSATTTSHSNPNWWVASDLMTASEEASTTTRASATTATGSLPQAIA 623

Query: 1361 PATPVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPY 1409
              T V  PD+Y LITIGF + LNY F+V+ P +SAQ+FS+LP  LN P+
Sbjct: 624  APTEVTAPDDYSLITIGFKKALNYEFVVNTPESSAQLFSYLPIALNTPF 672

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 65.9 bits (159), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 60/108 (55%), Gaps = 17/108 (15%)

Query: 1313 KSNPSSTSIDEKTGWLPTTIV-------TASMQTSPKESTTVGSAATYTLPRAITPATPV 1365
            KS  ++ S+   + WLP+T+V       +A+MQ +P E        T+  PRAITP    
Sbjct: 1542 KSTFTTKSVSNGSNWLPSTLVVENNPSGSANMQFNPSE--------TFKWPRAITPENQN 1593

Query: 1366 AKPDNYD--LITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIE 1411
             KP   D  LI +   + LNY FL+ N V+SAQ+ +++P +L+Y  I+
Sbjct: 1594 EKPAPVDSQLILVALDRPLNYPFLIENLVSSAQVMNYIPFILSYSLID 1641

 Score = 61.2 bits (147), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 41/69 (59%)

Query: 1475 YSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLAS 1534
            Y  I VKQI+P L++  DY  +  +VY P+  V  L+  + D +S LY NPV    +L++
Sbjct: 1774 YPGIEVKQIIPLLIEDRDYWVAGVQVYVPNNVVDQLQAYIYDLDSILYHNPVYIARELSN 1833

Query: 1535 LVDPRIPVL 1543
             +D  IP++
Sbjct: 1834 FIDSSIPIV 1842

 Score = 40.4 bits (93), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 34/73 (46%), Gaps = 13/73 (17%)

Query: 1702 VYSLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQESGGETININEAQYMSSGIDL 1761
            VY  + G+ Y +D+EGNYYY        +     D +       T N +   Y   G D 
Sbjct: 2003 VYDNNNGLAYTVDKEGNYYYHH------NLTTGKDFI-------TFNTSLQDYRKEGHDD 2049

Query: 1762 EDIDQEGNIEISE 1774
              IDQ+GNIEI +
Sbjct: 2050 IFIDQDGNIEIED 2062

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
            complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score = 65.1 bits (157), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 63/114 (55%), Gaps = 1/114 (0%)

Query: 1327 WLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYAF 1386
            W+PT+++T S  T     TT   +AT ++P AI  +T  A P+   L+TIGF + LNY F
Sbjct: 643  WVPTSLITESDVTD-SAVTTRTLSATKSVPLAIAASTQTATPEGCSLVTIGFKEALNYQF 701

Query: 1387 LVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYF 1440
            ++S+ V  AQIF+FLP  L  P+ E    + +  ++  N        +V+  YF
Sbjct: 702  VLSSSVTVAQIFAFLPGGLIAPFEEQLANVTVYRLSPLNYGNFNYTLTVAEVYF 755

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 41/71 (57%)

Query: 1472 EHGYSQIVVKQIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQ 1531
            E   + + V ++ P      +YT +VAEVYFP+  +  L   VAD  S LY+N   T  +
Sbjct: 725  EEQLANVTVYRLSPLNYGNFNYTLTVAEVYFPTSKIDELAAFVADSESALYVNASGTEEE 784

Query: 1532 LASLVDPRIPV 1542
            L SL+DPRIP+
Sbjct: 785  LVSLIDPRIPI 795

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 multicopy suppressor of a CDC24 bud
            emergence defect
          Length = 936

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (59%), Gaps = 3/84 (3%)

Query: 1326 GWLPTTIVTASMQTSPKESTTVGSAATY--TLPRAIT-PATPVAKPDNYDLITIGFVQGL 1382
             W+PT+++ A  +T  + + T  +  T   +LP+ I   A   + P+ Y +ITIGF + L
Sbjct: 590  AWIPTSLIIAPTETESESTPTESNDGTQLSSLPKVIYGSAYSESVPEGYSVITIGFKKPL 649

