Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40215.699ON45945921050.0
AFR283W5.699ON4524639361e-122
SAKL0E14850g5.699ON4704586131e-73
KLTH0E01122g5.699ON4724634822e-54
Kwal_55.197165.699ON4674604752e-53
ZYRO0G06666g5.699ON5035013834e-40
KLLA0A00660g5.699ON5244933371e-33
Smik_9.235.699ON5273943221e-31
TDEL0B022205.699ON4892843122e-30
YIL146C (ATG32)5.699ON5293963027e-29
Suva_9.435.699ON5132962574e-23
Skud_9.225.699ON5373082503e-22
CAGL0H06545g5.699ON4922081971e-15
KNAG0L021005.699ON4444301712e-12
TBLA0E020905.699ON7491351662e-11
NCAS0G002605.699ON5103061534e-10
KAFR0D022505.699ON5561311421e-08
Kpol_2001.735.699ON41188820.18
ZYRO0B13354g4.291ON142089705.8
NOTE: 1 genes in the same pillar as Ecym_4021 were not hit in these BLAST results
LIST: TPHA0D04580

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4021
         (459 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   815   0.0  
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   365   e-122
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   240   1e-73
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   190   2e-54
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   187   2e-53
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   152   4e-40
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...   134   1e-33
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   128   1e-31
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   124   2e-30
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   120   7e-29
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   103   4e-23
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   100   3e-22
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...    80   1e-15
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....    70   2e-12
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...    69   2e-11
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...    64   4e-10
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...    59   1e-08
Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...    36   0.18 
ZYRO0B13354g Chr2 (1081872..1086134) [4263 bp, 1420 aa] {ON} sim...    32   5.8  

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/459 (88%), Positives = 408/459 (88%)

Query: 1   MSQTVEKMQSNGHTQNGGLPGTTQRSILDPHLSVLEILEGKELNKVEGPHELSGASRVSG 60
           MSQTVEKMQSNGHTQNGGLPGTTQRSILDPHLSVLEILEGKELNKVEGPHELSGASRVSG
Sbjct: 1   MSQTVEKMQSNGHTQNGGLPGTTQRSILDPHLSVLEILEGKELNKVEGPHELSGASRVSG 60

Query: 61  KQFEGERVLHHSISESWQSIKSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHXX 120
           KQFEGERVLHHSISESWQSIKSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIH  
Sbjct: 61  KQFEGERVLHHSISESWQSIKSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHPS 120

Query: 121 XXXXXXXXXXFDSRIINIAGQAFSATLSHLRSXXXXXXXXTVTVSLPNTMTSLVMPKLSL 180
                     FDSRIINIAGQAFSATLSHLRS        TVTVSLPNTMTSLVMPKLSL
Sbjct: 121 PPPPNSASSAFDSRIINIAGQAFSATLSHLRSEDEDDDGETVTVSLPNTMTSLVMPKLSL 180

Query: 181 SDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGL 240
           SDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGL
Sbjct: 181 SDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGL 240

Query: 241 APELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNXXXXXXX 300
           APELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSN       
Sbjct: 241 APELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNHHEKHRL 300

Query: 301 XXXXXXXSSGSDSGYETEVTVEXXXXXXXXXXXXXXXXXTFRDWVVWTASITIGIGIGCC 360
                  SSGSDSGYETEVTVE                 TFRDWVVWTASITIGIGIGCC
Sbjct: 301 LKHLHQLSSGSDSGYETEVTVEPVKKLPRKAKKRPSKPSTFRDWVVWTASITIGIGIGCC 360

Query: 361 VSLMVSTRYAFLVPRQLAVDDITSSPLSPEGTDKSSHNLFLHAYSLCKTSLKKLASSLRP 420
           VSLMVSTRYAFLVPRQLAVDDITSSPLSPEGTDKSSHNLFLHAYSLCKTSLKKLASSLRP
Sbjct: 361 VSLMVSTRYAFLVPRQLAVDDITSSPLSPEGTDKSSHNLFLHAYSLCKTSLKKLASSLRP 420

Query: 421 FFSDRLESCTWIHTLGIELSYDDSLISMGRIMPLDFIML 459
           FFSDRLESCTWIHTLGIELSYDDSLISMGRIMPLDFIML
Sbjct: 421 FFSDRLESCTWIHTLGIELSYDDSLISMGRIMPLDFIML 459

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  365 bits (936), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 201/463 (43%), Positives = 279/463 (60%), Gaps = 20/463 (4%)

Query: 2   SQTVEKMQSNGHTQNGGLPGTTQ-RSILDPHLSVLEILE---GKELNKVEGPHELSGASR 57
           SQ   +++++  T   G+ G  Q + ILDPHLSVLE+L+   G    +VE      GA  
Sbjct: 5   SQVTRRVRTSIATPEDGVHGNNQHKGILDPHLSVLEMLDRQDGDGAGQVE-----EGAVM 59

Query: 58  VSGKQFEGERVLHHSISESWQSIKSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDI 117
             GK+   ER LHHSISESWQ+IK +DY FLS  ++      S+VGILSSSDTSEEE ++
Sbjct: 60  TVGKR-RVERSLHHSISESWQAIKRSDYSFLSGTHEVG-AMHSSVGILSSSDTSEEEAEM 117

