Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40205.700ON1125112553590.0
AFR284W5.700ON1103110229460.0
SAKL0E14872g5.700ON1140113128210.0
KLLA0A00638g5.700ON1155113927800.0
ZYRO0G06644g5.700ON1166112827020.0
Kwal_55.197075.700ON1143112926880.0
KNAG0L021105.700ON1200118726670.0
CAGL0H06567g5.700ON1169115126500.0
TDEL0B022105.700ON1095110925750.0
KAFR0D022405.700ON1187119425740.0
Kpol_2001.745.700ON1113112025300.0
Kpol_1043.685.700ON1042109822870.0
NCAS0G002505.700ON118394121990.0
TPHA0E002505.700ON1068108221560.0
TBLA0E021005.700ON1140113719740.0
TPHA0D045905.700ON112768317610.0
Smik_9.225.700ON123072517230.0
TBLA0I016805.700ON121474116890.0
KLTH0E01100g5.700ON117769215850.0
NDAI0F003105.700ON125952514271e-177
Skud_9.215.700ON122148613391e-164
YIL147C (SLN1)5.700ON122048513361e-164
Suva_9.415.700ON121947713221e-162
ADL388W4.385ON4821721905e-14
Ecym_74744.385ON4961441817e-13
KNAG0M001804.385ON6151261782e-12
CAGL0F09097g4.385ON6301421764e-12
KAFR0B069904.385ON5451261737e-12
TDEL0D003204.385ON5471261737e-12
NCAS0A064504.385ON6091261711e-11
SAKL0B12408g4.385ON4651261682e-11
KLLA0A10219g4.385ON4751261682e-11
KLTH0D17182g4.385ON4641261656e-11
TBLA0A107004.385ON5871261666e-11
Smik_8.2964.385ON6251301657e-11
ZYRO0G00484g4.385ON6471261649e-11
Suva_15.4124.385ON6171271641e-10
YHR206W (SKN7)4.385ON6221271631e-10
Kpol_265.24.385ON5491451621e-10
Skud_8.2734.385ON6231271631e-10
Kwal_47.167704.385ON4611261575e-10
NDAI0D034304.385ON5971491576e-10
TPHA0C001504.385ON5101261451e-08
KAFR0J007005.230ON6201251443e-08
Suva_10.845.230ON6951681391e-07
Ecym_50775.230ON7951481344e-07
KNAG0B051405.230ON6481501335e-07
ADR343C5.230ON7491481301e-06
ZYRO0A11154g5.230ON7761741282e-06
KLTH0B02684g5.230ON5951681263e-06
YLR006C (SSK1)5.230ON7121681264e-06
NCAS0D029005.230ON7621601254e-06
Kwal_33.152885.230ON5871711255e-06
TDEL0E039805.230ON7301401221e-05
Skud_12.725.230ON7021681221e-05
CAGL0D02882g5.230ON6671661192e-05
Smik_12.685.230ON7121681165e-05
NDAI0I020005.230ON8901641166e-05
TPHA0N008505.230ON6701511166e-05
KLLA0E09505g5.230ON635721131e-04
Kpol_1004.45.230ON7141501085e-04
TBLA0D031705.230ON7651501040.001
ACR218W8.34ON1569125980.008
KLTH0G18612g8.34ON1524144920.041
SAKL0G12100g5.230ON73871910.044
Klac_YGOB_Anc_8.348.34ON157196910.052
KLLA0E04533g7.222ON42181830.34
Ecym_15088.34ON1694128820.56
TBLA0E049804.385ON791125810.77
Ecym_30206.16ON94471754.1
KLLA0D01133g6.20ON106752754.5
TDEL0C005908.34ON160276746.1
YFL033C (RIM15)8.34ON177076729.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4020
         (1125 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...  2068   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...  1139   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1091   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...  1075   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1045   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1040   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...  1031   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...  1025   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   996   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   996   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   979   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   885   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   851   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   835   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   764   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   682   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   668   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   655   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   615   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   554   e-177
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   520   e-164
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   519   e-164
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   513   e-162
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    78   5e-14
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    74   7e-13
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    73   2e-12
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    72   4e-12
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    71   7e-12
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    71   7e-12
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    70   1e-11
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    69   2e-11
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    69   2e-11
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    68   6e-11
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    69   6e-11
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    68   7e-11
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    68   9e-11
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    68   1e-10
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    67   1e-10
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    67   1e-10
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    67   1e-10
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    65   5e-10
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     65   6e-10
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    60   1e-08
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    60   3e-08
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    58   1e-07
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    56   4e-07
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    56   5e-07
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    55   1e-06
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    54   2e-06
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    53   3e-06
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    53   4e-06
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    53   4e-06
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    53   5e-06
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    52   1e-05
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    52   1e-05
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    50   2e-05
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    49   5e-05
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    49   6e-05
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    49   6e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    48   1e-04
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    46   5e-04
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    45   0.001
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    42   0.008
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    40   0.041
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    40   0.044
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    40   0.052
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    37   0.34 
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    36   0.56 
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    36   0.77 
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...    33   4.1  
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...    33   4.5  
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    33   6.1  
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    32   9.9  

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score = 2068 bits (5359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1024/1125 (91%), Positives = 1024/1125 (91%)

Query: 1    MALLFIKKHLSIPTTRRIRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTT 60
            MALLFIKKHLSIPTTRRIRKHMFRPPYKAGLSTQLT                TTGVYFTT
Sbjct: 1    MALLFIKKHLSIPTTRRIRKHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTT 60

Query: 61   NYKSLRADRLTVAAQLTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDN 120
            NYKSLRADRLTVAAQLTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDN
Sbjct: 61   NYKSLRADRLTVAAQLTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDN 120

Query: 121  AKEVLVKFLDSSNSIFRTHLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXX 180
            AKEVLVKFLDSSNSIFRTHLYDSAFNEVLSVSTNSTGN                      
Sbjct: 121  AKEVLVKFLDSSNSIFRTHLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSS 180

Query: 181  XXXXGMLSNPVFNGSSFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPA 240
                GMLSNPVFNGSSFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPA
Sbjct: 181  IIDDGMLSNPVFNGSSFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPA 240

Query: 241  LNGSTVSVLAGVYDENNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGS 300
            LNGSTVSVLAGVYDENNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGS
Sbjct: 241  LNGSTVSVLAGVYDENNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGS 300

Query: 301  VSKTNAFYEPNVAVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFIC 360
            VSKTNAFYEPNVAVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFIC
Sbjct: 301  VSKTNAFYEPNVAVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFIC 360

Query: 361  IVTFIVANWAVKPIVRLQKATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLR 420
            IVTFIVANWAVKPIVRLQKATELIAAGRGL                     KGSPSPTLR
Sbjct: 361  IVTFIVANWAVKPIVRLQKATELIAAGRGLRSYRHSSRSSSRTTSINRSNSKGSPSPTLR 420

Query: 421  EGDGLRKTPPSPYTPMHSHVEPNPSGIGREYSVDIARAIGIEVPSSHPSERVDAFTTSAN 480
            EGDGLRKTPPSPYTPMHSHVEPNPSGIGREYSVDIARAIGIEVPSSHPSERVDAFTTSAN
Sbjct: 421  EGDGLRKTPPSPYTPMHSHVEPNPSGIGREYSVDIARAIGIEVPSSHPSERVDAFTTSAN 480

Query: 481  WIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESAN 540
            WIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESAN
Sbjct: 481  WIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESAN 540

Query: 541  EAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXX 600
            EAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSG            
Sbjct: 541  EAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELLT 600

Query: 601  FSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNR 660
            FSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNR
Sbjct: 601  FSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNR 660

Query: 661  IIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDETKNV 720
            IIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDETKNV
Sbjct: 661  IIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDETKNV 720

Query: 721  FDTITEEKYVSCSGESTDDTIETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIP 780
            FDTITEEKYVSCSGESTDDTIETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIP
Sbjct: 721  FDTITEEKYVSCSGESTDDTIETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIP 780

Query: 781  AVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGG 840
            AVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGG
Sbjct: 781  AVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGG 840

Query: 841  TGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQS 900
            TGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTV             NAQS
Sbjct: 841  TGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQS 900

Query: 901  KINRRVKFKLNKGGKSRQSSLSVPEISGVPDSPLNSMGXXXXXXXXXXXXXDRPFLQSTG 960
            KINRRVKFKLNKGGKSRQSSLSVPEISGVPDSPLNSMG             DRPFLQSTG
Sbjct: 901  KINRRVKFKLNKGGKSRQSSLSVPEISGVPDSPLNSMGRSESELSVSSVRVDRPFLQSTG 960

Query: 961  TATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVAN 1020
            TATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVAN
Sbjct: 961  TATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVAN 1020

Query: 1021 LTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMD 1080
            LTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMD
Sbjct: 1021 LTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMD 1080

Query: 1081 GFLSKPIKREKLRKILLEYCPVLNKSVSTTTNRGLEDPLFVNSGL 1125
            GFLSKPIKREKLRKILLEYCPVLNKSVSTTTNRGLEDPLFVNSGL
Sbjct: 1081 GFLSKPIKREKLRKILLEYCPVLNKSVSTTTNRGLEDPLFVNSGL 1125

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score = 1139 bits (2946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/1102 (54%), Positives = 766/1102 (69%), Gaps = 22/1102 (1%)

Query: 17   RIRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQL 76
            R R  + +PP+KAGL TQLT                TTGVYFT+NY++LRADRL VAA+L
Sbjct: 7    RKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAARL 66

Query: 77   TSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIF 136
             S+Q++Q+L ++YYQC  LS++D+IQNAL  Y+ GN S+ N   A ++L  FL+ S + +
Sbjct: 67   MSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFY 126

Query: 137  RTHLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSS 196
              +LYD  + EVLS   N T                             + + P +N + 
Sbjct: 127  IAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTL 185

Query: 197  FFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDEN 256
              MSM+LPV  +AS +  + + VG++T+VMSAD +++V      L  S VS+L G+ ++ 
Sbjct: 186  NLMSMTLPV--EASTIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDK 242

Query: 257  NILNSYQVLFPPSIVQVPR-LLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYE------ 309
              L  Y+ +FPP   +  R + E  +PI N SFL +AF+NRS   V+ T++FY       
Sbjct: 243  GNLVKYRFVFPPG--ETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGH 300

Query: 310  --PNVAVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVA 367
                VAVGY+AC F+ ++WVAVV+Q E+VFLSP+ KLTKIIIGTV+G+A F+CIVTFI+A
Sbjct: 301  DFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILA 360

Query: 368  NWAVKPIVRLQKATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLREGDGLRK 427
            +WAVKPIVRLQKATE IAAGRGL                     +GS     RE    +K
Sbjct: 361  SWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFE-KK 419

Query: 428  TPPSPY-TPMHSHVEPNPSGIG--REYSVDIARAIGIEVPSSHPSERVDAFTTSANWIET 484
               SP+ T  H+    + S +     Y   IAR    E  ++  S+     T++ NWI+T
Sbjct: 420  HHVSPFVTENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGSTSATNWIDT 479

Query: 485  RVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKT 544
            RVPVYRRLF+DELSELTDTFN+MTDELDR Y +LEDRVRARTKQLEAAKIQAE+ANEAKT
Sbjct: 480  RVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAKIQAEAANEAKT 539

Query: 545  MFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFSKN 604
            +FIANI HELRTPLNGILGMTAIAMAE D EK+QNSLKLIFRSG            FSKN
Sbjct: 540  VFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLHILTELLTFSKN 599

Query: 605  ILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQI 664
            +LKR KLE+R+FS++D+ALQVKSIFGKLAKDQ+VK SI+LMPN IR MVLWGDSNRIIQI
Sbjct: 600  VLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQI 659

Query: 665  VMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDETKNVFDTI 724
            VMNLVSNALKFTPVDGKV +RIKL+GEYD   SE CN +EV+I  GTE+++ + N   T+
Sbjct: 660  VMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNSSVNNIPTV 719

Query: 725  TEEKYVSCSGEST-DDTIETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVL 783
             EE+  +C  E T DDT E  ++ ++  D AD IS+ SS  +SYDDA+ H++ KKIP  +
Sbjct: 720  VEEEEKACEEEPTADDTPERKKKDSETVDDADAISISSSVATSYDDAVLHAQLKKIPTFI 779

Query: 784  DVDEGDLS-SIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTG 842
            D+++ D + ++ K EK + WVI IEV+DTGPGI+PSL ESVFKPFVQGDQTLSRQYGGTG
Sbjct: 780  DLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTG 839

Query: 843  LGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKI 902
            LGLSICRQL+TMMKGTMKL S+VG GSKF FTVPL+QTGTV             N  SK 
Sbjct: 840  LGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKK 899

Query: 903  NRRVKFKLNKGGKSRQSSLSVPEISG-VPDSPLNSMGXXXXXXXXXXXXXDRPFLQSTGT 961
            NR+VKF+LN+ GKSR+  ++    +G + +S + S G             DRPFLQSTGT
Sbjct: 900  NRKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGT 959

Query: 962  ATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANL 1021
            ATSTRS+PT+ S ES+ ++LVAEDNNVNQEVIKRML LEG ++I+LACDGE+A +KV+ L
Sbjct: 960  ATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSAL 1019

Query: 1022 TNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDG 1081
              Q +HY+++FMDVQMP+MDGL+ T+ +R++L+Y YPIVALTAFADDSNIK CLESGM+ 
Sbjct: 1020 VEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNS 1079

Query: 1082 FLSKPIKREKLRKILLEYCPVL 1103
            FL+KPIKR  L+KILLE+   L
Sbjct: 1080 FLAKPIKRPMLKKILLEHTSQL 1101

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1091 bits (2821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1131 (54%), Positives = 749/1131 (66%), Gaps = 65/1131 (5%)

Query: 23   FRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLTSAQIN 82
             +PP+K G+ TQL                 TTGVYFT NYKSLRADRL VAAQL S+QI+
Sbjct: 11   LKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSSQID 70

Query: 83   QTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHLYD 142
            Q LN +YYQCYWLS+RD++Q++L+ Y+ GNT+  N   A+ VL KFL SS+      +YD
Sbjct: 71   QNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYD 130

Query: 143  SAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSFFMSMS 202
            S F  VL+ + N +GN                          G+L++PV N + + MSMS
Sbjct: 131  STFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMS 190

Query: 203  LPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNILNSY 262
            LP+ A  SI+   S+  GYIT+VMSA+ +  V     AL+ S V++L+  Y   ++  SY
Sbjct: 191  LPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSY 250

Query: 263  QVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAACSFK 322
              +FPP  V    +++  F I N SF+ +AF +R SGSV +T+ FY  +VAVGY+ C FK
Sbjct: 251  HFVFPPHGVGAD-IIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFK 309

Query: 323  LVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQKATE 382
             V WVAV++Q E VFLSPST+LT IIIGT +GIA F+C+VTF +A+WAVKPIVRLQKATE
Sbjct: 310  QVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATE 369

Query: 383  LIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLREGDGLRKTPPSPYTP--MHSHV 440
            +I A RGL                     +  PS +   G   R     P+     HS+ 
Sbjct: 370  IITARRGLRSYNQSAPASRTNSF------RKRPSTSSSIGSVFRTITDRPHERDNGHSNF 423

Query: 441  EPNPSGIGREYSVDIARA-----IGIEVPSSHP-----------SERVDAFTTSANWIET 484
            E +        SVD   A     I   +P ++P           S + D F  S N I+ 
Sbjct: 424  ELHHR---TSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDA 480

Query: 485  RVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKT 544
            RVPVY RLFSDELSELTDTFN+MTDELDRHYALLEDRVRARTKQLEAAKI+AE+ANEAKT
Sbjct: 481  RVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANEAKT 540

Query: 545  MFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFSKN 604
            +FIANISHELRTPLNGILGMTAI+MAE DM+KVQNSLKLIFRSG            FSKN
Sbjct: 541  VFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTFSKN 600

Query: 605  ILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQI 664
            +L+R KLE+RNF+++DVALQVKSIFGKLAKDQ+V  SI L PN+IR M+LWGDSNRIIQI
Sbjct: 601  VLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQI 660

Query: 665  VMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISD--ETKNVFD 722
            VMNLVSNALKF+PVDGKV +RIKLLGEYD ++S+  N  +VFIK GTEI D   +K+   
Sbjct: 661  VMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSLS 720

Query: 723  T----------------------ITEEKYVSCSGESTDDTIETGQEGAQKPDK------A 754
            T                      + EE   S    S+D   E+  +     DK      +
Sbjct: 721  TLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADTDTDTDKRSNSEIS 780

Query: 755  DNISVVSSGTSSYDDAIFHSRFKKIPAVLD-VDEGDLSSIG-KSEKKKVWVISIEVEDTG 812
            D++S+VSS  SSYDDAI H++ +K+P+  +  D GD  S+G K E  K WVI+IEVEDTG
Sbjct: 781  DSLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGD--SLGRKLEISKTWVIAIEVEDTG 838

