Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_4022na 1ON34341763e-19
NDAI0K011702.114ON34341147e-10
NDAI0B044702.114ON34341147e-10
CAGL0C01919gsingletonON34341112e-09
NCAS0B05140singletonON34341103e-09
TPHA0I012802.114ON34341085e-09
TPHA0I01275na 2ON34341085e-09
NCAS0G021802.114ON34341071e-08
Sklu_YGOB_MFA1na 1ON33341061e-08
TBLA0B04930singletonON34341061e-08
Ecym_6479singletonON34341051e-08
Kwal_YGOB_MFA1na 3ON33341052e-08
NDAI0K01420singletonON34341052e-08
Sklu_YGOB_MFA2na 4ON33331034e-08
TBLA0J00550singletonON34341026e-08
Smik_14.1822.114ON38381018e-08
YNL145W (MFA2)2.114ON38381019e-08
Skud_4.736na 5ON36361001e-07
Kthe_YGOB_MFA1na 3ON33341001e-07
TBLA0A01280singletonON34341001e-07
YDR461W (MFA1)na 5ON3636991e-07
Kpol_1039.70a2.114ON3334982e-07
Skud_14.1872.114ON3838964e-07
Suva_14.1942.114ON3838964e-07
Klac_YGOB_MFA1na 4ON3334964e-07
Kpol_1039.70na 2ON3334956e-07
Kpol_1039.70bsingletonON3334956e-07
Smik_4.739na 5ON3636957e-07
KAFR0K02130singletonON3535947e-07
KAFR0F005802.114ON3535947e-07
Suva_2.636na 5ON3636922e-06
ABL196Cna 1ON3334895e-06
TBLA0A01750singletonON3434818e-05
TBLA0A02390singletonON3434783e-04
TDEL0B047802.114ON3434758e-04
Zrou_YGOB_MFA12.114ON3435730.001
NCAS0B01270singletonON3535680.009
Klac_YGOB_MFA2singletonON3220660.018
NCAS0B071402.114ON3434640.027
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4022
         (34 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4022 Chr4 complement(55499..55603) [105 bp, 34 aa] {ON} sim...    72   3e-19
NDAI0K01170 Chr11 (269630..269734) [105 bp, 34 aa] {ON}                49   7e-10
NDAI0B04470 Chr2 (1118223..1118327) [105 bp, 34 aa] {ON}               49   7e-10
CAGL0C01919g Chr3 complement(202384..202488) [105 bp, 34 aa] {ON...    47   2e-09
NCAS0B05140 Chr2 complement(956459..956563) [105 bp, 34 aa] {ON}       47   3e-09
TPHA0I01280 Chr9 complement(292074..292178) [105 bp, 34 aa] {ON}...    46   5e-09
TPHA0I01275 Chr9 complement(290869..290973) [105 bp, 34 aa] {ON}       46   5e-09
NCAS0G02180 Chr7 complement(390421..390525) [105 bp, 34 aa] {ON}       46   1e-08
Sklu_YGOB_MFA1 Chr5 (1176933..1177034) [102 bp, 33 aa] {ON} ANNO...    45   1e-08
TBLA0B04930 Chr2 complement(1161014..1161118) [105 bp, 34 aa] {O...    45   1e-08
Ecym_6479 Chr6 (928035..928139) [105 bp, 34 aa] {ON} similar to ...    45   1e-08
Kwal_YGOB_MFA1 s56 complement(511414..511515) [102 bp, 33 aa] {O...    45   2e-08
NDAI0K01420 Chr11 (325279..325383) [105 bp, 34 aa] {ON}                45   2e-08
Sklu_YGOB_MFA2 Chr5 (1220858..1220959) [102 bp, 33 aa] {ON} ANNO...    44   4e-08
TBLA0J00550 Chr10 complement(109603..109707) [105 bp, 34 aa] {ON}      44   6e-08
Smik_14.182 Chr14 (331978..332091) [114 bp, 38 aa] {ON} YNL145W ...    44   8e-08
YNL145W Chr14 (352414..352530) [117 bp, 38 aa] {ON}  MFA2Mating ...    44   9e-08
Skud_4.736 Chr4 (1305258..1305365) [108 bp, 36 aa] {ON} YDR461W ...    43   1e-07
Kthe_YGOB_MFA1 Chr7 (1301790..1301891) [102 bp, 33 aa] {ON} ANNO...    43   1e-07
TBLA0A01280 Chr1 (304900..305004) [105 bp, 34 aa] {ON}                 43   1e-07
YDR461W Chr4 (1385176..1385286) [111 bp, 36 aa] {ON}  MFA1Mating...    43   1e-07
Kpol_1039.70a s1039 complement(187909..188010) [102 bp, 33 aa] {...    42   2e-07
Skud_14.187 Chr14 (342672..342785) [114 bp, 38 aa] {ON} YNL145W ...    42   4e-07
Suva_14.194 Chr14 (349190..349303) [114 bp, 38 aa] {ON} YNL145W ...    42   4e-07
Klac_YGOB_MFA1 Chr5 complement(1149528..1149629) [102 bp, 33 aa]...    42   4e-07
Kpol_1039.70 s1039 complement(186672..186773) [102 bp, 33 aa] {O...    41   6e-07
Kpol_1039.70b s1039 complement(189037..189138) [102 bp, 33 aa] {...    41   6e-07
Smik_4.739 Chr4 (1306426..1306533) [108 bp, 36 aa] {ON} YDR461W ...    41   7e-07
KAFR0K02130 Chr11 complement(438634..438741) [108 bp, 35 aa] {ON}      41   7e-07
KAFR0F00580 Chr6 complement(119048..119155) [108 bp, 35 aa] {ON}...    41   7e-07
Suva_2.636 Chr2 (1137378..1137485) [108 bp, 36 aa] {ON} YDR461W ...    40   2e-06
ABL196C Chr2 complement(40215..40316) [102 bp, 33 aa] {ON} Non-s...    39   5e-06
TBLA0A01750 Chr1 (425269..425373) [105 bp, 34 aa] {ON}                 36   8e-05
TBLA0A02390 Chr1 (573085..573189) [105 bp, 34 aa] {ON}                 35   3e-04
TDEL0B04780 Chr2 complement(846043..846147) [105 bp, 34 aa] {ON}...    33   8e-04
Zrou_YGOB_MFA1 Chr7 complement(448893..448997) [105 bp, 34 aa] {...    33   0.001
NCAS0B01270 Chr2 (212581..212688) [108 bp, 35 aa] {ON}                 31   0.009
Klac_YGOB_MFA2 Chr3 (1339261..1339359) [99 bp, 32 aa] {ON} ANNOT...    30   0.018
NCAS0B07140 Chr2 (1356259..1356363) [105 bp, 34 aa] {ON}               29   0.027