Query: 118 HXXXXXXXXXXXXFDSRIINIAGQAFSATLSHLRSXXXXXXXXTVTVSLPNTMTSLVMPK 177
                          S +  +        +    S        TVT+S+P++ TSLVMPK
Sbjct: 118 RPSAHGTVHLGSSLASPMRQL-------LVEEDNSCAEEDDCQTVTISMPSSSTSLVMPK 170

Query: 178 LSLSDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHD 237
           LSLS R+ E ++L+VGQPARKFW +IPK YQK+F++ +L ++   DV ++Y  +MV+FHD
Sbjct: 171 LSLSQRLGEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHD 230

Query: 238 MGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNXXXX 297
           +  APELLD +C K   P +IP+CQKGQK  L++LLK+Y +   I+++C+PI+MSN    
Sbjct: 231 IAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEK 290

Query: 298 XXXXXXXXXXSSGSDSGYETEVTVEXXXXXXXXXXXXXXXXXTFRDWVVWTASITIGIGI 357
                      + S+SGYETE+TV+                   R W +WTAS TIGIGI
Sbjct: 291 HRLLKHLHNLCNESESGYETELTVK-SKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGI 349

Query: 358 GCCVSLMVSTRYAFLVPRQLAVDDITSSPL-SPEGTDKSSHNLFLHAYSLCKTSLKKLAS 416
           GCC+SLM +TR+ F     L +  +  + + S   +DK  H L  H Y LCKT++++L +
Sbjct: 350 GCCISLMATTRFTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTIRQLGT 409

Query: 417 SLRPFFSDRLESCTWIHTLGIELSYDDSLISMGRIMPLDFIML 459
           SLR FF ++ ES TW+H  G++L  DD L S+GR+MPLDFIML
Sbjct: 410 SLRLFFFEKFESRTWVHIFGMDLHSDDPLASLGRLMPLDFIML 452

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  240 bits (613), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 168/458 (36%), Positives = 240/458 (52%), Gaps = 22/458 (4%)

Query: 16  NGGLPGTTQRSILDPHLSVLEILE------GKELNKVEG--PHELSGA-SRVSGKQFEGE 66
           +G +P   +RSILDPH SVL++LE       +++N+     P EL  A +R         
Sbjct: 21  SGSMP-FQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYP 79

Query: 67  RVLHHSISESWQSIKSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHXXXXXXXX 126
             L+ SIS+SWQSIK  DY  L+  +DTS  Q  AVGILSSSDTSEEE D H        
Sbjct: 80  EALNQSISDSWQSIKMVDYSILNSLHDTSSSQ--AVGILSSSDTSEEELD-HLNSPSPSS 136

Query: 127 XXXXFDSRIINIAGQA----FSATLSHLRSXXXXXXXXTVTVSLPNTMTSLVMPKLSLSD 182
                +   I+   QA     SATL +           TVTVSL  +  S VMP+LSLS 
Sbjct: 137 QQVFPNGPPISFQTQAGVLTASATLPN-PGVLEEDDNETVTVSLAASSNSFVMPQLSLSQ 195

Query: 183 RIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGLAP 242
           R    ++L+VG+PARKFW ++PK YQKMF+I     +    V   Y+ +M+IF D     
Sbjct: 196 RSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKVSH-YTAVMIIFQDTKEVS 254

Query: 243 ELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNXXXXXXXXX 302
            +LD +  K+    IIPICQ+GQKQ L+SLL+ +V   +I+L   P VMSN         
Sbjct: 255 FILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSNHQEIHKLLR 314

Query: 303 XXXXXSSGSDSGYETEVTVEXXXXXXXXXXXXXXXXXTFRDWVVWTASITIGIGIGCCVS 362
                S+  DSGYET+ T                   T   WV+W  S+T+G+GIGCC+S
Sbjct: 315 YLHRLSTEIDSGYETDET--HLKVRKRKKTHKKKSKGTSNRWVIWGLSLTVGVGIGCCIS 372

Query: 363 LMVSTRYAFLVPRQLAVDDITSSPLSPEGTDKSSHNLFL-HAYSLCKTSLKKLASSLRPF 421
            ++S+  + +     + DD+      P   DK+  N  +    +L + ++K+    L+ F
Sbjct: 373 FILSSYSSSVQIPHASRDDVVLVEEVPTLPDKAEGNGPIGQVITLLRKTVKQFNLVLKQF 432

Query: 422 FSDRLESCTWIHTLGIELSYDDSLISMGRIMPLDFIML 459
             +++ S +WI  +G EL  +DS  ++GR+  LD ++L
Sbjct: 433 IYEQVGSLSWIQRVGKELISEDSDGTVGRVAALDLVLL 470

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  190 bits (482), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 143/463 (30%), Positives = 227/463 (49%), Gaps = 32/463 (6%)

Query: 13  HTQNGGLPGTTQRSILDPHLSVLEILEGKELNKVEGPHELSG-----ASRVSGKQFEGER 67
           H     +P   + SILDPHLSVL++L+     + + P ELS       ++ +  +  G  
Sbjct: 26  HFATSSVPLNQRNSILDPHLSVLQLLD-----RADPPSELSSLKHGEIAKPATPRRSGFE 80

Query: 68  VLHHSISESWQSIKSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHXXXXXXXXX 127
            ++ SISESWQSIK TD   ++   D + Q     GILSSSDTSE+E D           
Sbjct: 81  SVNCSISESWQSIKHTDCSMVNTQGDATHQH---AGILSSSDTSEDEPDAQLSPSPNNFA 137