Query: 813  PGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFI 872
            PGI+P+L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ MMKGTMKL S+VGVGSKF 
Sbjct: 839  PGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFT 898

Query: 873  FTVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNK--GGKSRQSSLSVPEISGVP 930
            FTVPL QT  V             NA SK NR+VKFK+NK  GG   + S++    SG  
Sbjct: 899  FTVPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFKMNKNSGGSKSRPSVNTSLNSGT- 957

Query: 931  DSPLNSMGXXXXXXXXXXXXXDRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQ 990
            DS    M              DRPFLQSTGTATSTRSI TV SLE  FK+LVAEDNNVNQ
Sbjct: 958  DSTAEKMALSESEVSVGSVRVDRPFLQSTGTATSTRSITTVKSLERPFKILVAEDNNVNQ 1017

Query: 991  EVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIR 1050
            EV+KRML LEG+ DI+LACDG+EA +KV  L    DHY I+FMDVQMP++DGL++T+ IR
Sbjct: 1018 EVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRVDGLLSTKMIR 1077

Query: 1051 KELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEYCP 1101
            +EL Y++PIVALTAFADDSNIKVCL+SGM+GFLSKPIKR KL+ +L E+CP
Sbjct: 1078 QELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFCP 1128

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score = 1075 bits (2780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/1139 (51%), Positives = 742/1139 (65%), Gaps = 65/1139 (5%)

Query: 20   KHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLTSA 79
            +  F PP+  GL TQL                 TTGVYFTTNYKS+RA+RL VAAQL S+
Sbjct: 15   RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74

Query: 80   QINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTH 139
            Q++Q LN +YYQ YWLS+RD++Q+ALV+++ GN+S  N ++A++ L KFL SS       
Sbjct: 75   QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134

Query: 140  LYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSFFM 199
            +YD++FN V++ + N +G+                          G++++PV+N +++ +
Sbjct: 135  VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194

Query: 200  SMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNIL 259
            SMSLPVS   SI+   ++  GYIT++ SA+ + +V     AL+ S+VS+L+ V+D N+ L
Sbjct: 195  SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254

Query: 260  NSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAAC 319
              Y  +FPP         ++ FPI N +F+ +AF N   GSV KTN   E N+AVGY+  
Sbjct: 255  TGYHFVFPPHGTS-SFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPP 313

Query: 320  SFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQK 379
            +FKLVNWVAVV Q E VFLSP+ +L KII GTV  IA F+C++TF +A+WAV+PIVRLQK
Sbjct: 314  TFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQK 373

Query: 380  ATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLRE--GDGLRKTPPSPYTPMH 437
            ATE+I +GR L                       S    + +     + K  PS Y   +
Sbjct: 374  ATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHN 433

Query: 438  SHVEP-----NPSGIGREYSV------DIAR-AIGIEVP-----SSHPSERVDAFTTSAN 480
             +V P     +PS   R          D+ R A     P     SS+ SER   +  S N
Sbjct: 434  YNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSER---YIKSTN 490

Query: 481  WIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESAN 540
             +E  VPVYRR F DELSELTDTFN+MTDELDRHYALLE+RVRARTKQLEAAKIQAESAN
Sbjct: 491  LVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESAN 550

Query: 541  EAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXX 600
            EAKT+FIANISHELRTPLNGILGMTAIAMAE DM+KVQNSLKLIFRSG            
Sbjct: 551  EAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTELLT 610

Query: 601  FSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNR 660
            FSKN+LKR KLE+R+FS++D+ALQ+KSIFGKLAKDQ+VK SI L PN IR +VLWGDSNR
Sbjct: 611  FSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNR 670

Query: 661  IIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDE---- 716
            IIQIVMNLVSNALKFTPVDGKV +RIKLLGEYD + SE  +  EVF+  G+E +D+    
Sbjct: 671  IIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFN 730

Query: 717  ------------------------------TKNVFDTITEEKYVSCSGESTDDT---IET 743
                                          TK    +I  E   S  G   D++   +E+
Sbjct: 731  LTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLES 790

Query: 744  GQEGAQKPDKADNISVV-SSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVW 802
              E  +  D+ + +S++ +S +SSYDDAIFHS+FKK+ +  D D  + ++    +  K W
Sbjct: 791  KHE--ENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEE-NTFRDLKVPKTW 847

Query: 803  VISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLH 862
            VIS+EVEDTG GIDPSLQESVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ MMKGTMKL 
Sbjct: 848  VISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLD 907

Query: 863  SEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNKGGKSRQSSLS 922
            S+VGVGSKFIFTVPL+QT  +             N  S+ NR+VKFK+N   KS Q+  S
Sbjct: 908  SKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKS 967

Query: 923  VPEISGVPDSPLNSM-GXXXXXXXXXXXXXDRPFLQSTGTATSTRSIPTVGSLESNFKVL 981
               I G  D+ ++                 DRPFLQSTGTATSTRSI +V S  +  +VL
Sbjct: 968  KSSIDGHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEVTRHRVL 1027

Query: 982  VAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMD 1041
            VAEDNNVNQEVIKRMLQLEG+ D+++ACDG+EA EKV  +    + Y+++FMDVQMP++D
Sbjct: 1028 VAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVD 1087

Query: 1042 GLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEYC 1100
            GL+AT+ IR +L Y  PIVALTA+ADDSNIKVCLESGMDGFL KPIKR  L+KI+ +YC
Sbjct: 1088 GLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKRPLLKKIIAQYC 1146

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score = 1045 bits (2702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/1128 (51%), Positives = 719/1128 (63%), Gaps = 68/1128 (6%)

Query: 16   RRIRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQ 75
            R++    F+ P + G+  QLT                +TGVYFT NYK+LR++RL +AAQ
Sbjct: 4    RQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQ 63

Query: 76   LTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSI 135
            L S QI+Q LN +YYQCYWLSSRD++Q AL +Y  GN +  N  ++  V+ KFL SS   
Sbjct: 64   LKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLF 123

Query: 136  FRTHLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGS 195
                +YD+ F  VLS + N TGN                          G+L+NPV NG+
Sbjct: 124  SVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGT 183

Query: 196  SFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDE 255
            S+ MSMSLP+ A  SI+   S   GYIT+VMSAD + +V     AL  S V++L+ VYD+
Sbjct: 184  SYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQ 243

Query: 256  NNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVG 315
            N  L+SY  +F P  V    L E + PI N +FL +A      G++ +T   Y   VAVG
Sbjct: 244  NETLSSYNFVFAPLGVPSSILAETI-PIKNGTFLSSALRQGKGGALERTKFLYTKKVAVG 302

Query: 316  YAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIV 375
            Y+ CS   VNW+AVV Q EAVF+ P+TKLTKII GTV+GI  F+C+VTF +A+WAVKPIV
Sbjct: 303  YSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIV 362

Query: 376  RLQKATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLREGDGLRKTPPSPYTP 435
            RLQKATELI  GRGL                      G+ S  +         P +  + 
Sbjct: 363  RLQKATELITEGRGLRASS-----------------PGAGSSNVSRRSSFFHRPSNCGSS 405

Query: 436  MHSHVEPNPSGIGREYSVD------------IARAIGIEVPSSHP---SERVDAFTTSAN 480
            + S V  N +  G +   +            I  ++   + SS     S++    TTSAN
Sbjct: 406  IRSRVTDNHNEKGHDLHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSAN 465

Query: 481  WIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESAN 540
             IE RVPVYRR FSDELSELTDTFN+MTD LD+HYALLEDRVRART+QLEAAKI AE+AN
Sbjct: 466  LIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAAN 525

Query: 541  EAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXX 600
            EAKT+FIANISHELRTPLNGILGMTAI+M E D++K+QNSLKLIFRSG            
Sbjct: 526  EAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELLT 585

Query: 601  FSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNR 660
            FSKN+LKR KLE+RNFS+ DVALQ+KSIFGK+AKDQ V+ SI L PNLIR MVL+GDSNR
Sbjct: 586  FSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNR 645

Query: 661  IIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDETKNV 720
            IIQIVMNLVSNALKFTPVDGKV++ + LLGEYD E SE  N+ +V++  GTE     +  
Sbjct: 646  IIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPKGNDEKD 705

Query: 721  FDTITEEKYVSCSGESTD---------------------------DTIETGQEGAQKPDK 753
               I E++  S      D                           D ++ G+E  +    
Sbjct: 706  KGGIEEKERFSIENTPNDTSSNSSNKHSDTETTPGLNDTDEKQASDDMDGGEEDVE---D 762

Query: 754  ADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGP 813
            AD +S  S+ TSSY+D +FHS+FKK P V D    +L    K +KK  WVISI VEDTGP
Sbjct: 763  ADEVSSFSTSTSSYNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKK--WVISIVVEDTGP 820

Query: 814  GIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIF 873
            GID SL ESVF+PFVQGDQ LSRQYGGTGLGLSICRQL+TMM GTM L S++GVGS+F F
Sbjct: 821  GIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTF 880

Query: 874  TVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNKGGKSRQSSLSVPEISGVPDSP 933
            TVPL QT  +             N  SK NR+VKFK+ K  KS++S  S+  +     S 
Sbjct: 881  TVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFKIAKSLKSKRSKSSLMTVGPKSSSS 940

Query: 934  LNSMGXXXXXXXXXXXXXDRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVI 993
              S+              DRPFLQSTGTA+S  ++ T  ++    K+LVAEDN+VNQEVI
Sbjct: 941  DKSLSQLKLTDSDRSVRLDRPFLQSTGTASSNTNLGTTSTIN---KILVAEDNDVNQEVI 997

Query: 994  KRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKEL 1053
            KRML LEG+++IEL CDG+EAL+KV  L    +HYN++FMDVQMPKMDGL++T+ IR++L
Sbjct: 998  KRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDL 1057

Query: 1054 NYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEYCP 1101
            NYT+PIVALTAFADDSNI+ CL++GMDGFL+KPIKR +LRKI+ E+CP
Sbjct: 1058 NYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCP 1105

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1040 bits (2688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1129 (50%), Positives = 723/1129 (64%), Gaps = 59/1129 (5%)

Query: 16   RRIRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQ 75
            RR+R+     P    + TQLT                 TGVYFT+++KSLRA+RL VAAQ
Sbjct: 15   RRLRR-----PLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQ 69

Query: 76   LTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSI 135
            L S+QI+Q LN +YYQCYWLS+RD +QNAL  Y  GNTS+ N  +A   L KFL SSN  
Sbjct: 70   LKSSQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLF 129

Query: 136  FRTHLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGS 195
                +YDS+F +VL+VS N +GN                          GML++PV NGS
Sbjct: 130  SLARVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGS 189

Query: 196  SFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDE 255
             + MSMSLP+ A  SI+   +   GYIT+V+SA+ + SV     AL+ S+V +++ VYD+
Sbjct: 190  VYLMSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDD 249

Query: 256  NNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVG 315
            +  L  Y ++FPP  +  P ++   + I N SFL +A  +   GS+  T  F    +AVG
Sbjct: 250  HE-LAGYHLVFPPYNM-YPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVG 307

Query: 316  YAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIV 375
            Y+ C+  L  WVA++ Q EA+FLSPST+L KII+GT I IA   C+VTF +++WAV+PIV
Sbjct: 308  YSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIV 367

Query: 376  RLQKATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLREGDGLRKTPPSPYTP 435
            RLQKATE+I AGRGL                         + ++R    + +     Y P
Sbjct: 368  RLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARAGRDKYIP 427

Query: 436  MHSHVEPNPSGIGREYSVDIARAIGIEV-------PSSHPSE----RVDAFTTSANWIET 484
              S   P  +     + V+      IE+       P S  +E    + + + TS N IE 
Sbjct: 428  DSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYITSTNLIEA 487

Query: 485  RVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKT 544
            RVPVY+RLFSDELSELT+TFN+MTDELDRHYALLEDRVRART+QLEAAKI+AE ANEAKT
Sbjct: 488  RVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKT 547

Query: 545  MFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFSKN 604
            +FIANISHELRTPLNGILGMTAIAMAE D  KV++SLKLIFRSG            FSKN
Sbjct: 548  VFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKN 607

Query: 605  ILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQI 664
            +LKR KLE+R+F +VD+ALQV+SIFGKLAKDQ+V  +I ++PNL+R MVLWGDSNRI+QI
Sbjct: 608  VLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQI 667

Query: 665  VMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFI-------KQGTEISDE- 716
            VMNLVSNALKFTPVDGKV ++ +LLGEYDEE+S+     EVF+          TE  DE 
Sbjct: 668  VMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEAKDEK 727

Query: 717  -TKNVFDTITEEKYVSCSGESTDD-TIETGQ------------EGAQKPDKADNISVVSS 762
              ++  D+ T    +  + ESTD+  ++ GQ            E + + D+ ++   + S
Sbjct: 728  NAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIESSDEDDENEDTKSIGS 787

Query: 763  G-TSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSLQE 821
            G TSSYDDAIF +R +K  +  + +EG        E  K WVIS+EV DTGPGIDP+L E
Sbjct: 788  GNTSSYDDAIFQTRLRKDSSNEENEEGR-----ALESPKKWVISMEVHDTGPGIDPALHE 842

Query: 822  SVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTG 881
            SVF+PFVQGDQTLSRQYGGTGLGLSICRQL+TMM GTMKL S+VGVGSKF FTVPL QT 
Sbjct: 843  SVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTK 902

Query: 882  TVXXXXXXXXXXXXXNAQSKINRRVKFKLNKGGKSRQSSLSVPEISGVPDSPLNSMGX-- 939
             +             N  SK NR+VKF++   GKS + S S  E SG   +  NS G   
Sbjct: 903  ELLFEDVENPFEDEFNPDSKKNRKVKFRM---GKSNKRSKSRSESSGTEGNGGNSPGVEG 959

Query: 940  -------XXXXXXXXXXXXDRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEV 992
                               DRPFLQSTGTA ST ++ T  SL    K+LVAEDNNVNQEV
Sbjct: 960  SGGNSPGTGSEVSVGSVRVDRPFLQSTGTALST-TLVTTSSLADRRKILVAEDNNVNQEV 1018

Query: 993  IKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKE 1052
            IKRML LEG+ D+ELACDG++A +KV        HY+++FMDVQMP++DGL ATR IRKE
Sbjct: 1019 IKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKE 1078

Query: 1053 LNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEYCP 1101
            L Y++PIVALTAFADDSNIK CL++GM+GFLSKPIKR K++ IL EYCP
Sbjct: 1079 LGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCP 1127

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 576/1187 (48%), Positives = 731/1187 (61%), Gaps = 106/1187 (8%)

Query: 17   RIRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQL 76
            R+R    +PPY+ G+  QLT                TTGVYFT+NYK+LR+DRL +AAQL
Sbjct: 4    RLRSFTPKPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQL 63

Query: 77   TSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIF 136
             S+QI+Q LN +YYQCYW++SRD++Q  L +Y  GN S  N  +++ VL KFL SSN   
Sbjct: 64   KSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFS 123

Query: 137  RTHLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSS 196
               +YDS+F  VL+ + NSTG+                          G+++NPV NGSS
Sbjct: 124  VARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSS 183

Query: 197  FFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDEN 256
            + MSMSLP+ A  SI+   S   GY+T+VMSA+ + SV     AL  S V++++ VY   
Sbjct: 184  YLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNA 243

Query: 257  NILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGY 316
              L++Y+ +FPP       +L   FP+ NN+FL +A      G++  T  FY   +AVGY
Sbjct: 244  TKLDAYRFVFPP-FGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGY 302

Query: 317  AACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVR 376
            +  +  L NWVA+VAQ E+VF+SP+TKL KII GTV+GI  F  ++TF +A+WAVKPIVR
Sbjct: 303  SPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVR 362

Query: 377  LQKATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKG---SPSPTLREGDGLRKTPPSPY 433
            LQKATELI   RGL                           P  T    +        P 
Sbjct: 363  LQKATELITESRGLRPTTPTSGSRANSILRDKSSLISFPLHPVSTNNINNNNSNEKAQPP 422

Query: 434  TPMHSHVEPNPSGIG----REYSVDIARAIGIEVPSSHPSERVD-------AFTTSANWI 482
            +   ++   + S I     RE     A  +   +  S+ S+R++        +TT+ N I
Sbjct: 423  SDQDTNTNNSSSSIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAVNLI 482

Query: 483  ETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEA 542
            + RVP YR LF DELS+LT+TFN+MTD LD+HYALLE+RVRARTKQLEAAKI+AE+ANEA
Sbjct: 483  QARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEA 542

Query: 543  KTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFS 602
            KT+FIANISHELRTPLNGILGMTAI+M E D++K++NSLKLIFRSG            FS
Sbjct: 543  KTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILTELLTFS 602