>Ecym_4022 Chr4 complement(55499..55603) [105 bp, 34 aa] {ON}
          similar to Ashbya gossypii ABL196C MFa2
          Length = 34

 Score = 72.4 bits (176), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA
Sbjct: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34

>NDAI0K01170 Chr11 (269630..269734) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 48.5 bits (114), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 28/34 (82%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP+T A++ +N S++KDN+IVKG  W+P CVIA
Sbjct: 1  MQPSTQATKKDNSSEKKDNYIVKGLFWDPACVIA 34

>NDAI0B04470 Chr2 (1118223..1118327) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 48.5 bits (114), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 28/34 (82%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP+T A++ +N S++KDN+IVKG  W+P CVIA
Sbjct: 1  MQPSTQATKKDNSSEKKDNYIVKGLFWDPACVIA 34

>CAGL0C01919g Chr3 complement(202384..202488) [105 bp, 34 aa] {ON}
          highly similar to uniprot|P34166 Saccharomyces
          cerevisiae YNL145w MFA2
          Length = 34

 Score = 47.4 bits (111), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 26/34 (76%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP   A+Q +N  +++DN+IVKG+ W+P CVIA
Sbjct: 1  MQPTIEATQKDNTQEKRDNYIVKGFFWSPDCVIA 34

>NCAS0B05140 Chr2 complement(956459..956563) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 47.0 bits (110), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 26/34 (76%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP+  ASQ +N ++ KDN+IVKG  W+P CVIA
Sbjct: 1  MQPSAQASQKDNTAENKDNYIVKGLFWDPACVIA 34

>TPHA0I01280 Chr9 complement(292074..292178) [105 bp, 34 aa] {ON}
          Anc_2.114 YNL145W
          Length = 34

 Score = 46.2 bits (108), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 26/34 (76%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP T A + +  S++KDN+IVKG  W+P+CVIA
Sbjct: 1  MQPTTQAIKKDTTSEKKDNYIVKGVFWDPECVIA 34

>TPHA0I01275 Chr9 complement(290869..290973) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 46.2 bits (108), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 26/34 (76%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP T A + +  S++KDN+IVKG  W+P+CVIA
Sbjct: 1  MQPTTQAIKKDTTSEKKDNYIVKGVFWDPECVIA 34