Query: 128 XXXFDSRIINIAGQAFSATL------SHLRSXXXXXXXXTVTVSLPNTMTSLVMPKLSLS 181
                + I   A     A+       S + +        TVT+SL N+  S VMPKLSL 
Sbjct: 138 FPNSATSIFPEAPHNLEASSLREYQNSEIANPREENDNETVTMSLMNSSNSFVMPKLSLI 197

Query: 182 DRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGLA 241
            +  +  +LIVG+PA++F+  IP++Y KMFE+  +  L  ++++ KYS +MVIF +    
Sbjct: 198 QQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMN-KYSAVMVIFGEPKEG 256

Query: 242 PELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNXXXXXXXX 301
            ELL+++        II +CQ+GQ+Q +S++L +Y   N I+L  +  VMS+        
Sbjct: 257 KELLEKVA--AHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLL 314

Query: 302 XXXXXXSSGSDSGYETEVTVEXXXXXXXXXXXXXXXXXTFRDWVVWTASITIGIGIGCCV 361
                 S+  DSGYETEV                      R WV+W+ S+T+G+G+G C+
Sbjct: 315 RYLNTLSTEVDSGYETEVGSRKIRKRRKSSKKRSPQITVNR-WVIWSISLTVGVGLGYCI 373

Query: 362 SLMVSTRYAFLVPRQLAVDDITSSPLSPEGTDKSSH-----NLFLHAYSLCKTSLKKLAS 416
           S ++S+  + L     + D++T      E    S H     N   H     K ++K++ S
Sbjct: 374 SCLLSSTSSTLSVTLRSGDEVTIM----EDIHNSPHESPFDNYLRHLLLAVKRAVKQVNS 429

Query: 417 SLRPFFSDRLESCTWIHTLGIELSYDDSLISMGRIMPLDFIML 459
           S + + S +     W+  +G E   + S  ++  +  LD +++
Sbjct: 430 SFKQYLSGQSLPVLWMQRIGKEWLSEASDPTLPGVTALDLVLV 472

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 140/460 (30%), Positives = 222/460 (48%), Gaps = 40/460 (8%)

Query: 22  TTQRSILDPHLSVLEILEGKELN---------KVEGPHELSGASRVSGKQFEGERVLHHS 72
             + SILDPHLSVL++LE  E++          +  PH LS +S            +  S
Sbjct: 26  NNRNSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSS---------SEPMGRS 76

Query: 73  ISESWQSIKSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHXXXXXXXXXXXXFD 132
           IS+SWQSI+ TDY  L+   +TS Q     GILSSSDTSE+E D                
Sbjct: 77  ISDSWQSIRHTDYSILNLIGETSHQ---PAGILSSSDTSEDEPDHFLSPSPNEYAFANGA 133

Query: 133 SRIINIAGQAFSA-TLSHLR-------SXXXXXXXXTVTVSLPNTMTSLVMPKLSLSDRI 184
             +   A  A    +L+ L+       +        TVT+SL N+  S VMPKLSL+  +
Sbjct: 134 KTVFPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKLSLAQPL 193

Query: 185 IESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGLAPEL 244
            +  +LIVG+PA++F+  IP++YQKMFE+C     + +DVD+ +S IMVIF D      L
Sbjct: 194 RKFSILIVGKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQ-FSAIMVIFTDPKNGQSL 252

Query: 245 LDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNXXXXXXXXXXX 304
           L+ +  +     II +CQ+GQ+Q +S+LL ++   + ++L  +  VMS+           
Sbjct: 253 LEMVTGR--SSNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLRYL 310

Query: 305 XXXSSGSDSGYETEVTVEXXXXXXXXXXXXXXXXXTFRDWVVWTASITIGIGIGCCVSLM 364
              S+  DS Y+TEV                      R WV+W+ S+T+G+GIG C+S +
Sbjct: 311 YTLSNEIDSEYDTEVGPRKVRKRRKSYKKRETPAAVNR-WVIWSISLTVGVGIGYCISCL 369

Query: 365 VSTRYA-----FLVPRQLAVDDITSSPLSPEGTDKSSHNLFLHAYSLCKTSLKKLASSLR 419
           +S+  +       +     +  I  +P+SP  T     N F       K ++K+++ S +
Sbjct: 370 LSSTMSVRGNTLTLHSSDEIALIEEAPISPHET--VLENYFRQLVLAFKKAVKQVSQSFK 427

Query: 420 PFFSDRLESCTWIHTLGIELSYDDSLISMGRIMPLDFIML 459
                      W+  +G +   + S  ++  +  LD +++
Sbjct: 428 QCLHGHSLPVLWMQRIGKDWMSEASDTTLPGVTALDLVLI 467

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  152 bits (383), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 140/501 (27%), Positives = 211/501 (42%), Gaps = 85/501 (16%)

Query: 24  QRSILDPHLSVLEILEGKELNKVEGPHE-LSG-ASRVSGKQFEGERVLHHSISESWQSIK 81
           +RSILDPHLSVLE+L      +   PHE L G  S + G         + SIS+SWQ+I 
Sbjct: 23  RRSILDPHLSVLELLRRPSDTR---PHEALKGEVSDIVGNCAGTTGTGNGSISQSWQTIH 79