Query: 603  KNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRII 662
            KN+LKR KLE+RNF + DVALQ+KSIFGK+AKDQ+V+ SI L PN+IR MVL+GDSNRII
Sbjct: 603  KNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRII 662

Query: 663  QIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDET----- 717
            QIVMNLVSNALKFTPVDGKV +R+K+LG YDE  SEK N+ +V++K GTEI+D T     
Sbjct: 663  QIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSLNV 722

Query: 718  ------KNVFDTITEEKYVSCSGESTDDTIET---GQEGAQKPDKADNISVVSSGTSSYD 768
                  K+ F + T  K  + S  + D T  T    QE  +     DN S++SS TSSYD
Sbjct: 723  KSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDNESMISSTTSSYD 782

Query: 769  DAIFHSRFKKIPAVLDVDEGDLSSIG-KSEKKKVWVISIEVEDTGPGIDPSLQESVFKPF 827
            DAIF+S+FKK   + D  E D S +G + E  K WVIS EVED+GPGID  LQESVF+PF
Sbjct: 783  DAIFNSQFKKTTNLYD--EDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPF 840

Query: 828  VQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVXXXX 887
            VQGDQTLSRQYGGTGLGLSICRQL+ MMKG M L S+VGVGSKF FT+PL QT  +    
Sbjct: 841  VQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFAN 900

Query: 888  XXXXXXXXXNAQSKINRRVKFKLNKG---GKSRQSSLSV--------------------- 923
                     NA+SK NR+VKF++ +     KSR S ++                      
Sbjct: 901  VEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHHSVHTRTPTKSPRLKC 960

Query: 924  ------------PEISGV-------PDSPLNSM------GXXXXXXXXXXXXXDRPFLQS 958
                        PE +G         D  L+ M                    DRPFLQS
Sbjct: 961  DRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQS 1020

Query: 959  TGTATSTRSIPTVGSLESN-------------------------FKVLVAEDNNVNQEVI 993
            TGTATSTRSIP + S +                           +K+LVAEDN+VNQEVI
Sbjct: 1021 TGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQEVI 1080

Query: 994  KRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKEL 1053
            KRMLQLEG+ DI+LACDG++A +KV  L ++   YN++FMDVQMPK+DGL +T+ IR +L
Sbjct: 1081 KRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDL 1140

Query: 1054 NYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEYC 1100
            +  +PIVALTAFADDSNIK CL++GMDGFLSKPIKR KL+ IL E+C
Sbjct: 1141 HCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFC 1187

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1151 (49%), Positives = 721/1151 (62%), Gaps = 85/1151 (7%)

Query: 19   RKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLTS 78
            R+   +PP++ G+  QLT                TTGVYFT+NYK+LR+DRL +AAQL S
Sbjct: 10   RRRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKS 69

Query: 79   AQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRT 138
            +Q++Q LN +YYQCYWL+SRD++QNAL SY  GN +  N + +  V+ KFL SSN  F +
Sbjct: 70   SQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLS 129

Query: 139  HLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSFF 198
             +YD  F  VL+ + N TG+                          GML++PV NG+ + 
Sbjct: 130  RVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYL 189

Query: 199  MSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNI 258
            MSMSLP+ A  SI++      GYIT+VMSA+ + SV     AL  S V++++  Y     
Sbjct: 190  MSMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTK 249

Query: 259  LNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAA 318
            ++SY+ +FPP  V  P +L   F + ++SFL  AF     GS+ KT  FY  +VA+GY  
Sbjct: 250  IDSYRFVFPPYGVS-PSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYP 308

Query: 319  CSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQ 378
            CSF  VNWVAVV+Q E+VFLSPSTKLTKII GTV+GIA F+ ++TF +A+WAVKPIVRLQ
Sbjct: 309  CSFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQ 368

Query: 379  KATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLREGDGLRKTPPSPYTPMHS 438
            KATELIA GRGL                            + + + + +   S      +
Sbjct: 369  KATELIAEGRGLRPAGAGSGSRSGSRTSSMKK-------DINDLNFISRLSLSE----KN 417

Query: 439  HVEPNPSGIGREYSVD--IARAIGIEVPSSHPSER-----VDAFTTSA-NWIETRVPVYR 490
            H     S     Y+ D  ++  +     S+ PS+         F T++ N  E R+P YR
Sbjct: 418  HRPAYDSASDSNYATDGSLSHDLQTSQASNRPSDNDRSSSRSRFLTTSTNLNEARLPDYR 477

Query: 491  RLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTMFIANI 550
            RLFSDELS+LT+TFN+MTD LD+HYALLEDRVRARTKQLEAAKIQAE+ANEAKT+FIANI
Sbjct: 478  RLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANI 537

Query: 551  SHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFSKNILKRNK 610
            SHELRTPLNGILGMTAI+M E D+ K++NSLKLIFRSG            FSKN+LKR  
Sbjct: 538  SHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTA 597

Query: 611  LEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVS 670
            LE+RNF + DVALQ+KSIFGK+AKDQ+V+ SI L PN+IR MVLWGDSNRIIQIVMNLVS
Sbjct: 598  LEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVS 657

Query: 671  NALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFI------KQGTEISDETKNVFDTI 724
            NALKFTPVDGKV++RIKLLGEYDEE ++  N  ++         Q   +S     V   +
Sbjct: 658  NALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHPVSSSPNGVL--V 715

Query: 725  TEEKYVSCSGESTDDTIETGQEGAQKPDKADNISVVSSG-----------TSSYDDAIFH 773
                  S S  +  D+ +  ++   + D   +I+ +S             TSSYD+A+F+
Sbjct: 716  KHLSTSSDSNSNLSDSDKYNEKTYDEDDDEHSITNISDHSDDLSSLVSSSTSSYDNALFN 775

Query: 774  SRFKKIPAVLDVDEGDLSSIGKS-EKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQ 832
            ++FKK P   D+ E     +G     +K WV +IEVEDTGPGIDP L ESVF+PFVQGDQ
Sbjct: 776  TQFKKTP---DLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQ 832

Query: 833  TLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXX 892
            TLSRQYGGTGLGLSICRQL+TMM GTMKL S+VGVGSKF FTVPL+QT  +         
Sbjct: 833  TLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKFDEEEDLF 892

Query: 893  XXXXNAQSKINRRVKFK-LNKGGKSRQSSLSVPEISGVPDSPLNSMGXXXX--------- 942
                N +SK NRRVKFK   +   SR+S  SV  I+       +S G             
Sbjct: 893  EDEFNPESKKNRRVKFKDSTRSLHSRRSRTSVDRITNHSGDKQSSEGHSTSFKISEVKDE 952

Query: 943  --------------------------------XXXXXXXXXDRPFLQSTGTATSTRSIPT 970
                                                     DRPFLQSTGTATS+R++PT
Sbjct: 953  DIEQSPEPDNLPKVGDENDSKASSSSSKSDNIKEKEEKVHLDRPFLQSTGTATSSRNVPT 1012

Query: 971  VGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNI 1030
            +  +   FK+LVAEDN+VNQEVIKRML LEGI +I+LACDG++A +KV +L  Q D Y++
Sbjct: 1013 MADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDM 1072

Query: 1031 VFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKRE 1090
            +FMD+QMPK+DGL++T+ IR++LNY   IVALTAFADDSNIK C+E+GM+GFLSKPIKR 
Sbjct: 1073 IFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRP 1132

Query: 1091 KLRKILLEYCP 1101
            KL+ IL EYCP
Sbjct: 1133 KLKMILEEYCP 1143

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/1109 (50%), Positives = 726/1109 (65%), Gaps = 55/1109 (4%)

Query: 18   IRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLT 77
            I K  F PP++  + TQLT                TTGVYFT+NYKSLR++RL VAAQL 
Sbjct: 6    IAKEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLK 65

Query: 78   SAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFR 137
            S+QI+Q LN +YYQCYWLSS+ ++Q +L +Y  GN +  N  ++  VL KFL SS     
Sbjct: 66   SSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSV 125

Query: 138  THLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSF 197
              +YD+ F  VL+ + N TG+                          GML++PV NG+S+
Sbjct: 126  ARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSY 185

Query: 198  FMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENN 257
             MSMSLP+ A  SI+  +S   GY+T++MSAD + SV   + AL  S+V++++ +Y ++ 
Sbjct: 186  LMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQ 245

Query: 258  ILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYA 317
             L SY+ +F P     P +L+  +PI NNSFL  A     +GS  +T+ FY    AVGY+
Sbjct: 246  GLGSYRFVFAP-YGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYS 304

Query: 318  ACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRL 377
             CSFK VNWVA+++Q EAVF+ PST+LTKIIIG V+GI  F+CI TF +A+WAV+PIVRL
Sbjct: 305  PCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRL 364

Query: 378  QKATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLREGDG--LRKTPPSPYTP 435
            QKATE+I  GRGL                      G+P  +    +   +R+      + 
Sbjct: 365  QKATEIITEGRGLRS--------------------GTPGSSSVSRNSSFIRRRFSGSSSV 404

Query: 436  MHSHVEPNPSGIGR---EYSVDIARAI-GIEVPSSHPSERVDAFTTSANWIETRVPVYRR 491
                +      +GR   E S +  +A+  +   +   S+R   + TS+N +E RVPVYR 
Sbjct: 405  RSPSLADEKGAVGRASTEGSFNYDQAVPSLNSNAEISSDRTRKYMTSSNLVEARVPVYRI 464

Query: 492  LFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTMFIANIS 551
             FSDE SELTDTFN+MT+ LD+HYALLEDRVRARTKQLEAAK++AE+ANEAKT+FIANIS
Sbjct: 465  FFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANIS 524

Query: 552  HELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFSKNILKRNKL 611
            HELRTPLNGILGMTAI+M E D++K+Q+SLKLIFRSG            FSKN+L+R KL
Sbjct: 525  HELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKL 584

Query: 612  EQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSN 671
            E+R+FS+ DVA+Q+KSIFGK+AKDQ VKFSI L PN IRKMVL+GDSNRIIQIVMNLVSN
Sbjct: 585  EKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSN 644

Query: 672  ALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISD---------------- 715
            ALKFTPVDGKVS+R++LLGEYD++ SE  +   V++  GTE  +                
Sbjct: 645  ALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPREDGLIPPPVKQFEKQED 704

Query: 716  -ETKNVFDTITEEKYVSCSGESTDDTIETGQEGAQKPDKADNISVVSSGTSSYDDAIFHS 774
             E + + +   EE+  +   E T+  ++     +++ D  D +S++S  TSSYDD IFH+
Sbjct: 705  LEKEKISEKHNEEEASTSDSEKTN--LDDKTPDSKRSDADDQVSLISISTSSYDDTIFHT 762

Query: 775  RFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTL 834
            +FKK  +    + G L      E  K W IS+EVEDTGPGIDPSL ESVF+PFVQGDQ L
Sbjct: 763  QFKKHTSSSGDENGHL-----LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQAL 817

Query: 835  SRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXX 894
            SRQYGGTGLGLSICRQL+TMM GTMKL S++GVGSKF FT+PL QT  +           
Sbjct: 818  SRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTREI-EFEDENAFED 876

Query: 895  XXNAQSKINRRVKFKL---NKGGKSRQSSLSVPEISGVPDSPLNSMGXXXXXXXXXXXXX 951
              N  SK NR+VKFK+    K  KS+ S  +     G  D     +              
Sbjct: 877  EFNPLSKKNRKVKFKVAKSIKSRKSKSSLSNSSGKGGSSDKSSKQLKGSESEFSVGNVSL 936

Query: 952  DRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDG 1011
            DRPFLQSTGTA+S++++  V ++  ++++LVAEDN+VNQEVIKRML LEGI  I+LA DG
Sbjct: 937  DRPFLQSTGTASSSKNVTVVSNVNKSYRILVAEDNHVNQEVIKRMLTLEGIDRIDLAADG 996

Query: 1012 EEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNI 1071
            ++A +KV  L  + +HY ++FMDVQMPK+DGL+AT+ IRK+L+Y YPIVALTAFADDSNI
Sbjct: 997  QDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTAFADDSNI 1056

Query: 1072 KVCLESGMDGFLSKPIKREKLRKILLEYC 1100
            +VCLE+GM+GFLSKPIKR KL+ I+ +YC
Sbjct: 1057 RVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score =  996 bits (2574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/1194 (47%), Positives = 732/1194 (61%), Gaps = 93/1194 (7%)

Query: 1    MALLFIKKHLSIPTTRRIRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTT 60
            +A +F +K +S    +R+     +PPY+  + TQL                 TTGVYFT+
Sbjct: 2    VARVFARKRIS-QRLKRLAHLNTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTS 60

Query: 61   NYKSLRADRLTVAAQLTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDN 120
            +YK+LRA+RL +AAQL S+QI+QTL  +YYQ YW+S+RD++Q++L ++  GN SS N ++
Sbjct: 61   SYKNLRANRLYIAAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWES 120

Query: 121  AKEVLVKFLDSSNSIFRTHLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXX 180
             + VL KFL SS+      +YD  F+ VLSV+ N TGN                      
Sbjct: 121  TESVLEKFLSSSDYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSS 180

Query: 181  XXXXGMLSNPVFNGSSFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPA 240
                G+L++PV NG+S+ MSMSLPV A  SI+   S   GYIT++M+AD + SV     A
Sbjct: 181  LETTGILTDPVLNGTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTA 240

Query: 241  LNGSTVSVLAGVYDENNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGS 300
            +  S V++++ VY+  + L++Y +  PP       + +I F + N+SFL  A      GS
Sbjct: 241  IEKSNVAIVSAVYNNQSELDAYHLALPPYGF-TASVTDINFQLKNSSFLNGALKQGKGGS 299

Query: 301  VSKTNAFYEPNVAVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFIC 360
            + KT+  Y   VAVGY+ CSF+L NWV+VV+Q E+VF  PSTKLTKII G V+GI+ F+ 
Sbjct: 300  IKKTHFLYNKAVAVGYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVM 359

Query: 361  IVTFIVANWAVKPIVRLQKATELIAAGRGL------------XXXXXXXXXXXXXXXXXX 408
            +VT  +A +AVKPIVRL+KATE+I  GRGL                              
Sbjct: 360  LVTLPLAYFAVKPIVRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSR 419

Query: 409  XXXKGSPSPTLREGDGLRKTPPSPYTPMHSHVEPNPSGIGR------EYSVDIARAIGIE 462
                   S +L E      + P   T  +  V  N SG+ R      +  +D A A  + 
Sbjct: 420  KSTATGNSNSLNENSASLSSHPMVLTSENVLV-TNHSGLSRIPVNMNQELLDRASASTVN 478

Query: 463  V----PSSHPSERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALL 518
                  +   SER     T  N  E RVP+ R+LF DELS+LT+TFN+MTD LD HY LL
Sbjct: 479  TLTIDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLL 538

Query: 519  EDRVRARTKQLEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQ 578
            EDRVRARTKQLEAAKIQAE+ANEAKT+FIANISHELRTPLNGILGMTAI+M E D+ K++
Sbjct: 539  EDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIR 598

Query: 579  NSLKLIFRSGXXXXXXXXXXXXFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNV 638
            +SLKLIFRSG            FSKN+L+R KLE+RNF + DVALQ+KSIFGK+AKDQ+V
Sbjct: 599  SSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHV 658

Query: 639  KFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESE 698
            + SI L PN++R MVL+GDSNRIIQ+VMNLVSNALKFTPVDGKV ++IKLLGEYDEE S+
Sbjct: 659  RLSIILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSK 718

Query: 699  KCNNAEVFIKQGTEISDETKNVFDTITEEKYVSCSGEST--------------------- 737
                 +V++K GTE        F +I  E       EST                     
Sbjct: 719  NSKFEKVYVKGGTE--------FTSIPAELAALSKRESTAGSHFSGSSSHIKEKLDGIPA 770

Query: 738  --------------DDTIETGQE-GAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAV 782
                            TI T Q+  +   D  DNIS+ S+ TSSYDDAIF+S+FKK P +
Sbjct: 771  NVFASDSDSDDPSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDL 830

Query: 783  LDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTG 842
             + ++G+L    +  ++K WV  IEV DTGPGID SLQESVF+PFVQGDQTLSRQYGGTG
Sbjct: 831  YEDEDGNLGE--ELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTG 888

Query: 843  LGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKI 902
            LGLSICRQL+TMM GTM L S VG GSKFIFTVPL QT  +             N +SK+
Sbjct: 889  LGLSICRQLATMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKM 948

Query: 903  NRRVKFK-------------LNKGGKSRQSSL-------SVPEISGVPDSPLNSMGXXXX 942
            NR+VKF              L     SR +++       +    S V  S  N       
Sbjct: 949  NRKVKFNVARSINSRRSRSSLITSNSSRIATVREESRLETRSNHSDVSTSNKNE-SASPQ 1007