>NCAS0G02180 Chr7 complement(390421..390525) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 45.8 bits (107), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 26/34 (76%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP T A+  +N ++++DN+IVKG  W+P CVIA
Sbjct: 1  MQPTTQATHKDNSAEKQDNYIVKGLFWDPACVIA 34

>Sklu_YGOB_MFA1 Chr5 (1176933..1177034) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 45.4 bits (106), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 29/34 (85%), Gaps = 1/34 (2%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          M+ AT A+Q  + +++K+NWI+KG+AW+PQC+IA
Sbjct: 1  MKAATHATQKGS-TEDKENWIIKGFAWDPQCIIA 33

>TBLA0B04930 Chr2 complement(1161014..1161118) [105 bp, 34 aa]
          {ON} 
          Length = 34

 Score = 45.4 bits (106), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP T A+Q  N S+ KDN+I+ G  W+P C+IA
Sbjct: 1  MQPTTQATQKENSSENKDNYIIPGLFWDPACIIA 34

>Ecym_6479 Chr6 (928035..928139) [105 bp, 34 aa] {ON} similar to
          Ashbya gossypii ABL196C
          Length = 34

 Score = 45.1 bits (105), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQ  +     N +S+ KD+WI+KG+ WNPQCVIA
Sbjct: 1  MQQHSKDGNQNGESENKDHWIIKGFVWNPQCVIA 34

>Kwal_YGOB_MFA1 s56 complement(511414..511515) [102 bp, 33 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 33

 Score = 45.1 bits (105), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/34 (64%), Positives = 25/34 (73%), Gaps = 1/34 (2%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP   A+Q N+ S  KDNWI KG AW+PQCVIA
Sbjct: 1  MQPIAQATQ-NDSSDNKDNWIHKGLAWDPQCVIA 33

>NDAI0K01420 Chr11 (325279..325383) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 45.1 bits (105), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 27/34 (79%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP+T A++ ++  +++DN+IVKG  W+P CVIA
Sbjct: 1  MQPSTEATKKDSSFEKRDNYIVKGLFWDPACVIA 34

>Sklu_YGOB_MFA2 Chr5 (1220858..1220959) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 44.3 bits (103), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 28/33 (84%), Gaps = 1/33 (3%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVI 33
          MQP ++A+Q ++ ++ KDNWI++G AWNPQCVI
Sbjct: 1  MQPKSNATQKDS-AENKDNWIIEGLAWNPQCVI 32

>TBLA0J00550 Chr10 complement(109603..109707) [105 bp, 34 aa] {ON}
          
          Length = 34

 Score = 43.9 bits (102), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (70%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP T A++ +N S+ KDN+IV G  W+P C+I 
Sbjct: 1  MQPTTQATRKDNSSENKDNYIVPGLFWDPACIIV 34

>Smik_14.182 Chr14 (331978..332091) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 43.5 bits (101), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 27/38 (71%), Gaps = 4/38 (10%)

Query: 1  MQPATS----ASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP T+    A+Q N  S++KDN+I+KG  W+P CVIA
Sbjct: 1  MQPITTTSAQAAQKNKSSEKKDNYIIKGLFWDPACVIA 38

>YNL145W Chr14 (352414..352530) [117 bp, 38 aa] {ON}  MFA2Mating
          pheromone a-factor, made by a cells; interacts with
          alpha cells to induce cell cycle arrest and other
          responses leading to mating; biogenesis involves
          C-terminal modification, N-terminal proteolysis, and
          export; also encoded by MFA1
          Length = 38

 Score = 43.5 bits (101), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 27/38 (71%), Gaps = 4/38 (10%)

Query: 1  MQPATSAS----QDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP T+AS    Q +  S++KDN+I+KG  W+P CVIA
Sbjct: 1  MQPITTASTQATQKDKSSEKKDNYIIKGLFWDPACVIA 38

>Skud_4.736 Chr4 (1305258..1305365) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 43.1 bits (100), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 27/36 (75%), Gaps = 2/36 (5%)

Query: 1  MQPAT--SASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP+T  +A +D   S++KDN+I+KG  W+P CVIA
Sbjct: 1  MQPSTITAAPKDKTSSEKKDNYIIKGVFWDPACVIA 36

>Kthe_YGOB_MFA1 Chr7 (1301790..1301891) [102 bp, 33 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 33