Query: 82  STDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQD-------IHX---XXXXXXXXXXXF 131
             D   LS   +    Q +A GILSSSDTSE+E D       +H                
Sbjct: 80  RNDSC-LSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLE 138

Query: 132 DSRIINIA-----------GQAFSATLSHLRSXXXXXXXXTVTVSLPNTMTSLVMPKLSL 180
           D R +N+                +   S   S        T+T SL ++  S +MPKLSL
Sbjct: 139 DYRSLNVGIPLVLPEDSNNINNNNKNGSTTGSNGEEDDNDTITKSLNSSSNSFIMPKLSL 198

Query: 181 SDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDE--KYSTIMVIFHDM 238
           S +  + ++L++G+P  KF+ SIPK YQ MFE+      R  D  E  +Y+ I+V+F ++
Sbjct: 199 SQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELP-----RSHDPAEFKQYTGILVVFQEL 253

Query: 239 GLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNXXXXX 298
                LL+R+C       +IP+CQ GQ+Q + +LL+  +    + L   P+V++N     
Sbjct: 254 KEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLL 313

Query: 299 XX----XXXXXXXSSGSDSGYETEVT----------------VEXXXXXXXXXXXXXXXX 338
                        S  SD   E                    +E                
Sbjct: 314 GMFRFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKKRHNN 373

Query: 339 XTFRDWVVWTASITIGIGIGCCVSLMVSTRYAFLVPRQLAVDDITSSPLSPEGTDKSSHN 398
                WV+W  S+T+G+G+G C+S +VS+ +  L          T++PL P   +  S +
Sbjct: 374 EKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISL----------TTNPLGPVDPESVSKD 423

Query: 399 LFL--------------------HAYSLCKTSLKKLASSLRPFFSDRLESCTWIHTLGIE 438
           LF+                    HA  L K +LK+   +++ F    L     I      
Sbjct: 424 LFVFDRQELKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANC- 482

Query: 439 LSYDDSLISMGRIMPLDFIML 459
           L +  S     R++ L ++ML
Sbjct: 483 LEWPTSDEHTNRVLALGYVML 503

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score =  134 bits (337), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 122/493 (24%), Positives = 204/493 (41%), Gaps = 63/493 (12%)

Query: 24  QRSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHSI---------S 74
           + SILDPH SV+++L G++    +    L     +  ++ +   + H+ I         +
Sbjct: 38  RHSILDPHDSVMDLLNGQQSCAFDS--RLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLT 95

Query: 75  ESWQSIKSTDYLFLSRANDTSLQQQS------AVGILSSSDTSEEEQDIHXXXXXXXXXX 128
           +SWQ+I   +Y FL+  N  +    S        G + SSDTSEEE +I+          
Sbjct: 96  DSWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSAS 155

Query: 129 XXFDSRI------INIAGQAFSATLSHLRSX------------------XXXXXXXTVTV 164
              +  +           Q  S T  H  S                          T+ V
Sbjct: 156 QQHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMV 215

Query: 165 SLPNTMTS--LVMPKLSLSDRIIESKVLIV--GQPARKFWFSIPKSYQKMFEICSLSVLR 220
           +L ++      VMPKLSLS+ +   K+LI+  G  A  F+  + + ++ MF++  L+   
Sbjct: 216 NLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEAS 275

Query: 221 DKDVDEKYSTIMVIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGN 280
            K+   KY+  M+IF D      +L+R+  K     +IPICQKGQKQ ++  +K + + N
Sbjct: 276 -KEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSN 334

Query: 281 RIKLFCNPIVMSNXXXXXXXXXXXXXXSSGSDSGYETEVTVEXXXXXXXXXXXXXXXXXT 340
           +IKL   P+V+S+                  DS YET++  +                  
Sbjct: 335 KIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIPKKTKPRKGAKKKPAPHLA-- 392

Query: 341 FRDWVVWTASITIGIGIGCCVSLMVS--------TRYAFLVPRQLAVDDI------TSSP 386
            + W  W  SI +G+GIGCCV+   S        +    +      +D I       S  
Sbjct: 393 -KRWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVDAIEGNSPS 451

Query: 387 LSPEGTDKSSHNLFLHAYSLCKTSLKKLASSLRPFFSDRLESCTWIHTLGIELSYDDSLI 446
           +  E + +S  +       L K +  ++   L+ F S  L +  WI ++G E    DS  
Sbjct: 452 ILEESSPQSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSIGKEFMQPDSQS 511

Query: 447 SMGRIMPLDFIML 459
           ++ ++  LD +M 
Sbjct: 512 TISKVTALDLVMF 524

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  128 bits (322), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 117/394 (29%), Positives = 162/394 (41%), Gaps = 68/394 (17%)

Query: 25  RSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHSISESWQSIKSTD 84
           R +LDPHLSVLE+L GK       P  + G S V+     G + ++ SIS SWQ+I+  D
Sbjct: 39  RGLLDPHLSVLELL-GK---TGHSPSPM-GQSLVTSIDISGHQNVNDSISGSWQAIQPLD 93

Query: 85  YLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHXXXXXXXXXXXXFDSRIINIAGQAFS 144
            L  S   +    Q +   ILSSSDTSEEEQ++               + IINI  Q   
Sbjct: 94  -LGASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPA----------ADIINIIKQGQE 142