Query: 943  XXXXXXXXXDRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGI 1002
                     DRPFLQSTGTA S+ ++PTV +L     VLVAEDN+VNQEVIKRML LEG+
Sbjct: 1008 PESGSNLNLDRPFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGV 1067

Query: 1003 YDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVAL 1062
             +I+LACDG++A + V +L  + + Y+++FMDVQMPK+DGL AT+ IR +L Y +PIVAL
Sbjct: 1068 KNIDLACDGQDAFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVAL 1127

Query: 1063 TAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEYCPVLNKSVSTTTNRGLE 1116
            TAFADDSNIK CL++GMDGFLSKPIKR +L+ ILLEYCP ++ S+   T+ G E
Sbjct: 1128 TAFADDSNIKECLDAGMDGFLSKPIKRPQLKTILLEYCPKVD-SMGRATSTGEE 1180

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1120 (49%), Positives = 722/1120 (64%), Gaps = 52/1120 (4%)

Query: 16   RRIRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQ 75
            R+  +  F+PPY+  +  QLT                TTGVYFT NYK LR+ RL +AA+
Sbjct: 2    RQSWRKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAK 61

Query: 76   LTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSI 135
            L S+QI+QTLN ++YQC +L+SRD++QNAL++Y+ GN +  N   ++ V+ KFL SS+  
Sbjct: 62   LKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLF 121

Query: 136  FRTHLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGS 195
            +   LYD  F +V++ + N TG+                          G+L++PV NGS
Sbjct: 122  YVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGS 181

Query: 196  SFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDE 255
             + MSMSLP+    SI+   S   GYIT+VMSAD + +V     AL  S V+V++ +Y++
Sbjct: 182  IYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYND 241

Query: 256  NNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVG 315
               ++ +  +F         L+E  +PI N ++L +A V   SGS+ KT   +   +A+G
Sbjct: 242  QGKVDGFHFVFEVENDDFSTLIE--YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIG 299

Query: 316  YAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIV 375
            Y+ CSF L NWVA+V Q EAVFLSPSTKL KII GTV+ IA F+C++TF +++WAVKPIV
Sbjct: 300  YSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIV 359

Query: 376  RLQKATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLREGDGLRKT-PPSPYT 434
            RLQKATELI+ GRGL                     + S    +R   G+ K+   +   
Sbjct: 360  RLQKATELISQGRGLKPTSNFSNGDSSSTSDNW---RESVESHVRASLGIFKSLRNNGSN 416

Query: 435  PMHSHVEPNPSGIGREYSVDIARAIGIEVPSSHPSERVDAFTTSANWIETRVPVYRRLFS 494
             + S+ + N   I    S + +    I+   +  S     +TTS N ++ RVPVY R   
Sbjct: 417  ELQSNDDMNE--INERSSKNNSTGDNIKSSDNDSSSSFQRYTTS-NLVQARVPVYGRFLQ 473

Query: 495  DELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTMFIANISHEL 554
            DELSELTDTFN+MT+ LD+HY LLEDRVRARTKQLEAAKI+AE+ANEAKT+FIANISHEL
Sbjct: 474  DELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHEL 533

Query: 555  RTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFSKNILKRNKLEQR 614
            RTPLNGILGMTAI+M E+D +K++ +LKLIFRSG            FSKN+LKR  LE+R
Sbjct: 534  RTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNVLKRTNLEKR 593

Query: 615  NFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALK 674
            +F + ++ALQ+KSIFGK+A+DQ+VK  I LMPN IR MVLWGDSNRIIQIVMNLVSNALK
Sbjct: 594  DFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALK 653

Query: 675  FTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEI----SDETKNVFDTITEEKYV 730
            FTP+DGKV +RIKLLGEYDEE S   +  EV+IK GTE+      +T  V   I E    
Sbjct: 654  FTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQELSEK 713

Query: 731  SC-SGEST------------DDTIETGQEGAQKPDKADN-----ISVVSSGTSSYDDAIF 772
             C  G++             D  IE  ++ +   ++  N     +S+ +S T SYDDA  
Sbjct: 714  DCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRSYDDAAL 773

Query: 773  HSRFKKIPAVLDVDEGDLSSIG-KSEKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGD 831
              +FKK P + D +E    ++G +  + K WVIS+EVEDTGPGI+P LQE+VF+PFVQGD
Sbjct: 774  QRQFKKTPDLDDKEE----TLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGD 829

Query: 832  QTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVXXXXXXXX 891
            Q LSRQYGGTGLGLSICRQL+TMM GTMKL S VGVGSKFIFTVPL+QT  +        
Sbjct: 830  QALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREI--HFDDEK 887

Query: 892  XXXXXNAQSKINRRVKFKLNKGGKSRQSSLSVPEISGVP-----DSPLNSMGXXXXXX-- 944
                 NA+SK NRR+KFK+    KS  S+    E  G+      DS  N           
Sbjct: 888  FEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEE--GIKSSRDIDSSNNEHKDENGTSPD 945

Query: 945  XXXXXXXDRPFLQSTGTATSTRSIPTV-----GSLESNFKVLVAEDNNVNQEVIKRMLQL 999
                   DRPFLQSTGTATS++ IPT+      ++E + ++LVAEDN+VNQEVIKRML L
Sbjct: 946  NHSKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNL 1005

Query: 1000 EGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPI 1059
            E I +I+LACDG++A +KV +L +  ++Y+I+FMDVQMPK+DGL++T+ IRK+LNY +PI
Sbjct: 1006 EKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPI 1065

Query: 1060 VALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
            VALTAFA+D NIK CL++GMDGFL KPIKR KL++IL EY
Sbjct: 1066 VALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
            (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  885 bits (2287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1098 (44%), Positives = 656/1098 (59%), Gaps = 72/1098 (6%)

Query: 16   RRIRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQ 75
            R     +++ PYK  L TQLT                +TGVYFT NY+ LR  +L +AA+
Sbjct: 3    RACNVSIWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAAR 62

Query: 76   LTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSI 135
            L S+QI+QT+N++YYQC WL+ RD I++AL  Y  GN S+ N  +  +VL  FL+SS   
Sbjct: 63   LKSSQIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVF 122

Query: 136  FRTHLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGS 195
              T LYDS FN +L+ + N T +                          G+L++PV N S
Sbjct: 123  LTTTLYDSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDS 182

Query: 196  SFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDE 255
            ++ MSMSLP+ A  S+    S   GY+T+VMSA+ + +V     AL  S V+V++     
Sbjct: 183  TYLMSMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTN 242

Query: 256  NNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVG 315
                  Y  +FPP       ++   +P+ N++FL +AF +   GS++K+ + Y   VA+G
Sbjct: 243  GTSGQEYHFVFPPHGAS-DDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIG 301

Query: 316  YAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIV 375
            Y  CSF L NWV  V+Q E VF+S S KLTKII GTVI I  F+C++TF ++ W+V+PIV
Sbjct: 302  YWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIV 361

Query: 376  RLQKATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLREGDGLRKTPP-SPYT 434
            RLQKATE+I+   G                      K          DG   +   + Y 
Sbjct: 362  RLQKATEVISKRDGNEVHRSNSSSSSRSTFSSNRRSK----------DGRHNSSSYNLYE 411

Query: 435  PMHSHVEPNPSGIGREYSVDIARAIGIEVPSSHPSERVDAFTTSANWIETRVPVYRRLFS 494
             +  + E   +    E       ++  E  + + S    A     N  + +VP  RR   
Sbjct: 412  DVEKYTEIGKANKSTE-------SLSKENITDYSSSNSSAIVMRKNLADFQVPASRRFVK 464

Query: 495  DELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTMFIANISHEL 554
            DELSELT+T+  MTD LD H  LLE RV+ RTKQLEAAKI+AESANEAKT+FIAN++HEL
Sbjct: 465  DELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHEL 524

Query: 555  RTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFSKNILKRNKLEQR 614
            RTPLNGILGMTAIAM E DME++Q+SLKLI+RSG            FSKN+LK+ KLE+ 
Sbjct: 525  RTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEKT 584

Query: 615  NFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALK 674
            +F ++D+ALQ++SIFGK++KDQ+VK SIF++PN +R MVLWGD NRI+Q++MNLVSNALK
Sbjct: 585  HFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALK 644

Query: 675  FTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQ-GTEISDETKNVFDTITEEKYVSCS 733
            FTPVDGK+++ IKLLGEYD++ S   N  +V++K+      D+ K +   I         
Sbjct: 645  FTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMKEIRNSNGDKIKPLMTLI--------- 695

Query: 734  GESTDDTIETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSI 793
              S+ DT+          D   N SV S    S ++ I+ ++FK      D D+    +I
Sbjct: 696  --SSKDTMSVA-------DNISNKSVASDTERSTNNTIYSNKFKNGSNFQDTDD----AI 742

Query: 794  GKS-EKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLS 852
            G   +KK+ WVIS+EVEDTGPGI+PSLQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQL+
Sbjct: 743  GVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 802

Query: 853  TMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNK 912
             +M GTMKL SEVGVGSKFIFTVPL QT  +             N  SK NR VKF+   
Sbjct: 803  NLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKNREVKFQ--- 859

Query: 913  GGKSRQSSLSVPEISGVPDSPLNSMGXXXXXXXXXXXXXDRPFLQSTGTATSTRSIPTVG 972
                        EI+   D  +N  G              +   +S   A     +P+  
Sbjct: 860  ------------EITDEVDQ-VNIEGNSGVEVEPGKCTEPKKSTESESQAV----VPSKS 902

Query: 973  SLE---------SNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTN 1023
            S E          NFK+L+ EDN VNQ V+ RML+LEGI +  +ACDG+EA+EK+  + +
Sbjct: 903  SQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQS 962

Query: 1024 QYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFL 1083
            + ++Y +V MD+QMPK+DG+ AT+ IR+EL Y  PIVALTAFADDSNI+ C +SGMDGFL
Sbjct: 963  RGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFL 1022

Query: 1084 SKPIKREKLRKILLEYCP 1101
            +KPIKRE+L+ IL E+CP
Sbjct: 1023 AKPIKREQLKGILTEFCP 1040

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/941 (49%), Positives = 594/941 (63%), Gaps = 55/941 (5%)

Query: 21  HMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLTSAQ 80
           ++ +PP++ G+ TQLT                TTGVYFT+NYK+LR+DRL +AAQL S+Q
Sbjct: 9   YVLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQ 68

Query: 81  INQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHL 140
           I+Q LN +YYQ YWLSSRD++Q  L +Y  GN ++ N  ++++V+ KFL S+N      L
Sbjct: 69  IDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQL 128

Query: 141 YDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSFFMS 200
           YDS+FN VL+ + N TG+                          G+L++PV NGS++ MS
Sbjct: 129 YDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMS 188

Query: 201 MSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNILN 260
           MSLP+ A  SI+   S   GYIT+VMSA+ + +V     AL  S V++++GVY+  + LN
Sbjct: 189 MSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLN 248

Query: 261 SYQVLFPPSIVQVPR-LLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAAC 319
           +Y  +F P     P  ++   F I NNSFL  A      GSV KT  FY  N+AVGY+ C
Sbjct: 249 AYHFVFAP--YGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYSPC 306

Query: 320 SFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQK 379
           +F  VNW+A+V+Q E+VFLSPSTKL KII GTV+ I  F+ ++TF +A+WAVKPIVRLQK
Sbjct: 307 TFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRLQK 366

Query: 380 ATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLR----EGDGLRKTPPSPY-- 433
           ATEL++ GRGL                        PS         GD L  T       
Sbjct: 367 ATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNGHLNQ 426

Query: 434 -----TPMHSHVEPNPSG-------IGREYSVDIARAIGIEVPSSHPSERVDAFTTSANW 481
                TPM +   P+PS        I    +   A +I      +  S R    TTSAN 
Sbjct: 427 RGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDHTDLSNRSKKLTTSANL 486

Query: 482 IETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANE 541
           IE RVP YRRLFSDELS+LTDTFN+MTD LD+HYALLEDRVRARTKQLEAAKI+AE+ANE
Sbjct: 487 IEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEAETANE 546

Query: 542 AKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXF 601
           AKT+FIANISHELRTPLNGILGMTAI+M E D+ K+++SLKLIFRSG            F
Sbjct: 547 AKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHILTELLTF 606

Query: 602 SKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRI 661
           SKN+LKR  LE+R+F + DVALQ+KSIFGK+AKDQ V+ SI L+PN+IR M+L+GDSNRI
Sbjct: 607 SKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFGDSNRI 666

Query: 662 IQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEI-------- 713
           IQIVMNLVSNALKFTPVDGKV++RIKL+GEYDE  S + N  +V +K GTE         
Sbjct: 667 IQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIETKAKAI 726

Query: 714 -----SDETKNVFDTITE--EKYVSCSGESTDDTIETGQEGAQ----------------- 749
                 D+ K   +++ +  E   S +  S++D I T  +  +                 
Sbjct: 727 LGAPKKDDPKTSTESVVQIKENLNSNTSSSSNDIISTTSDEKKYDEKEDEGEEDNSDNDN 786

Query: 750 KPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVE 809
                +  S+VS+ TSSYDDA+F+++FKK P + + ++G+L    +    K WVI+IEV+
Sbjct: 787 DDTSMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGI--ELTNPKTWVIAIEVQ 844

Query: 810 DTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGS 869
           DTGPGIDPSLQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ MM GTM+L SEVGVGS
Sbjct: 845 DTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGS 904

Query: 870 KFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKL 910
            F FTVPL QT  +             N  S+ NRRVKFKL
Sbjct: 905 TFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKFKL 945

 Score =  224 bits (572), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 103/150 (68%), Positives = 127/150 (84%)

Query: 952  DRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDG 1011
            DRPFLQSTGTATSTR+I TV      FK+LVAEDN+VNQEVIKRML LEG+ +IELA DG
Sbjct: 1019 DRPFLQSTGTATSTRTIQTVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDG 1078

Query: 1012 EEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNI 1071
            ++A  +V  +  Q +H++++FMDVQMPK+DGL++T+ IR +L+YTYPIVALTAFADDSNI
Sbjct: 1079 QDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNI 1138

Query: 1072 KVCLESGMDGFLSKPIKREKLRKILLEYCP 1101
            K CLE+GM+GFLSKPIKR K++ IL EYCP
Sbjct: 1139 KECLEAGMNGFLSKPIKRPKVKTILEEYCP 1168

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1068

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/1082 (44%), Positives = 645/1082 (59%), Gaps = 39/1082 (3%)

Query: 25   PPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLTSAQINQT 84
            PPY   L  QL                 +TGVYFT NYKSLRA++L +AAQL S+Q++Q+
Sbjct: 12   PPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71

Query: 85   LNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHLYDSA 144
            LN +YYQ  W    D + +AL+ Y  GN ++ N   +   +  FL SS+   R  +YD+ 
Sbjct: 72   LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131

Query: 145  FNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSFFMSMSLP 204
            F E+ +VS N TG                           G L++PV N S++ MS+SLP
Sbjct: 132  FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191

Query: 205  VSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVY-DENNILNSYQ 263
            +    SI+   S   GY+T++  A  + +V     AL  S V++++  Y +     + Y 
Sbjct: 192  IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251

Query: 264  VLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAACSFKL 323
             +FPP       +++I +P++NNSFL++AF   ++GSVS T  FY   VAVGY+ C+F L
Sbjct: 252  FVFPPYGSDA-SVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSL 310

Query: 324  VNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQKATEL 383
             NWVAVV+Q E+VF S + KLTKII GTV+GIA  +C VTFI++ + VKPI++L++ATEL
Sbjct: 311  ANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATEL 370

Query: 384  IAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLREGDGL----RKTPPSPYTPMHSH 439
            I+ GRGL                         +  L + DG      K+ P+      S 
Sbjct: 371  ISRGRGLRPYYENLSDRTSQDNTSTRT-----TIDLSDLDGYTNEKEKSLPTCTEDERSK 425

Query: 440  VEPNPSGIGREYSVDIARAIGIEVPSSHPSERVDAFTTSANWIETRVPVYRRLFSDELSE 499
               N +   +     + + +G    S   S     F  + +    RVPV+    +DEL+E
Sbjct: 426  SLSNIAS--KSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVHSTYITDELTE 483

Query: 500  LTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTMFIANISHELRTPLN 559
            L +TFN M D LD H  LLE+RV+ARTK+LEAAKI AE+ NEAKT+FIANISHELRTPLN
Sbjct: 484  LKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIANISHELRTPLN 543

Query: 560  GILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFSKNILKRNKLEQRNFSMV 619
            GILGMTAIA+ E+D EK+Q SLKLI+RSG            FSKN+L++ KLE+ +F + 
Sbjct: 544  GILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSKNVLQKTKLEKIHFCIH 603

Query: 620  DVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALKFTPVD 679
            D+ALQ+KSIFGK+AKDQ V FSI + PNLIR MV +GDSNRIIQ++MNLVSNALKFTP+D
Sbjct: 604  DIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLVSNALKFTPID 663

Query: 680  GKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDETKNVFDTITEEKYVSCSGESTDD 739
            G V +RIKLLGEYDEE+S   N  +V+IK+GT  + +   +      +K +S +G S+  
Sbjct: 664  GNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEPISDK-ISFAGGSS-- 720

Query: 740  TIETGQEGAQKPDKADNISV-VSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-E 797
               +  +   K D+ DNI   + S  S+  D   +S    + +  +        +G    
Sbjct: 721  ---SIHDYCSKTDENDNIKTEIKSDDSTISD---YSEENIMGSYYENKNPGQELLGVPIP 774

Query: 798  KKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKG 857
            K K WVIS++VEDTGPGI P+LQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQL+++M G
Sbjct: 775  KPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHG 834

Query: 858  TMKLHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNKGGKSR 917
            TM+L S  G+GSKF FTVPL Q   +             N  SK NR+V FK +K     
Sbjct: 835  TMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDK----- 889

Query: 918  QSSLSVPEISGVPDSPLNSMGXXXXXXXXXXXXXDRPFLQSTGTATSTRSIPTVGSLESN 977
             +S  +P  +   +   N+ G                 L+ T    S  +I      + +
Sbjct: 890  VTSRGIPSKAAEKNDDANTNGQTTLNAEAKSKT-----LKPTHITISEDNID-----QHD 939

Query: 978  FKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQM 1037
            FKVL+ EDN VNQEVIKR+L+LE I  IE A DG+EA++ V    ++ D ++I+FMD+QM
Sbjct: 940  FKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQM 999

Query: 1038 PKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILL 1097
            P +DG  ATR IR ELNY YPIVALTAFADDSN K C  SGM+ FL+KPIKR +L++I+ 
Sbjct: 1000 PNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIK 1059

Query: 1098 EY 1099
            E+
Sbjct: 1060 EF 1061

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
            YIL147C
          Length = 1140

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1137 (40%), Positives = 638/1137 (56%), Gaps = 65/1137 (5%)

Query: 17   RIRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQL 76
            ++ K   +PPY+  L  QLT                 TGVYFTT+YK L  +RL +A+QL
Sbjct: 11   KMNKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQL 70

Query: 77   TSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIF 136
             S+QI+QTLN +YYQCYW++SR++IQ  + S   G  ++  +  ++ VL KF+ +S+  +
Sbjct: 71   KSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFY 130

Query: 137  RTHLYDSAFNEVLSVSTNSTG-NXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGS 195
             T +YD     +++ + N +G N                          G+L++P+ N +
Sbjct: 131  YTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNST 190

Query: 196  SFFMSMSLPVS---AKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGV 252
             + MSMSLP+S   + A+ +  +S+  GY+T+VMSA+ + SV      L+ ST ++L+ +
Sbjct: 191  KYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAI 250

Query: 253  YDENNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNV 312
            Y  + +   +  +FPP  +    +++    I N +F Y AF    SGS  K     + N 
Sbjct: 251  YTNDTLPRYFHFVFPPFDLD-DSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNY 309

Query: 313  AVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVK 372
            A+GYA  +F L  WVAVVA  +  F S S KLTKII GTV+GIA F+ +++  ++ WAV+
Sbjct: 310  AIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQ 369

Query: 373  PIVRLQKATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKG-------SPSPTLREGDGL 425
            PIVRLQ+A+ELI   RGL                              S +PTL+  D  
Sbjct: 370  PIVRLQRASELITKRRGLRNLNDDSFDDSNDDHTYDSNDDHTYESKLISSTPTLKNSDSN 429

Query: 426  RKTPPSPYTPMHSHVEPNPSGIGREYSVDIARAIGIEVPSSHPSERVDAFTTSANWIETR 485
                 S  T   ++     SG     +         +      +  V    + + + E +
Sbjct: 430  IHDEKSGRTRGDAN-----SGTLNSNNTITNNTNNKDFNRLRRNVSVSTHVSLSEFDEIQ 484

Query: 486  VPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTM 545
            VPVYR+LF DEL+ELTDTFN M++ LD HYALLE RV  RTKQLEAAK+QAE+ANEAKT+
Sbjct: 485  VPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAANEAKTV 544

Query: 546  FIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFSKNI 605
            FIANISHELRTPLNGILGMT+ ++ END++K+++ LKLIFRSG            FSKN+
Sbjct: 545  FIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLTFSKNV 604

Query: 606  LKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMP-NLIRKMVLWGDSNRIIQI 664
            L + KLE R F+++++  Q+K+IF KL + Q VK  I L+P   ++ ++ +GDSNRI+Q+
Sbjct: 605  LNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSNRILQV 664

Query: 665  VMNLVSNALKFTP-VDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDE------- 716
            +MNL+SNA+KFTP V+GKV + + LLGEYDEEES+  N ++V IK  T+I  E       
Sbjct: 665  LMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESGELIKS 724

Query: 717  ------TKNVFDTITEEKYVSCSGESTDD---------TIETGQEGAQKPDKADNISVVS 761
                  TK+  +  T     S   ES  +            T         +  N+S V+
Sbjct: 725  KIRCKITKSTTNMNTATTNNSARIESNTNQYLSPYSHTNTRTHTHPGADSRRNSNVSTVN 784

Query: 762  SGTSS--------YDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGP 813
            + + S        YD+ +F+   K+     D D  D+ ++ + E  K WVI  EV D GP
Sbjct: 785  NSSISLDSESSKMYDNLMFNRLIKREG---DGDINDIKALEQIEGNKKWVIRFEVIDNGP 841

Query: 814  GIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIF 873
            GID +L +SVFKPFVQGDQTLSRQYGGTGLGLSIC+QL  MMKGT++L SE+G GSKFI+
Sbjct: 842  GIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKFIY 901

Query: 874  TVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNKGGKSRQSSLSVPEISGVPDSP 933
            T+PL Q G               N  S ++  +    +       SS +  +++ +  + 
Sbjct: 902  TIPLLQVGGTKKDNDDNEEDHNDNTNSSVD--IDIIEDTPVSITSSSQTHSDLNSLQSNS 959

Query: 934  LNSMGX----XXXXXXXXXXXXDRPFLQSTGTATSTRSIPTVGSLE-------SNFKVLV 982
             N +G                 D+  LQ T           +  ++       S  KVLV
Sbjct: 960  TNEVGLDDSFSEAENDSTVASLDKSVLQKTRMDAQKVEANEIDDIDHCNKGIPSKLKVLV 1019

Query: 983  AEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDG 1042
            AEDN VNQEVIKRML+LE I DIELA DG EA EKV      Y  Y+I+FMD+QMPKMDG
Sbjct: 1020 AEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDG 1079

Query: 1043 LIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
            L +T  IR+EL Y   IVALTAFAD+SNIK C ++GMDGF+ KPIKR  L  +L E+
Sbjct: 1080 LESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/683 (54%), Positives = 463/683 (67%), Gaps = 51/683 (7%)

Query: 458  AIGIEVPSSHPSERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYAL 517
            ++GI  P    S     + TSAN IE RVPVY RL  DELSELTDTFN+MTD LD+HY L
Sbjct: 450  SMGIN-PDDDLSSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCL 508

Query: 518  LEDRVRARTKQLEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKV 577
            LE+RVRARTKQLEAAKIQAESANEAKT+FIANISHELRTPLNGILGMTAI+M E+D++K+
Sbjct: 509  LEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKI 568

Query: 578  QNSLKLIFRSGXXXXXXXXXXXXFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQN 637
            + +LKLIFRSG            FSKN+L+R KLE+R+F + +VALQ+KSIFGKLAKDQ+
Sbjct: 569  RGNLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQH 628

Query: 638  VKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEES 697
            VK SI LMPN++R  VLWGDSNRIIQ+VMNLVSNALKFTPVDG V +RI LLGEYDEE S
Sbjct: 629  VKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERS 688

Query: 698  EKCNNAEVFIKQGTE---------------ISDETKNVFDTITEEKYVSCSGESTDDTIE 742
            +  +  +V++KQGTE               IS +++   +    E +     ++ D +I+
Sbjct: 689  KAEDYKKVYVKQGTELPLNISHLKTEENNDISRKSETELNNDENETHTISKDDTADSSIK 748

Query: 743  TGQEGAQ--KPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKK 800
             G E  +  + DK    S+V++ + SYDD     +  K    LD DE  L    + +++K
Sbjct: 749  IGNEDVEISEVDKMGMASLVTTSSKSYDDTALMKQLIK-STDLDDDENKLGV--ELKEQK 805

Query: 801  VWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMK 860
             WVIS+EV+DTG GIDP LQESVF+PFVQGDQ LSRQYGGTGLGLSIC+QLSTMM GTM+
Sbjct: 806  TWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTME 865

Query: 861  LHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNKGGKSRQSS 920
            L SEVGVGSKFIFT+PL+QT  +             NA SK NR+VKFK    G S   S
Sbjct: 866  LESEVGVGSKFIFTLPLKQTREI-SIPDDELFNDEFNAVSKKNRKVKFKF--SGSSSAKS 922

Query: 921  LSVPEISGVPDSPLNSMGXXXXXXXX------------XXXXXDRPFLQSTGTATSTRSI 968
            +      G   S LN+                           +RPFLQSTGTATST+++
Sbjct: 923  IKTRNSIG---SSLNNRHSTTSIDSSSSDSDEEDNVRPSSVRLNRPFLQSTGTATSTQNV 979

Query: 969  PTVGSLESN------------FKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALE 1016
            PT+ +   +              +LVAEDN+VNQEVIKRML+LEGI +I+LA DG++A +
Sbjct: 980  PTLNAHTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFD 1039

Query: 1017 KVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLE 1076
            K   L+    +Y+I+FMDVQMP++DGL AT+ IR+ELNYT PIVAL+AF  + N+K CL+
Sbjct: 1040 KTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLD 1099

Query: 1077 SGMDGFLSKPIKREKLRKILLEY 1099
             GM+ FLSKPIKR  L+ IL +Y
Sbjct: 1100 VGMNDFLSKPIKRPDLKIILKKY 1122

 Score =  294 bits (753), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 223/373 (59%)

Query: 18  IRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLT 77
           I K  ++PPY+  +  QLT                T GVYFT NYK+L+  RL +AAQL 
Sbjct: 4   IPKKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLK 63

Query: 78  SAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFR 137
           ++QI+QTLN +YYQCY+LSS +++QN+LVSY  GN SS N   +  VL KFL SS+    
Sbjct: 64  ASQIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSV 123

Query: 138 THLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSF 197
             LYD+ FN +++ + N++GN                          G+ ++PV NGS+F
Sbjct: 124 ARLYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNF 183

Query: 198 FMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENN 257
            MSMSLP+ A  SI+   S   GY++++MSA+ + SV     AL  S V V++  Y    
Sbjct: 184 LMSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITT 243

Query: 258 ILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYA 317
            L  +  LF  +     +  ++ + I N++F+YN  VN   G+V KTN F     AVGY+
Sbjct: 244 NLEYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYS 303

Query: 318 ACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRL 377
           +CSF LVNW+A+VAQ EA F   +TKL +II G V+ +A F+C++TF +++WAV+P++RL
Sbjct: 304 SCSFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRL 363

Query: 378 QKATELIAAGRGL 390
           QKATE IA GRGL
Sbjct: 364 QKATERIAEGRGL 376

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/725 (54%), Positives = 475/725 (65%), Gaps = 99/725 (13%)

Query: 469  SERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQ 528
            S R    TTSAN  E R+P YRRLFSDELS+LT+TFN+MTD LD+HYALLEDRVRARTKQ
Sbjct: 493  SNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQ 552

Query: 529  LEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSG 588
            LEAAKI+AE+ANEAKT+FIANISHELRTPLNGILGMTAI+M E D+ K++NSLKLIFRSG
Sbjct: 553  LEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSG 612

Query: 589  XXXXXXXXXXXXFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNL 648
                        FSKN+L+R KLE+R+F + DVALQ+KSIFGK+AKDQ V+ SI L PNL
Sbjct: 613  ELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNL 672

Query: 649  IRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIK 708
            IR MVLWGDSNRIIQIVMNLVSNALKFTPVDG V +R+KLLGEYD++ SEK    EV +K
Sbjct: 673  IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKKQFKEVHVK 732

Query: 709  QGTEI---SDETKNVFDTITEEKYVSCSGESTDDTIETG------QEGAQKPDKADNISV 759
            +GTEI   S+ET      I+         EST  +I +       QE   K + A N ++
Sbjct: 733  RGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEEITKRNTAANENI 792

Query: 760  ------------------VSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-EKKK 800
                              VS+ TSSYDDAIF+S+F K P   D DEG   ++GK  E  K
Sbjct: 793  YKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNSQFNKAPGS-DEDEG--GNLGKPIENPK 849

Query: 801  VWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMK 860
             WVISIEVEDTGPGIDPSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL+ MM GTM+
Sbjct: 850  TWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMR 909

Query: 861  LHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNKGGKSRQSS 920
            L S+VGVGSKF FT+PL QT  +             N +S+ NRRVKF + K  KSRQS+
Sbjct: 910  LESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVAKSIKSRQST 969

Query: 921  LSV---------------PEI-------------SGVPDSPLNSMGXXXXXXXXXXXXXD 952
             S+               PEI             S +    +N +G              
Sbjct: 970  SSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQKLQEKNV--- 1026

Query: 953  RPFLQ-STGTATSTRSIP---------------------TVGSLESNFKVLVAEDNN--- 987
            +PF+  S+  ++  +++P                     + G+  S+  V   +DN+   
Sbjct: 1027 KPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQDNDKND 1086

Query: 988  ------------VNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDV 1035
                        VNQEVIKRML LEGI +IELACDG+EA +KV  LT++  +YN++FMDV
Sbjct: 1087 TSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDV 1146

Query: 1036 QMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKI 1095
            QMPK+DGL++T+ IR++L Y  PIVALTAFADDSNIK CLESGM+GFLSKPIKR KL+ I
Sbjct: 1147 QMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTI 1206

Query: 1096 LLEYC 1100
            L E+C
Sbjct: 1207 LTEFC 1211

 Score =  308 bits (788), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 168/371 (45%), Positives = 234/371 (63%), Gaps = 1/371 (0%)

Query: 20  KHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLTSA 79
           K  F PP++ G+  QLT                TTGVYFT+NYK+LR+DRL +AAQL S+
Sbjct: 8   KSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 80  QINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTH 139
           QI+QTLN +YYQ Y+L+SRD++Q++L S+  GN S+ N  ++  V+ KFL SSN  +   
Sbjct: 68  QIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAK 127

Query: 140 LYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSFFM 199
           +YDS+F  VL+ + N TG+                          G+L++PV N + + M
Sbjct: 128 VYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLM 187

Query: 200 SMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNIL 259
           SMSLP+ A  SI+   S   GYIT++MSA+ + SV     AL  S V++++ +Y+     
Sbjct: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKA 247

Query: 260 NSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAAC 319
           + Y  +FPP       L + VF I NN+F+ +AF N   GS+ +TN+F   N+A+GY+ C
Sbjct: 248 SGYHFIFPP-YGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLALGYSPC 306

Query: 320 SFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQK 379
           SF+LVNWVAVV+Q E+VFLSP+TKL KII GTVI I  F+ ++T  +A+WAV+PIVRLQK
Sbjct: 307 SFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366

Query: 380 ATELIAAGRGL 390
           ATELI  GRGL
Sbjct: 367 ATELITEGRGL 377

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/741 (52%), Positives = 481/741 (64%), Gaps = 108/741 (14%)

Query: 482  IETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANE 541
            +ET+VPVYRRLF DELSELTDTFN+M+D LD+HYALLE+RVRARTKQLEAAKI+AE+ANE
Sbjct: 475  LETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEAANE 534

Query: 542  AKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXF 601
            AKT+FIANISHELRTPLNGILGMTAI+M E+D++ +++SLKLIFRSG            F
Sbjct: 535  AKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTELLTF 594

Query: 602  SKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRI 661
            SKN+L+R KLE+R+F + DVALQ+KSIFGK+AKDQ+VK SI+L+PN IR +VLWGDSNRI
Sbjct: 595  SKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDSNRI 654

Query: 662  IQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDETKNVF 721
            IQIVMNLVSNALKFTP+DGKVS+R+ LLGEYD+E+S+  +  EVF+K GTE  +    + 
Sbjct: 655  IQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYSKIL 714

Query: 722  DTITEEKYV------SCSGE--------STDDTIETGQEGA--------QKPDKADNISV 759
              +  EK +      SC  E          +D I    + +            + D +S+
Sbjct: 715  QKLNTEKLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDISIHNRTRDDTLSL 774

Query: 760  VSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSL 819
            +S+ TSSYD+ +F+ +FKKI  + D DE  L    + ++ K WVI IEVEDTGPGI P+L
Sbjct: 775  LSTSTSSYDETVFNDQFKKITGLQDHDEERLGV--EIKEPKTWVICIEVEDTGPGIHPAL 832

Query: 820  QESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQ 879
            QESVF+PFVQGDQ LSRQYGGTGLGLSICRQL+TMM GTM L S+VG GSKF FTVPL Q
Sbjct: 833  QESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQ 892

Query: 880  TGTVXXXXXXXXXX---XXXNAQSKINRRVKFKL---------NKGGKSRQSSLS----- 922
            T  +                N  SK NR+VKF +         N   KSR+S  S     
Sbjct: 893  TREIVIGEDEDINEFFDDEFNIYSKKNRKVKFAIPSSPGTTLANSSLKSRKSKGSLNSSF 952

Query: 923  VPEISGVPDSP--------LNSMGXXXXXXXXXXXXX-------DRPFLQSTGTATSTRS 967
            V EI  V ++         +NS G                    DRPFLQSTGTATST  
Sbjct: 953  VGEIQNVNEAEEDAYNSKDINSSGELKIRHISTSTSNNNSIPSLDRPFLQSTGTATSTMK 1012

Query: 968  IPTV----------------------------------GSLESN-------------FKV 980
            IP +                                  G  ++N              ++
Sbjct: 1013 IPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEEDEGIRI 1072

Query: 981  LVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTN-----QYDHYNIVFMDV 1035
            LV EDN+VNQEVIKRML+LE + +I+LACDGEEA  KV  +T+     + ++Y+++FMDV
Sbjct: 1073 LVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDV 1132

Query: 1036 QMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKI 1095
            QMP+MDGL +T+ IR EL YT PIVALTAFAD+SNIK CL+ GMDGFLSKPIKR KL+ I
Sbjct: 1133 QMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDI 1192

Query: 1096 LLEYCPVLNKSVSTTTNRGLE 1116
            L E+CP  +   +T TN+GL+
Sbjct: 1193 LNEFCPGYHLQNNTDTNKGLQ 1213

 Score =  347 bits (890), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/375 (46%), Positives = 240/375 (64%), Gaps = 2/375 (0%)

Query: 17  RIRKHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQL 76
           R+ + + RPP   G+ TQLT                 TG+YFT NYK +R DRL++AA+L
Sbjct: 5   RMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAEL 64

Query: 77  TSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIF 136
            S+Q++QTLN +YYQCYWLS RD++Q A+ +Y  GN SS    +++ V+ KFL SS+   
Sbjct: 65  KSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFS 124

Query: 137 RTHLYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSS 196
            + LYD+ FN V++ + N TGN                          GML++PV N ++
Sbjct: 125 ISRLYDANFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTT 184

Query: 197 FFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVY-DE 255
           + MSMSLP+ A  SI+   S   GYIT++MSA+ + SV     AL  S V++++G Y D 
Sbjct: 185 YLMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDY 244

Query: 256 NNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVG 315
           +  L  Y  +FPP     P++++I +P+ N SFLY+A  N+  GS+ KT  FY  +VA+G
Sbjct: 245 SASLTEYHFVFPP-YGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIG 303

Query: 316 YAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIV 375
           Y+ CSF LV+WVA+V+Q E+VFLSPSTKLT+II GTV+ IA F+C VTF +++WAVKPIV
Sbjct: 304 YSPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIV 363

Query: 376 RLQKATELIAAGRGL 390
           RLQKATELIA GRGL
Sbjct: 364 RLQKATELIAEGRGL 378

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/692 (49%), Positives = 445/692 (64%), Gaps = 19/692 (2%)

Query: 20  KHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLTSA 79
           K   +PP+   + TQLT                 TGVYFT+++KS+RA+RL VA+QL ++
Sbjct: 14  KRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKAS 73

Query: 80  QINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTH 139
           QI+Q L  +YYQCY+LS+RD +QNAL  Y  GNT++ N  +A   L KFL SSN      
Sbjct: 74  QIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLAR 133

Query: 140 LYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSFFM 199
           +YDS+F +VL+ S N++GN                          GML++PV N + + M
Sbjct: 134 VYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLM 193

Query: 200 SMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNIL 259
           SMSLP+ A  SI+   S   GYIT+V+SA+ + +V     AL  S+V +++ VYD N  L
Sbjct: 194 SMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYD-NREL 252

Query: 260 NSYQVLFPPSIVQVPR-LLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAA 318
             Y ++FPP    +P  +++  + I N+SFL +AF     GS+  T+  Y   VA+GY+ 
Sbjct: 253 AGYHLVFPP--YGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSP 310

Query: 319 CSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQ 378
           CS  LV WVA++ Q E+ FL PST+L +II+GT + IA   C VTF +++WAV+PIVRLQ
Sbjct: 311 CSSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQ 370

Query: 379 KATELIAAGRGLXXXXXXXXXXXXXXXXXXXXXKGSPSPTLREGDGLRKTPPSPYTP--- 435
           KATE+I AGRGL                           ++R    + ++    Y P   
Sbjct: 371 KATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESA 430

Query: 436 -----MHSHVEPNPSGIGREYSVDIA-RAIGIEVPSSHPSE----RVDAFTTSANWIETR 485
                 +   E  P GI  E + D A + +    P S  SE    R + + TS N IE R
Sbjct: 431 KGTLNKNDFEEIQPDGI--ENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTNLIEAR 488

Query: 486 VPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTM 545
           VP Y RLFSDELSELT+TFN+MTDELDRHYALLEDRVRART+QLEAAKI+AE ANEAKT+
Sbjct: 489 VPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTV 548

Query: 546 FIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFSKNI 605
           FIANISHELRTPLNGILGMTAIAMAENDM+KV++SLKLIFRSG            FSKN+
Sbjct: 549 FIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNV 608

Query: 606 LKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIV 665
           LKR KLE+R+F++ ++ALQV+SIFGKLAKDQ+V  +I ++PN++R MVLWGDSNRI+QIV
Sbjct: 609 LKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIV 668

Query: 666 MNLVSNALKFTPVDGKVSLRIKLLGEYDEEES 697
           MNLVSNALKFTPVDG+V+++  LLGEYDE ++
Sbjct: 669 MNLVSNALKFTPVDGRVNVKFTLLGEYDESKA 700

 Score =  370 bits (951), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/370 (54%), Positives = 252/370 (68%), Gaps = 12/370 (3%)

Query: 738  DDTI-ETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS 796
            DDT  ET +E + +    D  S+ S   SSYDDAIFHSR +K  +  + D   L      
Sbjct: 807  DDTNNETQREDSNENQNEDARSIESENASSYDDAIFHSRLRKGNSGENEDGRPL------ 860

Query: 797  EKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMK 856
            E  +   I++EV+DTGPGI+P+LQESVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ MM 
Sbjct: 861  EHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMN 920

Query: 857  GTMKLHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNKGGKS 916
            G+M L S+VGVGSKF FTVPL QT  +             N  SK NR+VKFK++K  K 
Sbjct: 921  GSMSLDSKVGVGSKFTFTVPLTQTKELCFEEDENPFEDEFNPDSKKNRKVKFKVSKNNKR 980

Query: 917  RQSSLSVPEISGVPDSPLNSMGXXXXXXXXXXXXXDRPFLQSTGTATSTRSIPTVGSLES 976
            ++S  S    +    +P  S               DRPFLQSTGTA STRS+ T  S+ +
Sbjct: 981  KKSHSSSSGQNSSVGTPTVS----ESEVSVGSVRVDRPFLQSTGTALSTRSVTTT-SVAN 1035

Query: 977  NFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQ 1036
              KVLVAEDNNVNQEVIKRML LEG+ D++LACDG++A +KV         Y+++FMDVQ
Sbjct: 1036 KCKVLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQ 1095

Query: 1037 MPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKIL 1096
            MP++DGL ATR IR EL+YT+PIVALTA+ADD NIK C+++GM+GFL+KPI+R K+++IL
Sbjct: 1096 MPRVDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEIL 1155

Query: 1097 LEYCPVLNKS 1106
             EYCP   K+
Sbjct: 1156 SEYCPTYFKA 1165

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1259

 Score =  554 bits (1427), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 300/525 (57%), Positives = 358/525 (68%), Gaps = 46/525 (8%)

Query: 449  REYSVDIARAIGIEVPSSHP--SERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNS 506
            R+ + ++ R+  + V S H   S +    TTSAN IE RVP YRRLFSDELS+LTDTFN+
Sbjct: 492  RQGTPELRRSSSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNT 551

Query: 507  MTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTA 566
            MTD LD+HYALLEDRVRARTKQLEAAKI+AE ANEAKT+FIANISHELRTPLNGILGMTA
Sbjct: 552  MTDALDQHYALLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTA 611

Query: 567  IAMAENDMEKVQNSLKLIFRSGXXXXXXXXXXXXFSKNILKRNKLEQRNFSMVDVALQVK 626
            I+M E D+ K+++SLKLIFRSG            FSKN+LKR  LE+R+F + DVALQ+K
Sbjct: 612  ISMEETDISKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIK 671

Query: 627  SIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRI 686
            SIFGK+AKDQ VK SI L PN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDGKV++++
Sbjct: 672  SIFGKVAKDQRVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKV 731

Query: 687  KLLGEYDEEESEKCNNAEVFIKQGTEI--------------------------------- 713
            KL+GEYDE  S K N  EV++KQGTE+                                 
Sbjct: 732  KLIGEYDEALSAKNNFKEVYVKQGTELLGCSNPIEKTNESIPSPKSENNNSSSTTSGKDT 791

Query: 714  -----SDETKNVFDTITEEKYVS--CSGESTDDTIETGQEGAQKPDKADNISVVSSGTSS 766
                 S E +   D + +EK  +     E+TDDT    +   Q     DNIS+VS+ TSS
Sbjct: 792  TNSETSFEDEKSADDLDDEKIATKDAENENTDDTENLDE---QTDSVCDNISLVSTSTSS 848

Query: 767  YDDAIFHSRFKKIPAVLDVDEGDLSSIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKP 826
            YDDAIF+S+FKK P + D DE + + +   E  K WVI I VEDTGPGID +LQESVF+P
Sbjct: 849  YDDAIFNSQFKKSPGLYDDDENNDAGV-LIEDPKTWVIQISVEDTGPGIDKTLQESVFQP 907

Query: 827  FVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVXXX 886
            FVQGDQTLSRQYGGTGLGLSICRQL+ MM GTMKL SEVGVGS F FTVPL+QT  +   
Sbjct: 908  FVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFD 967

Query: 887  XXXXXXXXXXNAQSKINRRVKFKLNKGGKSRQSSLSVPEISGVPD 931
                      N +S+ NR+VKFKL +  +S++S  S      V D
Sbjct: 968  DMEHPFEDEFNPESRKNRKVKFKLARSIRSKKSRASTVTFGTVTD 1012

 Score =  325 bits (834), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 167/372 (44%), Positives = 234/372 (62%), Gaps = 3/372 (0%)

Query: 20  KHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLTSA 79
           K + +PP++ G+  QLT                TTGVYFT NYK+LR+DRL +AAQL S+
Sbjct: 6   KFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSS 65

Query: 80  QINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTH 139
           QI+QTLN +YYQCY++SSRD++Q AL +Y  GN S+ N  ++  +L KFL SSN      
Sbjct: 66  QIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAK 125

Query: 140 LYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSFFM 199
           +YD++F  VL+V+ N TG+                          G+L++PV N S++ M
Sbjct: 126 VYDASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLM 185

Query: 200 SMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNIL 259
           SMSLP+ A  S++  +S   GY+T+VMSA+ + +V     AL  S V++++ VY+  + L
Sbjct: 186 SMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSAL 245

Query: 260 NSYQVLFPPSIVQVPR-LLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAA 318
            +Y+ +F P  +  P  ++   + + N SFL +A      GS+  T  FY  NVA+GY+ 
Sbjct: 246 TAYRFVFAP--MGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSP 303

Query: 319 CSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQ 378
           C+F  VNWVAVV+Q E+VFLSPSTKL KII GTV+ I  F+ I+TF +A+WAVKPIVRLQ
Sbjct: 304 CTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQ 363

Query: 379 KATELIAAGRGL 390
           KATELI+ GRGL
Sbjct: 364 KATELISEGRGL 375

 Score =  229 bits (584), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 107/156 (68%), Positives = 128/156 (82%), Gaps = 6/156 (3%)

Query: 952  DRPFLQSTGTATSTRSIPTVGSLE------SNFKVLVAEDNNVNQEVIKRMLQLEGIYDI 1005
            DRPFLQSTGTATS+R++P +           N K+LVAEDN+VNQEVIKRML LEG+  I
Sbjct: 1097 DRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGVNKI 1156

Query: 1006 ELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAF 1065
            +LACDG+EA +KV  L+ Q D YNI+FMDVQMPK+DGL++T+ IRK+L+Y +PIVALTAF
Sbjct: 1157 DLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTAF 1216

Query: 1066 ADDSNIKVCLESGMDGFLSKPIKREKLRKILLEYCP 1101
            ADDSNIK CLESGM+GFLSKPIKR KLR I+ EYCP
Sbjct: 1217 ADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCP 1252

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
           YIL147C (REAL)
          Length = 1221

 Score =  520 bits (1339), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 294/486 (60%), Positives = 349/486 (71%), Gaps = 33/486 (6%)

Query: 469 SERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQ 528
           S R    TTSAN  E R+P Y+RLFSDELS+LT+TFN+MTD LD+HYALLEDRVRARTKQ
Sbjct: 493 SSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQ 552

Query: 529 LEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSG 588
           LEAAKI+AE+ANEAKT+FIANISHELRTPLNGILGMTAI+M E D+ K++N+LKLIFRSG
Sbjct: 553 LEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSG 612

Query: 589 XXXXXXXXXXXXFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNL 648
                       FSKN+L+R KLE+R+F + DVALQ+KSIFGK+AKDQ V+ SI L PNL
Sbjct: 613 ELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNL 672

Query: 649 IRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIK 708
           IR MVLWGDSNRIIQIVMNLVSNALKFTPVDG V +R+KLLGEYD++ SEK    EV +K
Sbjct: 673 IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVK 732

Query: 709 QGTEISD-----ETKNVFDTITEEKYV----------SCSGES------------TDDTI 741
           +GTEI+D     + +++  ++   KYV          SC   S             ++ I
Sbjct: 733 KGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANENI 792

Query: 742 ETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-EKKK 800
                  +K    D  S+VS+ TSSYDDAIF+S+F K    LD D  +  ++G+  E  K
Sbjct: 793 YKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQFNK---ALDSDSDESGNVGRPIENPK 849

Query: 801 VWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMK 860
            WVISIEVEDTGPGI+PSLQESVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ MM GTMK
Sbjct: 850 TWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMK 909

Query: 861 LHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNKGGKSRQ-- 918
           L S+VGVGSKF FT+PL QT  +             N +SK NRRVKF + K  KSRQ  
Sbjct: 910 LESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQST 969

Query: 919 SSLSVP 924
           SSL+ P
Sbjct: 970 SSLTTP 975

 Score =  308 bits (789), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 170/371 (45%), Positives = 231/371 (62%), Gaps = 7/371 (1%)

Query: 23  FRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLTSAQIN 82
           F PP++ G+  QLT                TTGVYFT+NYK+LR+DRL +AAQL S+Q++
Sbjct: 11  FIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVD 70

Query: 83  QTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHLYD 142
           QTLN +YYQ Y+L+SRD++Q++L SY  GN S  N  ++  V+ KFL SSN  +   +YD
Sbjct: 71  QTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYD 130

Query: 143 SAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSFFMSMS 202
           S+F  VL+ + N TG+                          G+L++P+ N + + MSMS
Sbjct: 131 SSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMS 190

Query: 203 LPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNILNSY 262
           LP+ A  SI+   S   GYIT+VMSA+ + SV     AL  S V++++  Y+     + Y
Sbjct: 191 LPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGY 250

Query: 263 QVLFPPSIVQVPRLLEI---VFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAAC 319
             +FPP       LL I   +FPI NN+F+ + F N   GS+ KTN F   N+A+GY+ C
Sbjct: 251 HFVFPP----YGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPC 306

Query: 320 SFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQK 379
           SF+LVNWVAVV+Q E+VFLSP+TKLTKII GTVI I  F+ ++T  + +WAVKPIVRLQK
Sbjct: 307 SFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQK 366

Query: 380 ATELIAAGRGL 390
           ATELI  GRGL
Sbjct: 367 ATELITEGRGL 377

 Score =  219 bits (559), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 103/152 (67%), Positives = 129/152 (84%), Gaps = 3/152 (1%)