 Score = 43.1 bits (100), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/34 (61%), Positives = 26/34 (76%), Gaps = 1/34 (2%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          M P T A+Q ++ S+ KDNWI KG AW+PQCVIA
Sbjct: 1  MPPITQATQKDS-SENKDNWIQKGLAWDPQCVIA 33

>TBLA0A01280 Chr1 (304900..305004) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 43.1 bits (100), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQ  T A+Q +N S+ KDN+IV G  W+P C+IA
Sbjct: 1  MQSTTQATQKDNSSENKDNYIVPGLFWDPACIIA 34

>YDR461W Chr4 (1385176..1385286) [111 bp, 36 aa] {ON}  MFA1Mating
          pheromone a-factor, made by a cells; interacts with
          alpha cells to induce cell cycle arrest and other
          responses leading to mating; biogenesis involves
          C-terminal modification, N-terminal proteolysis, and
          export; also encoded by MFA2
          Length = 36

 Score = 42.7 bits (99), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 27/36 (75%), Gaps = 2/36 (5%)

Query: 1  MQP--ATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP  AT+A ++   S++KDN+I+KG  W+P CVIA
Sbjct: 1  MQPSTATAAPKEKTSSEKKDNYIIKGVFWDPACVIA 36

>Kpol_1039.70a s1039 complement(187909..188010) [102 bp, 33 aa]
          {ON} complement(187909..188010) [102 nt, 34 aa]
          Length = 33

 Score = 42.4 bits (98), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 28/34 (82%), Gaps = 1/34 (2%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQ  T A+Q N+ S++KDN+IVKG+ W+P+CVIA
Sbjct: 1  MQSTTYAAQKNS-SEKKDNYIVKGWFWDPECVIA 33

>Skud_14.187 Chr14 (342672..342785) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 41.6 bits (96), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 4/38 (10%)

Query: 1  MQPATS----ASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP  +    ASQ +  S++KDN+I+KG  W+P CVIA
Sbjct: 1  MQPTATVSAQASQKDRSSEKKDNFIIKGLFWDPACVIA 38

>Suva_14.194 Chr14 (349190..349303) [114 bp, 38 aa] {ON} YNL145W
          (REAL)
          Length = 38

 Score = 41.6 bits (96), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%), Gaps = 4/38 (10%)

Query: 1  MQPATS----ASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP  +    ASQ +  S++KDN+I+KG  W+P CVIA
Sbjct: 1  MQPVATVSAQASQKDKSSEKKDNYIIKGLFWDPACVIA 38

>Klac_YGOB_MFA1 Chr5 complement(1149528..1149629) [102 bp, 33 aa]
          {ON} ANNOTATED BY YGOB - similar to Scer MFA1 pheromone
          Length = 33

 Score = 41.6 bits (96), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP   ASQ N  ++ K+NWI+ G+ W PQCV+A
Sbjct: 1  MQPTQQASQ-NESAENKENWIIPGFVWVPQCVVA 33

>Kpol_1039.70 s1039 complement(186672..186773) [102 bp, 33 aa]
          {ON} complement(186672..186773) [102 nt, 34 aa]
          Length = 33

 Score = 41.2 bits (95), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 27/34 (79%), Gaps = 1/34 (2%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQ  T A+Q N+ S++KDN+IVKG+ W+P+CVI 
Sbjct: 1  MQSTTYAAQKNS-SEKKDNYIVKGWFWDPECVIV 33

>Kpol_1039.70b s1039 complement(189037..189138) [102 bp, 33 aa]
          {ON} complement(189037..189138) [102 nt, 34 aa]
          Length = 33

 Score = 41.2 bits (95), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 27/34 (79%), Gaps = 1/34 (2%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQ  T A+Q N+ S++KDN+IVKG+ W+P+CVI 
Sbjct: 1  MQSTTYAAQKNS-SEKKDNYIVKGWFWDPECVIV 33

>Smik_4.739 Chr4 (1306426..1306533) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 41.2 bits (95), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 26/36 (72%), Gaps = 2/36 (5%)

Query: 1  MQPAT--SASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP+T  +A +D   ++ KDN+I+KG  W+P CVIA
Sbjct: 1  MQPSTITAAPKDKTNTENKDNYIIKGVFWDPACVIA 36

>KAFR0K02130 Chr11 complement(438634..438741) [108 bp, 35 aa] {ON}
          
          Length = 35

 Score = 40.8 bits (94), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 1/35 (2%)