Query: 145 AT--------------------------------LSHLRSXXXXXXXXTVTVSLPNTMTS 172
            T                                ++            T+T SL ++  S
Sbjct: 143 GTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNS 202

Query: 173 LVMPKLSLSDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIM 232
            VMPKLSLS +    ++LI+G+    F+ SIPK YQ +FE   L    D     +Y+ I+
Sbjct: 203 FVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEYQSLFE---LPKYHDSATFPQYTGII 259

Query: 233 VIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMS 292
           +IF ++     LL+RI        IIPICQ GQ   + ++LK ++    IKL   P+V++
Sbjct: 260 IIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVT 319

Query: 293 NXXXXXXXXXXXXXXS----------------SGSDSGYE-TEVTVEXXXXXXXXXXXXX 335
           N              S                + S S Y   +                 
Sbjct: 320 NRKDLKKMFQRLQDLSLEYAEDENEEGDDDETTKSRSYYRYKKANNSKRKSPKSNKKPKK 379

Query: 336 XXXXTFRDWVVWTASITIGIGIGCCVSLMVSTRY 369
                F  W  W  SITIGI  GCCV+  V+  Y
Sbjct: 380 KKQRFFTSWFTWGISITIGISFGCCVTYFVTAAY 413

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  124 bits (312), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 140/284 (49%), Gaps = 30/284 (10%)

Query: 24  QRSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHH---SISESWQSI 80
           ++S+LDPHLSVLE+LE             +G ++  G+  E    + +   SIS SWQ+I
Sbjct: 28  KKSLLDPHLSVLELLE------------RTGDTQRVGRGVEKADDMANTTNSISSSWQAI 75

Query: 81  KSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHXXXXXXXXXXX----------- 129
              D +        S  Q +AVGILSSSDTSEEE D                        
Sbjct: 76  HRNDAMITGVPERCS-SQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPF 134

Query: 130 XFDSRIINIAGQAFSATLSHLRSXXXXXXXXTVTVSLPNTMTSLVMPKLSLSDRIIESKV 189
             D  +I  A     +  +            T+T SL N+  S VMPKLSLS +  + ++
Sbjct: 135 KLDVPVILPARDQEPSGQTQTPDNDDERDDETLTKSLSNSSNSFVMPKLSLSQKSHKLRI 194

Query: 190 LIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGLAPELLDRIC 249
           LI+G+P  KF+ SIPK YQ  FE   LS L+D     +++ I+++F ++     LL+R+C
Sbjct: 195 LILGRPGLKFYQSIPKRYQHFFE---LSRLQDPSEFRQFTGILIVFQELKEMVSLLNRVC 251

Query: 250 NKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSN 293
                  +IP+CQ GQ Q + ++L+  +    I L   P+V+SN
Sbjct: 252 QCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISN 295

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 22/131 (16%)

Query: 344 WVVWTASITIGIGIGCCVSLMVSTRYAFLVPRQLAV-------DDITSSPLSPEGTDKSS 396
           W+VW  S+T+G+G+G C+S   S+    +  + +A        D++     S  G  +  
Sbjct: 366 WIVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMGEYD 425

Query: 397 HNL---FLHAYSLCKTSLKKLASSLRPFFSDRLE-----SCTWIHTLGIELSYDDSLISM 448
           H+L   F HA  L K +LK+   +++ F    L      S T     G E   D+S    
Sbjct: 426 HDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAE---DNS---- 478

Query: 449 GRIMPLDFIML 459
            R++ L +I+L
Sbjct: 479 NRVLALGYILL 489

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  120 bits (302), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 112/396 (28%), Positives = 159/396 (40%), Gaps = 70/396 (17%)

Query: 25  RSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHSISESWQSIKSTD 84
           + +LDPHLSVLE+L     +K        G + V+     G   ++ SIS SWQ+I+  D
Sbjct: 39  KGLLDPHLSVLELL-----SKTGHSPSPMGQNLVTSIDISGNHNVNDSISGSWQAIQPLD 93

Query: 85  YLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHXXXXXXXXXXXXFDSRIINIAGQ--- 141
            L  S   +    Q +   ILSSSDTSEEEQ++               + IINI  Q   
Sbjct: 94  -LGASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPA----------ADIINIIKQGQE 142

Query: 142 -AFSATLSH----------------------------LRSXXXXXXXXTVTVSLPNTMTS 172
            A   + SH                                       T+T SL ++  S
Sbjct: 143 GANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGDEDEAFEEDSVTITKSLTSSTNS 202

Query: 173 LVMPKLSLSDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIM 232
            VMPKLSL+ +    ++LI+G+    F+ SIPK YQ +FE   L    D     +Y+ I+
Sbjct: 203 FVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFE---LPKYHDSATFPQYTGIV 259

Query: 233 VIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMS 292
           +IF ++     LL+RI        +IPICQ GQ   + ++LK ++    +KL   P+V++
Sbjct: 260 IIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNKLVKLLFPPVVVT 319

Query: 293 NXXXXXXXXXXXXXXS--SGSDSGYE-----------------TEVTVEXXXXXXXXXXX 333
           N              S   G D   E                  +               
Sbjct: 320 NKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYCRNKKAENSKKKSPKSNKKP 379