Query: 952  DRPFLQSTGTATSTRSIPTVGSLE---SNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELA 1008
            DRPFLQSTGTATS+R++PTV   +   ++ K+LV EDN+VNQEVI+RML LEGI +IELA
Sbjct: 1060 DRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELA 1119

Query: 1009 CDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADD 1068
            CDG+EA +KV  LT++ ++YN++FMDVQMPK+DGL++T+ IR++L Y  PIVALTAFADD
Sbjct: 1120 CDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADD 1179

Query: 1069 SNIKVCLESGMDGFLSKPIKREKLRKILLEYC 1100
            SNIK CLESGM+GFLSKPIKR KL  IL E+C
Sbjct: 1180 SNIKECLESGMNGFLSKPIKRPKLNTILSEFC 1211

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
           SLN1Histidine kinase osmosensor that regulates a MAP
           kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1220

 Score =  519 bits (1336), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 295/485 (60%), Positives = 348/485 (71%), Gaps = 35/485 (7%)

Query: 469 SERVDAFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQ 528
           S R    TTSAN  E R+P YRRLFSDELS+LT+TFN+MTD LD+HYALLE+RVRARTKQ
Sbjct: 493 SNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQ 552

Query: 529 LEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSG 588
           LEAAKI+AE+ANEAKT+FIANISHELRTPLNGILGMTAI+M E D+ K++NSLKLIFRSG
Sbjct: 553 LEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSG 612

Query: 589 XXXXXXXXXXXXFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNL 648
                       FSKN+L+R KLE+R+F + DVALQ+KSIFGK+AKDQ V+ SI L PNL
Sbjct: 613 ELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNL 672

Query: 649 IRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIK 708
           IR MVLWGDSNRIIQIVMNLVSNALKFTPVDG V +R+KLLGEYD+E SEK    EV+IK
Sbjct: 673 IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIK 732

Query: 709 QGTEISD--ETKNVFD---------------------------TITEEKYVSCSGESTDD 739
           +GTE+++  ET + +D                           TI EE  ++      ++
Sbjct: 733 KGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE--ITKRNTVANE 790

Query: 740 TIETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-EK 798
           +I       +K    D  S+VS+ TSSYD+AIF+S+F K P   D + G+L   G+  E 
Sbjct: 791 SIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGNL---GRPIEN 847

Query: 799 KKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGT 858
            K WVISIEVEDTGPGIDPSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL+ MM GT
Sbjct: 848 PKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGT 907

Query: 859 MKLHSEVGVGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNKGGKSRQ 918
           MKL S+VGVGSKF FT+PL QT  +             N +S+ NRRVKF + K  KSRQ
Sbjct: 908 MKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAKSIKSRQ 967

Query: 919 SSLSV 923
           S+ SV
Sbjct: 968 STSSV 972

 Score =  307 bits (787), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 168/368 (45%), Positives = 233/368 (63%), Gaps = 5/368 (1%)

Query: 25  PPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLTSAQINQT 84
           PP++ G+ TQLT                TTGVYFT+NYK+LR+DRL +AAQL S+QI+QT
Sbjct: 13  PPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72

Query: 85  LNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHLYDSA 144
           LN +YYQ Y+L+SRD++Q++L SY  GN S+ N  ++  V+ KFL SSN  +   +YDS+
Sbjct: 73  LNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSS 132

Query: 145 FNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSFFMSMSLP 204
           FN VL+ + N TG+                          G+L++PV N + + MSMSLP
Sbjct: 133 FNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLP 192

Query: 205 VSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNILNSYQV 264
           + A  SI+   S   GYIT++MSA+ + SV     AL  ST+++++ VY+     + Y  
Sbjct: 193 IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHF 252

Query: 265 LFPP--SIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAACSFK 322
           +FPP  S   +P   + VF I N++F+ +AF N   GS+ +TN     N A+GY+ CSF 
Sbjct: 253 VFPPYGSRSDLP---QKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFN 309

Query: 323 LVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQKATE 382
           LVNWVA+V+Q E+VFLSP+TKL KII GTVI I  F+ ++T  +A+WAV+PIVRLQKATE
Sbjct: 310 LVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATE 369

Query: 383 LIAAGRGL 390
           LI  GRGL
Sbjct: 370 LITEGRGL 377

 Score =  226 bits (577), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 130/152 (85%), Gaps = 3/152 (1%)

Query: 952  DRPFLQSTGTATSTRSIPTVGSLESN---FKVLVAEDNNVNQEVIKRMLQLEGIYDIELA 1008
            DRPFLQSTGTATS+R+IPTV   + N    K+LV EDN+VNQEVIKRML LEGI +IELA
Sbjct: 1059 DRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELA 1118

Query: 1009 CDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADD 1068
            CDG+EA +KV  LT++ ++YN++FMDVQMPK+DGL++T+ IR++L YT PIVALTAFADD
Sbjct: 1119 CDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADD 1178

Query: 1069 SNIKVCLESGMDGFLSKPIKREKLRKILLEYC 1100
            SNIK CLESGM+GFLSKPIKR KL+ IL E+C
Sbjct: 1179 SNIKECLESGMNGFLSKPIKRPKLKTILTEFC 1210

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
           YIL147C (REAL)
          Length = 1219

 Score =  513 bits (1322), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 288/477 (60%), Positives = 340/477 (71%), Gaps = 31/477 (6%)

Query: 475 FTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKI 534
            TTSAN  E R+P YRRLFSDELS+LT+TFN+MTD LD+HYALLEDRVRARTKQLEAAKI
Sbjct: 499 LTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKI 558

Query: 535 QAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGXXXXXX 594
           +AE+ANEAKT+FIANISHELRTPLNGILGMTAI+M E D+ K++NSLKLIFRSG      
Sbjct: 559 EAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHI 618

Query: 595 XXXXXXFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVL 654
                 FSKN+L+R KLE+R+F + DVALQ+KSIFGK+AKDQ V+ SI L PN IR MVL
Sbjct: 619 LTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVL 678

Query: 655 WGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEIS 714
           WGDSNRIIQIVMNLVSNALKFTPVDG V +R+KLLGEYD+E SEK    EV +++GTEI 
Sbjct: 679 WGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEII 738

Query: 715 DETKNV---------------------------FDTITEEKYVSCSGESTDDTIETGQEG 747
           ++  N+                            DT T ++ ++    + ++ I      
Sbjct: 739 EDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQEEITKRNTAANENIYKKTRD 798

Query: 748 AQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-EKKKVWVISI 806
            +K    D  S+VS+ TSSYDDAIF+S+F K     D + GDL   GK  E  K W ISI
Sbjct: 799 REKSSNDDISSIVSTSTSSYDDAIFNSQFNKALGSDDDEGGDL---GKPIENPKTWAISI 855

Query: 807 EVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVG 866
           EVEDTGPGIDPSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL+ MM GTMKL S+VG
Sbjct: 856 EVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVG 915

Query: 867 VGSKFIFTVPLRQTGTVXXXXXXXXXXXXXNAQSKINRRVKFKLNKGGKSRQSSLSV 923
           VGSKF FT+PL QT  +             N +S+ NRRVKF + +  KSRQS+ S+
Sbjct: 916 VGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVARSIKSRQSASSI 972

 Score =  315 bits (807), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 169/371 (45%), Positives = 235/371 (63%), Gaps = 1/371 (0%)

Query: 20  KHMFRPPYKAGLSTQLTXXXXXXXXXXXXXXXXTTGVYFTTNYKSLRADRLTVAAQLTSA 79
           + +F PP++  +  QLT                TTGVYFT+NYK+LR+DRL +AAQL S+
Sbjct: 8   RSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67

Query: 80  QINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTH 139
           QI+QTLN +YYQ Y+L+SRD++QN+L  Y  GN SS N  ++  ++ KFL SSN  F   
Sbjct: 68  QIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNLFFVAK 127

Query: 140 LYDSAFNEVLSVSTNSTGNXXXXXXXXXXXXXXXXXXXXXXXXXXGMLSNPVFNGSSFFM 199
           +YDS+F  VL+ + N TG+                          G+L++P+ N + + M
Sbjct: 128 VYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNSTDYLM 187

Query: 200 SMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNIL 259
           SMSLP+ A  SI+   S   GYIT++MSA+ + SV     AL  S V++++ VY+  +  
Sbjct: 188 SMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYNNQSKA 247

Query: 260 NSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAAC 319
            +Y  +FPP       + + +FPI NN+F+ +AF N   GS+ KTN+F   N+A+GY+ C
Sbjct: 248 YAYHFVFPPYGTS-SSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALGYSPC 306

Query: 320 SFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQK 379
           SF+LVNWVAVV+Q E+VFLSPSTKL KII GTVI I  F+ ++T  +A+WAV+PIVRLQK
Sbjct: 307 SFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQK 366

Query: 380 ATELIAAGRGL 390
           ATELI  GRGL
Sbjct: 367 ATELITEGRGL 377

 Score =  226 bits (576), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 106/152 (69%), Positives = 131/152 (86%), Gaps = 3/152 (1%)

Query: 952  DRPFLQSTGTATSTRSIPTVGSLE---SNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELA 1008
            DRPFLQSTGTATS R+IPTV + +   S+ K+LV EDN+VNQEVIKRML LEGI +IELA
Sbjct: 1060 DRPFLQSTGTATSNRNIPTVSNSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENIELA 1119

Query: 1009 CDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADD 1068
            CDG++A +KV  LT++ + YN++FMDVQMPK+DGL++T+ IR++L YT PIVALTAFADD
Sbjct: 1120 CDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADD 1179

Query: 1069 SNIKVCLESGMDGFLSKPIKREKLRKILLEYC 1100
            SNIK CLESGM+GFLSKPIKR KL+ IL+E+C
Sbjct: 1180 SNIKECLESGMNGFLSKPIKRPKLKTILIEFC 1211

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 87/172 (50%), Gaps = 15/172 (8%)

Query: 954  PFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEE 1013
            P  Q+T +       PT  SL   F VL+ ED++V  ++  + L+  G   +E+  DG  
Sbjct: 297  PLAQATPSKEEANP-PT--SLRPGFHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLS 352

Query: 1014 ALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKV 1073
            A+E V         Y++V MD+ MP +DG  AT  IR   N T PI+A+T   +D ++  
Sbjct: 353  AIETVEKF-----QYDLVLMDIVMPNLDGATATSVIRSFDNQT-PIIAMTGNIEDQDLVT 406

Query: 1074 CLESGMDGFLSKPIKREKLRKILLEYC----PVLNK-SVSTTTNRGLEDPLF 1120
             L+ GM+  L+KP  ++ L  +L+ Y     P+  + SV  T   G + PL 
Sbjct: 407  YLQHGMNDILAKPFTKDDLHSMLVRYLKDRIPLTEQASVVGTAQSGAQPPLL 458

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 76/144 (52%), Gaps = 11/144 (7%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L   F VL+ ED++V  ++  + L+  G   +E+  DG  A+E V         Y++V M
Sbjct: 325  LRPGFCVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLM 378

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT  IR   N T PI+A+T   +D ++   L+ GM+  L+KP  ++ L 
Sbjct: 379  DIVMPNLDGATATSVIRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLH 437

Query: 1094 KILLEY----CPVLNKSVSTTTNR 1113
             +L+ Y     P+  ++ ST   R
Sbjct: 438  SMLIRYLKDRVPLAEQNSSTAQPR 461

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 69/126 (54%), Gaps = 7/126 (5%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L   F VL+ ED+ ++ ++  + L+  G   +++  DG  A+  + N       Y++V M
Sbjct: 399  LRKGFHVLLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSAITTLEN-----SRYDLVLM 452

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT  IR   N T PI+A+T   DD ++   L+ GM+  L+KP  R+ L 
Sbjct: 453  DIVMPNLDGATATSIIRSFDNQT-PIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLH 511

Query: 1094 KILLEY 1099
             +L+ Y
Sbjct: 512  SMLIRY 517

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 80/142 (56%), Gaps = 7/142 (4%)

Query: 958  STGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEK 1017
            S+ ++++T+ +     L   F VL+ ED++V+ ++  + L+  G   +++  DG   L  
Sbjct: 385  SSNSSSTTKEVDQNIVLRKGFHVLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDG---LSA 440

Query: 1018 VANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLES 1077
            ++NL  +   Y++V MD+ MP +DG  AT  +R   N T PI+A+T   +D ++   L+ 
Sbjct: 441  ISNL--EKFRYDLVLMDIVMPNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLITYLQH 497

Query: 1078 GMDGFLSKPIKREKLRKILLEY 1099
            GM+  L+KP  R  L  IL+ +
Sbjct: 498  GMNDILAKPFTRNDLHSILIRH 519

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L   F VL+ ED+ ++ ++  + L+  G   +E+  DG  A+  +         Y++V M
Sbjct: 349  LRKGFHVLLVEDDAISIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLM 402

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT  IR   N T PI+A+T   +D ++   L+ GM+  L+KP  R+ L 
Sbjct: 403  DIVMPNLDGATATSIIRSFDNQT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLH 461

Query: 1094 KILLEY 1099
             +L+ Y
Sbjct: 462  SMLIRY 467

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 69/126 (54%), Gaps = 7/126 (5%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L+  F VL+ ED+ V  ++  + L+  G   +E+  DG  A+  +         Y++V M
Sbjct: 330  LKEGFHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLM 383

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT  +R   N+T PI+A+T   +D ++   L+ GM+  L+KP  ++ L 
Sbjct: 384  DIVMPNLDGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLH 442

Query: 1094 KILLEY 1099
             +L+ Y
Sbjct: 443  SMLIRY 448

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L   F VL+ ED+ V+  +  + L+  G   +E+  DG  A+  +         Y++V M
Sbjct: 377  LRPGFHVLLVEDDAVSIRLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLM 430

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT  IR   N T PI+A+T   +D ++   L+ GM+  L+KP  ++ L 
Sbjct: 431  DIVMPNLDGATATSIIRNFDNQT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLH 489

Query: 1094 KILLEY 1099
             +L+ Y
Sbjct: 490  SMLIRY 495

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L   F VL+ ED++V  ++  + L   G   +E+  DG  A+  +         Y++V M
Sbjct: 303  LRPGFHVLLVEDDSVCIQLCSKFLLKYGC-SVEVVTDGLSAISTLEKF-----RYDLVLM 356

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT  +R   N T PI+A+T   +D ++   LE GM+  L+KP  ++ L 
Sbjct: 357  DIVMPNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLH 415

Query: 1094 KILLEY 1099
             +L+ Y
Sbjct: 416  SMLIRY 421

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 70/126 (55%), Gaps = 7/126 (5%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L   F VL+ ED++V  ++  + L+  G   +E+  DG   L  ++ L  Q   +++V M
Sbjct: 325  LRPGFHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDG---LSAISTLEKQ--RFDLVLM 378

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT  +R   N T PI+A+T   DD ++   L+ GM+  L+KP  ++ L 
Sbjct: 379  DIVMPNLDGATATSIVRSFDNET-PIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLH 437

Query: 1094 KILLEY 1099
             +L+ Y
Sbjct: 438  SMLIRY 443

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L   F VL+ ED+++  ++  + L   G   +E+  DG  A+  +         Y++V M
Sbjct: 301  LRPGFHVLLVEDDSICIQLCSKFLMKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLM 354

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT  +R   N T PI+A+T   +D ++   L+ GM+  L+KP  ++ L 
Sbjct: 355  DIVMPNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLH 413

Query: 1094 KILLEY 1099
             +L+ Y
Sbjct: 414  SMLIRY 419

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L   F VL+ ED+ V  ++  + L+  G   + +  DG  A+  + N       +++V M
Sbjct: 412  LRKGFHVLLVEDDEVCIQLCSKFLRKYGCT-VRVVTDGLTAISVLEN-----HRFDLVLM 465

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT  +R   NYT PI+A+T   +D ++   L+ GM+  L+KP  +  L 
Sbjct: 466  DIVMPNLDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLH 524

Query: 1094 KILLEY 1099
             +L+ Y
Sbjct: 525  SMLVRY 530

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 69/130 (53%), Gaps = 7/130 (5%)

Query: 970  TVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYN 1029
            T  +L   F VL+ ED+ V+ ++  + L+  G   +++  DG  A+  +         Y+
Sbjct: 371  TTVTLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYD 424

Query: 1030 IVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKR 1089
            +V MD+ MP +DG  AT  +R   N T PI+A+T    + ++   L+ GM+  L+KP  R
Sbjct: 425  LVLMDIVMPNLDGATATSIVRSFDNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTR 483

Query: 1090 EKLRKILLEY 1099
            + L  IL+ Y
Sbjct: 484  DDLHSILIRY 493

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L   F VL+ ED+ V  ++  + L+  G   +E+  DG  A+  +         Y++V M
Sbjct: 372  LREGFHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLEKF-----RYDLVLM 425