Query: 1383 NYAFLVSNPVASAQIFSFLPHLLN 1406
            NY F+VS   +SAQI  +LP LLN
Sbjct: 650  NYPFVVSESKSSAQIMYYLPKLLN 673

>SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa]
            {ON} similar to uniprot|P39969 Saccharomyces cerevisiae
            YER114C BOI2 Protein implicated in polar growth
            functionally redundant with Boi1p interacts with bud-
            emergence protein Bem1p contains an SH3 (src homology 3)
            domain and a PH (pleckstrin homology) domain
          Length = 1027

 Score = 38.5 bits (88), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 54/126 (42%), Gaps = 15/126 (11%)

Query: 1991 SSVNYNPTGSKFMAQHH-------TYNTSTINSGYTSRSGYLQVPTTVSNNYPTPNNTEF 2043
            +S N +P  S F  QH+        Y  +T NS +  R G L  P      Y  P   E 
Sbjct: 431  ASPNRSPMSSTFTPQHNQKYQHPTIYEKATQNSAHPYRPGGLNSPM-----YEFPQKLEQ 485

Query: 2044 SSGHNSALLSSLLSKTQRPASAFDFENCPNILGSSPQVSNVGAHKGVMHRRSKTEGSVIS 2103
            ++    AL +   S +    S +D     N  G+   V   G HK   HR++K+ GS + 
Sbjct: 486  TTSSTPALPNPYASSS---PSVYDENRDENYPGNRGSVLYSGQHKAHSHRKTKSGGSFVE 542

Query: 2104 VPNRMS 2109
            + NR+S
Sbjct: 543  LFNRIS 548

>Skud_7.597 Chr7 complement(994091..996343) [2253 bp, 751 aa] {ON}
            YGR264C (REAL)
          Length = 751

 Score = 36.6 bits (83), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 1692 DDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQESGGETININE 1751
            D ++  G N +Y++S  IT ++ E G     +IN   N+   + D ++  +  E  NIN+
Sbjct: 671  DAVVTVGLNIIYAVSSIITPYMPEIGE----KINKMLNAPALKIDDIFHLAILEGHNINK 726

Query: 1752 AQYMSSGIDLEDIDQ 1766
            A+Y+   ID + ID+
Sbjct: 727  AEYLFQRIDEKKIDE 741

>YGR264C Chr7 complement(1019598..1021853) [2256 bp, 751 aa] {ON}
            MES1Methionyl-tRNA synthetase, forms a complex with
            glutamyl-tRNA synthetase (Gus1p) and Arc1p, which
            increases the catalytic efficiency of both tRNA
            synthetases; also has a role in nuclear export of tRNAs
          Length = 751

 Score = 35.8 bits (81), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 1692 DDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQESGGETININE 1751
            D ++  G N +Y++S  IT ++ E G     +IN   N+   + D  +  +  E  NIN+
Sbjct: 671  DAVVAVGLNIIYAVSSIITPYMPEIGE----KINKMLNAPALKIDDRFHLAILEGHNINK 726

Query: 1752 AQYMSSGIDLEDIDQ 1766
            A+Y+   ID + ID+
Sbjct: 727  AEYLFQRIDEKKIDE 741

>Smik_16.43 Chr16 (75638..77893) [2256 bp, 751 aa] {ON} YGR264C (REAL)
          Length = 751

 Score = 33.9 bits (76), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 1692 DDMIVTGENTVYSLSQGITYHIDEEGNYYYARINPFSNSFEPEADIMYQESGGETININE 1751
            D ++  G N +Y++S  IT  + E G     +IN   N+   + D  +  +  E  NIN+
Sbjct: 671  DAVVAVGLNIIYAVSSIITPFMPEIGE----KINKMLNAPALKIDDRFNLAILEGHNINK 726

Query: 1752 AQYMSSGIDLEDIDQ 1766
            A+Y+   ID + ID+
Sbjct: 727  AEYLFQRIDEKKIDE 741

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.122    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 198,998,140
Number of extensions: 8416267
Number of successful extensions: 63040
Number of sequences better than 10.0: 996
Number of HSP's gapped: 50847
Number of HSP's successfully gapped: 3465
Length of query: 2201
Length of database: 53,481,399
Length adjustment: 126
Effective length of query: 2075
Effective length of database: 39,033,483
Effective search space: 80994477225
Effective search space used: 80994477225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 74 (33.1 bits)