Query: 334 XXXXXXTFRDWVVWTASITIGIGIGCCVSLMVSTRY 369
                  F  W  W  SITIGI  GCCV+  V+  Y
Sbjct: 380 KRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAY 415

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  103 bits (257), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 92/296 (31%), Positives = 132/296 (44%), Gaps = 36/296 (12%)

Query: 25  RSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHSISESWQSIKSTD 84
           + +LDPHLSVLE+L GK       P  L G S V+         +  +IS SWQ+I+  D
Sbjct: 39  KGLLDPHLSVLELL-GK---TGSSPSPL-GQSLVTSIDISNHHNVIDNISGSWQTIQPLD 93

Query: 85  YLFLSRANDTSLQQQSAVGILSSSDTSEEEQDI-------------------------HX 119
            L  S   +    Q +   ILSSSDTSEEEQD+                         H 
Sbjct: 94  -LGASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPSHP 152

Query: 120 XXXXXXXXXXXFDSRIINIAGQAFSATLSHLRSXXXXXXXXTVTV--SLPNTMTSLVMPK 177
                         R     G+                   +VT+  SL ++  S VMPK
Sbjct: 153 FKQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVMPK 212

Query: 178 LSLSDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHD 237
           LSLS +    ++LI+G+    F+ S PK YQ +FE   L    D  +  +Y+ I+++F +
Sbjct: 213 LSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFE---LPKSHDSTIFPQYTGIVIVFQE 269

Query: 238 MGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSN 293
           +     LL+RI        IIPICQ GQ   + ++LK ++  + IKL   P+V +N
Sbjct: 270 LREMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVATN 325

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 18/34 (52%)

Query: 344 WVVWTASITIGIGIGCCVSLMVSTRYAFLVPRQL 377
           W  W  SITIGI  GCCV+  V+  Y     R L
Sbjct: 399 WFTWGVSITIGISFGCCVTYFVTAAYDHQTIRSL 432

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  100 bits (250), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 96/308 (31%), Positives = 138/308 (44%), Gaps = 59/308 (19%)

Query: 25  RSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHSISESWQSIKSTD 84
           + +LDPHLSVLE+L GK       P  + G S V+         ++ SIS SWQ+I   D
Sbjct: 39  KGLLDPHLSVLELL-GK---TGHSPSPM-GHSLVTSIDISSHHYVNDSISGSWQAIHPLD 93

Query: 85  YLFLSRANDTSLQQQSAVGILSSSDTS-EEEQDIHXXXXXXXXXXXXFDSRIINI--AGQ 141
            L  S   + S  Q +   ILSSSDTS EE++ +               + IINI   GQ
Sbjct: 94  -LGASFVPERSSSQTTNGSILSSSDTSEEEQELLQAPA-----------ADIINIIKQGQ 141

Query: 142 AFSATLSHLR------------------------------------SXXXXXXXXTVTVS 165
             ++  S  R                                             T+T S
Sbjct: 142 EGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQDDDDNNVDDDYDDGAYEEDSGTITKS 201

Query: 166 LPNTMTSLVMPKLSLSDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVD 225
           L ++  S VMPKLSLS +    ++LI+G+    F+ SIPK +Q +FE   L    D    
Sbjct: 202 LTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFE---LPKYHDSTAF 258

Query: 226 EKYSTIMVIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLF 285
            +Y+ I++IF ++     LL+RI        IIPICQ GQ   + ++LK ++    IKL 
Sbjct: 259 PQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLL 318

Query: 286 CNPIVMSN 293
             P+V++N
Sbjct: 319 YPPVVVTN 326

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 15/26 (57%)

Query: 344 WVVWTASITIGIGIGCCVSLMVSTRY 369
           W  W  SITIGI  GCCV+   +  Y
Sbjct: 398 WFTWGVSITIGISFGCCVTYFATAAY 423

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 94/208 (45%), Gaps = 18/208 (8%)

Query: 173 LVMPKLSLSDRIIESK-VLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTI 231
            VMPKLSL+ +  ++K +L+VG+ +++F   IP+ Y++ F I   S   D    + Y  I
Sbjct: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSS---DPSEFQNYIGI 251

Query: 232 MVIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVM 291
           +++F ++     +L+RI     +  IIPICQ GQ+  + ++LK ++  + I L+  P+ +
Sbjct: 252 VIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTI 311

Query: 292 SNXXXXXXXXXXXXXXS------------SGSDSGYETEVTVEXXXXXXXXXXXXXXXXX 339
           +N                           S SD     E +                   
Sbjct: 312 ANEKSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSDETS--GYRKNNRRKKHGGKPST 369

Query: 340 TFRDWVVWTASITIGIGIGCCVSLMVST 367
            +  W+ W  S+TIG+ IG   + M++T
Sbjct: 370 NYSKWITWGISLTIGVSIGYYATYMITT 397

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 26/77 (33%)

Query: 26  SILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHS--ISESWQSIKST 83
           SILDPH SV+E+L+                     +Q EG  V   S  + ESWQ I+ +
Sbjct: 28  SILDPHHSVMELLQ---------------------RQMEGSEVPSESGVLGESWQQIRES 66

Query: 84  DYLFLSRANDTSLQQQS 100
           D   +    D++  QQS
Sbjct: 67  D---VGDGGDSNFDQQS 80

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 104/430 (24%), Positives = 179/430 (41%), Gaps = 60/430 (13%)