Query: 1  MQP-ATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP +TSA+Q +N S++KDN++V    W+P CVIA
Sbjct: 1  MQPTSTSATQKDNSSEKKDNYMVSSGVWDPVCVIA 35

>KAFR0F00580 Chr6 complement(119048..119155) [108 bp, 35 aa] {ON}
          Anc_2.114 YNL145W
          Length = 35

 Score = 40.8 bits (94), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 1/35 (2%)

Query: 1  MQP-ATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP +TSA+Q +N S++KDN++V    W+P CVIA
Sbjct: 1  MQPTSTSATQKDNSSEKKDNYMVSSGVWDPVCVIA 35

>Suva_2.636 Chr2 (1137378..1137485) [108 bp, 36 aa] {ON} YDR461W
          (REAL)
          Length = 36

 Score = 40.0 bits (92), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 3/36 (8%)

Query: 1  MQPATSAS---QDNNKSQEKDNWIVKGYAWNPQCVI 33
          MQP T+ S   +D   +++KDN+I+KG  W+P C+I
Sbjct: 1  MQPITTVSAAPKDKTSTEKKDNYIIKGVFWDPACII 36

>ABL196C Chr2 complement(40215..40316) [102 bp, 33 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YNL145W (MFA2)
          Length = 33

 Score = 38.9 bits (89), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQ   + ++D + ++ KDNWI KGY W PQCVI 
Sbjct: 1  MQLTNNTNKDES-TENKDNWIAKGYMWTPQCVIV 33

>TBLA0A01750 Chr1 (425269..425373) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 35.8 bits (81), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQ     +Q  N S+ KDN+I+ G  W+P C+I 
Sbjct: 1  MQYNIQTTQKENSSENKDNYIIPGLFWDPACIIV 34

>TBLA0A02390 Chr1 (573085..573189) [105 bp, 34 aa] {ON} 
          Length = 34

 Score = 34.7 bits (78), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQ    A Q    S+ KDN+I+ G  W+P C+I 
Sbjct: 1  MQYNAQAGQKETSSENKDNYIIPGLFWDPACIIV 34

>TDEL0B04780 Chr2 complement(846043..846147) [105 bp, 34 aa] {ON}
          Anc_2.114 YNL145W
          Length = 34

 Score = 33.5 bits (75), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP T A++ +  S++KDN+++ G      CVIA
Sbjct: 1  MQPTTQATKKDTSSEKKDNFMLGGSTSYYGCVIA 34

>Zrou_YGOB_MFA1 Chr7 complement(448893..448997) [105 bp, 34 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 34

 Score = 32.7 bits (73), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 26/35 (74%), Gaps = 2/35 (5%)

Query: 1  MQPATS-ASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP T+ A++ +N S +KDN+++ G  ++P CVIA
Sbjct: 1  MQPTTAQATKKDNSSDKKDNFML-GSNYDPACVIA 34

>NCAS0B01270 Chr2 (212581..212688) [108 bp, 35 aa] {ON}
          Length = 35

 Score = 30.8 bits (68), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 1  MQPATSASQDNNKSQEKDNW-IVKGYAWNPQCVIA 34
          MQP+T A+Q +N  ++KDN+ +V     N  CVI 
Sbjct: 1  MQPSTHAAQKDNSEEKKDNFDLVINCLSNVSCVIV 35

>Klac_YGOB_MFA2 Chr3 (1339261..1339359) [99 bp, 32 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 32

 Score = 30.0 bits (66), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 8/20 (40%), Positives = 14/20 (70%)

Query: 15 QEKDNWIVKGYAWNPQCVIA 34
          +  D+W+  G  WNP+C+I+
Sbjct: 13 ESSDHWVFPGLTWNPKCIIS 32

>NCAS0B07140 Chr2 (1356259..1356363) [105 bp, 34 aa] {ON}
          Length = 34

 Score = 29.3 bits (64), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 1  MQPATSASQDNNKSQEKDNWIVKGYAWNPQCVIA 34
          MQP+T A+Q +  ++ KDN  V     N  CVI 
Sbjct: 1  MQPSTQATQKDTSAENKDNDFVFNCLSNISCVIV 34

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.120    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,265,529
Number of extensions: 76590
Number of successful extensions: 185
Number of sequences better than 10.0: 39
Number of HSP's gapped: 185
Number of HSP's successfully gapped: 39
Length of query: 34
Length of database: 53,481,399
Length adjustment: 9
Effective length of query: 25
Effective length of database: 52,449,405
Effective search space: 1311235125
Effective search space used: 1311235125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)