Query: 26  SILDPHLSVLEILEGKELNKVEGPHELSGASRVSGK-QFEGERVLHHSISESWQSIKSTD 84
           S+LDPHLSVLE+LE K   +  G  E  G+SR  G  Q +        +SESW +++  +
Sbjct: 7   SVLDPHLSVLELLE-KSCER-GGHAEAPGSSRNKGAGQIQ--------LSESWCTVERDE 56

Query: 85  YLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHXXXXXXXXXXXXFDSRIINIAG--QA 142
              + R    S  QQ+  G+LSSSDTSEE +                D+R+   A   Q+
Sbjct: 57  LSAMER----SASQQTNNGVLSSSDTSEEGEP-EQGSPGDGEGGGVADTRMARPAMSLQS 111

Query: 143 FSATLSHLRSXXXXXXXXTVTVSLPNTMTSLVMPKL-------------SLSDRIIESKV 189
            S+TL  +          TV+ SL ++  S +MPKL             +L  R    KV
Sbjct: 112 TSSTLDGVDD-----DSATVSKSLTSSSNSFIMPKLYTTVAGAPSTVSTALQTRCF--KV 164

Query: 190 LIVGQPARKF-WFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGLAPELLDRI 248
            ++G+ A KF   ++P+ ++  FE+   + + D         I+++  ++     LL+R+
Sbjct: 165 AVLGRGAVKFCQETVPEQFRHRFEL--TAGVHDLAQCADRQGILIVVQEVRELISLLNRV 222

Query: 249 CNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNXXXXXXXXXXXXXXS 308
                   ++ +  + ++  + ++L+ +     + L   P+ +SN              +
Sbjct: 223 HCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRLVSLLHPPVPLSNNEALDKMFHFVDNLA 282

Query: 309 SGSDSG----YETEVTVEXXXXXXXXXXXX--XXXXXTFRDWVVWTASITIGIGIG-CCV 361
              +       + + T E                   TF+ W++W  SI++GIG G  CV
Sbjct: 283 RQQEPAGVIHNDPQTTQEQHPDHNEDDPHRGPSKPEGTFKRWLLWGVSISLGIGAGYYCV 342

Query: 362 SLMVSTRYAFLVPRQLAVDDI----------TSSPLSPEGTDK--SSHNLFLHAYSLCKT 409
           S +VS+            D             ++  +P G D    SH    H  S+ K 
Sbjct: 343 SYVVSSSMCVSCFNFRHTDHTLAATTSTAAAAAAAATPSGIDHDADSHTTLRHCLSIVKN 402

Query: 410 SLKKLASSLR 419
           SLK+  + ++
Sbjct: 403 SLKRATAFVK 412

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 76/135 (56%), Gaps = 7/135 (5%)

Query: 162 VTVSLPNTMTSLVMPKLSLSDRIIESKVLIVGQPAR-KFWFSIPKSYQKMFEICSLSVLR 220
           +T S+ ++  S +MPKLS ++   + ++LI+G      F+ +IP SY+ +FE+       
Sbjct: 325 LTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPP----N 380

Query: 221 DKDVDEK-YSTIMVIFHDMGLAPELLDRICNKVVRPR-IIPICQKGQKQHLSSLLKQYVS 278
           + D + K Y+ I ++ HD+     +L++I    +  + IIPIC+KGQ   + ++LK Y+ 
Sbjct: 381 NFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIK 440

Query: 279 GNRIKLFCNPIVMSN 293
              + L   PIV +N
Sbjct: 441 TKDLSLLYPPIVGTN 455

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 25/118 (21%)

Query: 24  QRSILDPHLSVLEILEGKELNKVEGPHELSGAS----------------RVSGKQFEG-- 65
           +R  LDPH S++E+LE  + +  E  +E +  +                 +SG   +   
Sbjct: 24  KRGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRLELSGMNVDDIN 83

Query: 66  -----ERVLHHSISESWQSIKSTDY--LFLSRANDTSLQQQSAVGILSSSDTSEEEQD 116
                   L  S+S SWQ I++ DY  L +  +N  +    + VGILSS+D+SEEEQD
Sbjct: 84  SENQESSELSQSLSNSWQRIQTPDYSPLDVKDSNSINNINNNTVGILSSTDSSEEEQD 141

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 19/26 (73%)

Query: 345 VVWTASITIGIGIGCCVSLMVSTRYA 370
           + WT S+++G+G+G C+S   ST ++
Sbjct: 614 IYWTVSLSVGVGLGFCLSYYASTIFS 639

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 90/306 (29%), Positives = 144/306 (47%), Gaps = 40/306 (13%)

Query: 3   QTVEKMQSNGHTQNGGLPGTTQRSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQ 62
           + +E++Q +    N        +S+LDPHLSVLE+LE K+ + V     +  +SR     
Sbjct: 14  RVLEEVQESAGMDNHNDSSECVKSLLDPHLSVLEMLERKDNDTV-----MEASSR----- 63

Query: 63  FEGERVLHHSISESWQSIKS-TDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHXXX 121
                     IS SWQ+I+S  D   L  A  + +    ++   SS  + EE   I+   
Sbjct: 64  ----------ISRSWQNIESPADSKQLLSAKSSQVSNLVSILSSSSDTSDEEVDRINSLN 113

Query: 122 XXXXXXXXXFD--SRIIN-IAGQAFSATLSHLRSXXXXXXXXTVTVSLPNTMT---SLVM 175
                    ++  S + N I    F+   +            T+T SL ++ T   S VM
Sbjct: 114 SAGEGSSKNYNNPSPLQNPIYLPEFTDVTA---GDNDDGIASTITKSLTSSSTISNSFVM 170

Query: 176 PKLSLSDRIIESK---VLIVGQPARKFWFSIPKSYQKMFEICS-LSVLRDKDVDEKYSTI 231
           P LSLS    + +   +LI G+    F+ +IPK YQ +F + + L+ L   ++D  ++  
Sbjct: 171 PTLSLSSSQSQQRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDN-FTAF 229

Query: 232 MVIFHDMGLAPELLDRICN----KVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCN 287
           ++IF ++     LL+RI      K V P IIPICQ GQK  + S+LK ++  N + L   
Sbjct: 230 LIIFEELKELVSLLNRISEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLLS- 288

Query: 288 PIVMSN 293
           PI++ N
Sbjct: 289 PIIIIN 294

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 16/91 (17%)

Query: 344 WVVWTASITIGIGIGCCVSLMVSTRYAFLVPRQLAVDDITSSPLSPEGTDKSSHNL---- 399
           WVVW+ S+T+G G+G  +S  V      L P +         PLS     KS+ NL    
Sbjct: 382 WVVWSISLTVGAGMGYIISYCVFNSSKRL-PLEKIAHQTRPGPLSSLIHLKSNKNLLYLE 440

Query: 400 -----------FLHAYSLCKTSLKKLASSLR 419
                      F + +  CK ++ +L S+ +
Sbjct: 441 RTTPNDYSWSYFQNTWEFCKETVNQLNSTFK 471

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 70/131 (53%), Gaps = 16/131 (12%)

Query: 173 LVMPKLSLSDR------IIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDE 226
            +MP+LSL+ +        E ++LIVG+ + K +  IP  +Q +F++      +  D++E
Sbjct: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQNLFQLQ-----KSYDINE 278

Query: 227 --KYSTIMVIFHDMGLAPELLDRIC--NKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRI 282
             K++ I+V+  +      LL+RI    KV RP +I IC+K       ++LK Y+  + I
Sbjct: 279 YQKFTAILVVIQETRELISLLNRISRSEKVKRP-LIAICEKDAFLQCKNVLKSYLRNDLI 337

Query: 283 KLFCNPIVMSN 293
            L   P V+SN
Sbjct: 338 TLLYQPFVISN 348

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 58/124 (46%), Gaps = 14/124 (11%)

Query: 341 FRDWVVWTASITIGIGIGCCVSLMVSTRYAFLV----PRQLAVDDITSSPLSPEG----- 391
           +  W++W  S++IG+GIG C+S   S+ ++ LV    P   ++      PLS E      
Sbjct: 434 YNKWIIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATVPVPLSNESFVLLH 493

Query: 392 ---TDKSSHNLFLHAYSLCKTSLKKLASSLRPFFSDRLESCTWIHTLGIELSYDDSLISM 448
               D  +   F  + +  K S+ K+   ++      L + ++++  G+      SL+++
Sbjct: 494 DSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLN--GLNTDDASSLLAL 551

Query: 449 GRIM 452
           G I+
Sbjct: 552 GYIL 555

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
           (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 46/88 (52%), Gaps = 17/88 (19%)

Query: 344 WVVWTASITIGIGIGCCVSLMVSTRYAFLVPRQLAVDDITS-SPLSP-------EGTDKS 395
           +V +  SIT+G+G+G C+S +V ++ +         +DI S  P +P       E  D +
Sbjct: 308 FVYYGISITLGVGVGYCISSLVVSQNS---------NDIQSIVPSTPNNDIIALESQDLN 358

Query: 396 SHNLFLHAYSLCKTSLKKLASSLRPFFS 423
           SHN   + ++  K S+K + S L+ F +
Sbjct: 359 SHNGDDYNWNFLKLSIKNVYSILKRFIT 386

>ZYRO0B13354g Chr2 (1081872..1086134) [4263 bp, 1420 aa] {ON} similar
            to uniprot|Q06698 Saccharomyces cerevisiae YLR419W
            Hypothetical ORF
          Length = 1420

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 3/89 (3%)

Query: 372  LVPRQLAVDDITSSPLSPEGTDKSSHNLFLHAYSLCKTSLKK-LASSLRPFFSDRLESCT 430
            L  ++L  +D+   P+ PE    S  +L+L   S+    +KK LA+ L P     LE  +
Sbjct: 982  LFSKRLYQEDMIPMPI-PEIKRVSLESLYLSVKSMGIKDVKKFLATGLDPPPLKTLERAS 1040

Query: 431  -WIHTLGIELSYDDSLISMGRIMPLDFIM 458
              + T+G+   YDDSL  +G+ + +  +M
Sbjct: 1041 AMLTTVGLLNEYDDSLTELGKFISMMPVM 1069

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,329,403
Number of extensions: 1503840
Number of successful extensions: 4084
Number of sequences better than 10.0: 21
Number of HSP's gapped: 4104
Number of HSP's successfully gapped: 44
Length of query: 459
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 346
Effective length of database: 40,524,141
Effective search space: 14021352786
Effective search space used: 14021352786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)