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT +I +  +   PI+A+T   +D ++   L+ GM+  L+KP  ++ L 
Sbjct: 426  DIVMPNLDGATAT-SIVRSFDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLH 484

Query: 1094 KILLEY 1099
             +L+ Y
Sbjct: 485  SMLIRY 490

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 68/127 (53%), Gaps = 7/127 (5%)

Query: 973  SLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVF 1032
            +L   F VL+ ED+ V+ ++  + L+  G   +++  DG  A+  +         Y++V 
Sbjct: 373  TLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLVL 426

Query: 1033 MDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKL 1092
            MD+ MP +DG  AT  +R   N T PI+A+T    + ++   L+ GM+  L+KP  R+ L
Sbjct: 427  MDIVMPNLDGATATSIVRSFDNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDL 485

Query: 1093 RKILLEY 1099
              IL+ Y
Sbjct: 486  HSILIRY 492

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 70/127 (55%), Gaps = 7/127 (5%)

Query: 973  SLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVF 1032
            +L   F VL+ ED+ V+ ++  + L+  G   +++  DG  A+  +     +Y  Y++V 
Sbjct: 372  TLRKGFHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVSDGLSAISTLE----KY-RYDLVL 425

Query: 1033 MDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKL 1092
            MD+ MP +DG  AT  +R   N T PI+A+T    + ++   L+ GM+  L+KP  R+ L
Sbjct: 426  MDIVMPNLDGATATSIVRSFDNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDL 484

Query: 1093 RKILLEY 1099
              IL+ Y
Sbjct: 485  HSILIRY 491

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 76/145 (52%), Gaps = 12/145 (8%)

Query: 960  GTATSTRSIPTVGSLESN-----FKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEA 1014
            G+A        +G ++SN     F VL+ ED++V+ ++  + L+  G   +++  DG  A
Sbjct: 359  GSADINSKNDDIGDVDSNELKKGFHVLLVEDDDVSIQLCSKFLRKYGCT-VQVVTDGLAA 417

Query: 1015 LEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVC 1074
            +  +         +++V MD+ MP +DG  AT  IR   N T PI+A+T   +  ++   
Sbjct: 418  ISILEKF-----RFDLVLMDIVMPNLDGATATSIIRNFDNRT-PIIAMTGSIEHQDLITY 471

Query: 1075 LESGMDGFLSKPIKREKLRKILLEY 1099
            L+ GM+  L+KP  R+ L  IL+ Y
Sbjct: 472  LQHGMNDILAKPFTRKDLYSILIRY 496

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 68/127 (53%), Gaps = 7/127 (5%)

Query: 973  SLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVF 1032
            +L   F VL+ ED+ V+ ++  + L+  G   +++  DG  A+  +         Y++V 
Sbjct: 374  TLRKGFHVLLVEDDVVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLVL 427

Query: 1033 MDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKL 1092
            MD+ MP +DG  AT  +R   N T PI+A+T    + ++   L+ GM+  L+KP  R+ L
Sbjct: 428  MDIVMPNLDGATATSIVRSFDNET-PIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDL 486

Query: 1093 RKILLEY 1099
              IL+ Y
Sbjct: 487  HSILIRY 493

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L   F VL+ ED+++  ++  + L ++    +E+  DG  A+  +         +++V M
Sbjct: 298  LRPGFHVLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKF-----RFDLVLM 351

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT  +R   N T PI+A+T   +D ++   L+ GM+  L+KP  ++ L 
Sbjct: 352  DIVMPNLDGATATSIVRSFDNQT-PIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLH 410

Query: 1094 KILLEY 1099
             +L+ Y
Sbjct: 411  SMLIRY 416

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 75/149 (50%), Gaps = 16/149 (10%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L   + VL+ ED+ V+ ++  + L+  G   +E+  DG  A+  +         Y++V M
Sbjct: 420  LRKGYHVLLVEDDAVSIQLCSKFLRKSGCT-VEVVTDGLAAISILEAF-----RYDLVLM 473

Query: 1034 DVQMPKMDGLIAT---RNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKRE 1090
            D+ MP +DG  AT   RN  KE     PI+A+T   +D ++   L+ GM   L+KP  R+
Sbjct: 474  DIVMPNLDGATATSIIRNFDKET----PIIAMTGNIEDQDLITYLQHGMTDILAKPFTRD 529

Query: 1091 KLRKILLEYCPVLNKSVSTTTNRGLEDPL 1119
             L  +L+ +   L+K +     +  E P+
Sbjct: 530  DLLSMLIRH---LSKRIPLCERQQSEPPI 555

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query: 974  LESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFM 1033
            L+  F VL+ ED+ V+ ++  + L   G   +++  DG  A+  +         +++V M
Sbjct: 346  LKKGFNVLLVEDDEVSIQLCSKFLIKYGCT-VQVVTDGLAAISTLEKY-----RFDLVLM 399

Query: 1034 DVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLR 1093
            D+ MP +DG  AT  IR   N T PI+A+T   +  ++   L+ GM+  L+KP  R  L 
Sbjct: 400  DIVMPNLDGATATSIIRNFDNET-PIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLY 458

Query: 1094 KILLEY 1099
             +L  Y
Sbjct: 459  SMLTRY 464

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 68/125 (54%), Gaps = 11/125 (8%)

Query: 980  VLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPK 1039
            VL+ EDN +NQ ++   L+   I   ++A +G+EA+E   N        +++FMD+Q+P 
Sbjct: 477  VLIVEDNVINQAILGGFLRKHKI-SYKVAKNGKEAVEMWKN-----GGLHLIFMDLQLPV 530

Query: 1040 MDGLIATRNIR---KELNYTYP--IVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRK 1094
            + G+ A + IR   KE     P  IVALTA     + +  L SG + +L+KP+    L K
Sbjct: 531  LSGIDAAKQIRDFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHWLSK 590

Query: 1095 ILLEY 1099
             + E+
Sbjct: 591  KITEW 595

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 77/168 (45%), Gaps = 44/168 (26%)

Query: 961  TATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALE--KV 1018
            T TS +  P +        VL+ EDN +NQ ++   L+   I   +LA +G+EA+   K 
Sbjct: 476  TTTSEKVFPKIN-------VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE 527

Query: 1019 ANLTNQYDHYNIVFMDVQMPKMDGLIATRNIR-----------KELNYTYP--------- 1058
              L       +++FMD+Q+P + G+ A + IR           K LN +YP         
Sbjct: 528  GGL-------HLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKK 580

Query: 1059 -------IVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
                   IVALTA     + +  L SG + +L+KP+    L K + E+
Sbjct: 581  FSQAPVIIVALTASNSQMDKRKALVSGCNDYLTKPVNLHWLSKKITEW 628

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 74/148 (50%), Gaps = 34/148 (22%)

Query: 980  VLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPK 1039
            VL+ EDN +NQ ++   L+   I   E+A +G EA+EK      +    +++ MD+Q+P 
Sbjct: 551  VLIVEDNIINQAILVSFLKRHRI-SYEIAKNGAEAVEKW-----RQGGIHLILMDLQLPL 604

Query: 1040 MDGLIATRNIR--KELN------------------------YTYP--IVALTAFADDSNI 1071
            + GL AT+ IR  ++LN                        +  P  IVALTAF+  ++ 
Sbjct: 605  LSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSHADR 664

Query: 1072 KVCLESGMDGFLSKPIKREKLRKILLEY 1099
            +  L +G + +L+KP+  + L   + E+
Sbjct: 665  REALVAGCNDYLTKPVNLDWLSSKITEW 692

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 74/150 (49%), Gaps = 24/150 (16%)

Query: 959  TGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALE-- 1016
            T T+TS    P +        VL+ EDN +NQ ++   L+   I   ++A +G+EA++  
Sbjct: 505  TNTSTSANVFPKIN-------VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIW 556

Query: 1017 KVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRK-------ELNYTYPIVALTAFADDS 1069
            K   L       +++FMD+Q+P + G+ A + IR          N    IVALTA     
Sbjct: 557  KEGGL-------HLIFMDLQLPVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIE 609

Query: 1070 NIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
            + +  L SG + +L+KP+    L K + E+
Sbjct: 610  DKRKALISGCNDYLTKPVNLHWLSKKITEW 639

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 71/148 (47%), Gaps = 34/148 (22%)

Query: 980  VLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPK 1039
            VL+ EDN +NQ ++   L+   I   E+A +G EA+EK      +    +++ MD+Q+P 
Sbjct: 511  VLIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEAVEKW-----RKGGIHLILMDLQLPL 564

Query: 1040 MDGLIATRNIR-----------------------KELN---YTYP--IVALTAFADDSNI 1071
            + G+ A + IR                        ELN   +  P  IVALTAF+  ++ 
Sbjct: 565  LSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSHADR 624

Query: 1072 KVCLESGMDGFLSKPIKREKLRKILLEY 1099
               L +G + +L+KP+  + L   + E+
Sbjct: 625  NEALVAGCNDYLTKPVNLDWLSNKITEW 652

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 80/174 (45%), Gaps = 40/174 (22%)

Query: 952  DRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDG 1011
            ++PF     +ATS +  P +        VL+ EDN +NQ ++   L+   I+  ++A +G
Sbjct: 547  EKPF-PGEWSATSDKVFPKIN-------VLIVEDNVINQTILSSFLRKHKIF-YKVAKNG 597

Query: 1012 EEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRK-------------------- 1051
            +EA++       +    +++FMD+Q+P + G+ A + IR+                    
Sbjct: 598  QEAID-----VWREGGIHLIFMDLQLPVLSGIDAAKKIRELEREHGIGIQKSRKTPHIES 652

Query: 1052 ------ELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
                  ++N    IVA TA    S+ K  L SG + +L+KP+    L   + E+
Sbjct: 653  NKINKDQINAPVIIVAFTASKSQSDKKEALISGCNDYLTKPVNLHWLSNKINEW 706

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 80/168 (47%), Gaps = 29/168 (17%)

Query: 954  PFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEE 1013
            PF+ S   + +T SI T   +     VLV EDN +NQ ++   L+   I+  ++A +G E
Sbjct: 383  PFILSAMESVTTESI-TRDKVFPKISVLVVEDNMINQAILSSFLRKHKIH-YKVAKNGVE 440

Query: 1014 ALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIR--------------------KEL 1053
            A+++      +    +++ MD++MP + G+ A + IR                    K L
Sbjct: 441  AVDRW-----KEGGMHLILMDLEMPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGL 495

Query: 1054 NYTYP--IVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
                P  IVALTA    ++    L +G + +L+KP+  + L + + E+
Sbjct: 496  TCKAPVIIVALTASNSQTDKTEALLAGCNDYLTKPVNLDWLTRKITEW 543

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 76/168 (45%), Gaps = 44/168 (26%)

Query: 961  TATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALE--KV 1018
            T TS +  P +        VL+ EDN +NQ ++   L+   I   +LA +G+EA+   K 
Sbjct: 494  TTTSEKVFPKIN-------VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE 545

Query: 1019 ANLTNQYDHYNIVFMDVQMPKMDGLIATRNIR-----------KELNYTYP--------- 1058
              L       +++FMD+Q+P + G+ A + IR           K LN ++          
Sbjct: 546  GGL-------HLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKR 598

Query: 1059 -------IVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
                   IVALTA     + +  L SG + +L+KP+    L K + E+
Sbjct: 599  FSQAPVIIVALTASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEW 646

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 75/160 (46%), Gaps = 36/160 (22%)

Query: 961  TATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALE--KV 1018
            T TS +  P +        VL+ EDN +NQ ++   L+   I   ++A +G+EA++  K 
Sbjct: 535  TTTSEKVFPKIN-------VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE 586

Query: 1019 ANLTNQYDHYNIVFMDVQMPKMDGLIATRNIR-----------------KELNYTYP--I 1059
              L       +++FMD+Q+P + G+ A R IR                 K+     P  I
Sbjct: 587  GGL-------HLIFMDLQLPVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVII 639

Query: 1060 VALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
            VALTA     + +  L SG + +L+KP+    L K + E+
Sbjct: 640  VALTASNSQDDKRNALISGCNDYLTKPVNLHWLSKKITEW 679

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 82/171 (47%), Gaps = 30/171 (17%)

Query: 952  DRPFLQSTGTATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDG 1011
            D PFL+S     +T SI T   +     VLV EDN +NQ ++   L+   I   ++A +G
Sbjct: 394  DSPFLRSAMETFTTESI-TRDKVFPKISVLVVEDNMINQTILSSFLRKHKI-SYKVAKNG 451

Query: 1012 EEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRK--ELN--------------- 1054
             EA+++      +    +++ MD++MP + G+ A + IR+  +LN               
Sbjct: 452  IEAVDRW-----KEGGMHLILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPA 506

Query: 1055 ----YTYP--IVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
                   P  IVALTA    S+    L +G + +L+KP+  + L + + E+
Sbjct: 507  KRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPVNLDWLTRKITEW 557

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 72/140 (51%), Gaps = 26/140 (18%)

Query: 980  VLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPK 1039
            VL+ EDN +NQ +++  L+   I   ++A +G+EA+++      +    +++FMD+Q+P 
Sbjct: 503  VLIVEDNVINQAILRSFLKKHKI-SYKVAKNGQEAVDRW-----KEGGIDLIFMDLQLPV 556

Query: 1040 MDGLIATRNIR--KELNY---TYP---------------IVALTAFADDSNIKVCLESGM 1079
              G+ A + IR  ++LN    T P               IVA TA    ++ +  L SG 
Sbjct: 557  FSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLSGC 616

Query: 1080 DGFLSKPIKREKLRKILLEY 1099
            + +L+KP+    L K + E+
Sbjct: 617  NDYLTKPVNLHWLSKKINEW 636

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 76/168 (45%), Gaps = 44/168 (26%)

Query: 961  TATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALE--KV 1018
            T TS +  P +        VL+ EDN +NQ ++   L+   I   +LA +G+EA+   K 
Sbjct: 483  TTTSEKVFPKIN-------VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE 534

Query: 1019 ANLTNQYDHYNIVFMDVQMPKMDGLIATRNIR-----------KELNYTYP--------- 1058
              L       +++FMD+Q+P + G+ A + IR           K LN ++          
Sbjct: 535  GGL-------HLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKK 587

Query: 1059 -------IVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
                   IVALTA     + +  L SG + +L+KP+    L K + E+
Sbjct: 588  FSQAPVIIVALTASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEW 635

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 75/166 (45%), Gaps = 40/166 (24%)

Query: 961  TATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVAN 1020
            T TS +  P +        VL+ EDN +NQ ++   L+   I   ++A +G+EA++K   
Sbjct: 453  TTTSEKVFPKIN-------VLIVEDNVINQAILGSFLRKNKI-SYKIAKNGKEAVDKW-- 502

Query: 1021 LTNQYDHYNIVFMDVQMPKMDGLIATRNIRK---------------------------EL 1053
               +  + +++FMD+Q+P + G+ A + IR+                             
Sbjct: 503  ---KEGNLHLIFMDLQLPVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGST 559

Query: 1054 NYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
            N    IVALTA     + +  L SG + +L+KP+    L K + E+
Sbjct: 560  NSPVIIVALTASNSQEDKREALISGCNDYLTKPVNLLWLSKKITEW 605

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 74/168 (44%), Gaps = 44/168 (26%)

Query: 961  TATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALE--KV 1018
            T TS +  P +        VL+ EDN +NQ ++   L+   I   +LA +G+EA+   K 
Sbjct: 493  TTTSEKVFPKIN-------VLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE 544

Query: 1019 ANLTNQYDHYNIVFMDVQMPKMDGLIATRNIR--------------KELNYTYP------ 1058
              L       +++FMD+Q+P + G+ A + IR                 +Y +       
Sbjct: 545  GGL-------HLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKR 597

Query: 1059 -------IVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
                   IVALTA     + +  L SG + +L+KP+    L K + E+
Sbjct: 598  FSQAPVIIVALTASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEW 645

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 75/164 (45%), Gaps = 40/164 (24%)

Query: 961  TATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALE--KV 1018
            T TS +  P +        VL+ EDN +NQ ++   L+   I   ++A +G+EA++  K 
Sbjct: 660  TTTSEKVFPKIN-------VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE 711

Query: 1019 ANLTNQYDHYNIVFMDVQMPKMDGLIATRNIR----------KELNYTYP---------- 1058
              L       +++FMD+Q+P + G+ A R IR          +E N              
Sbjct: 712  GGL-------HLIFMDLQLPVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQA 764

Query: 1059 ---IVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
               IVALTA     + +  L SG + +L+KP+    L K + E+
Sbjct: 765  PVIIVALTASNSLDDKRKALLSGCNDYLTKPVNLHWLSKKITEW 808

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 68/151 (45%), Gaps = 34/151 (22%)

Query: 977  NFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQ 1036
            N  VL+ EDN +NQ ++   L+   I    +A +G EA+EK      +    +++FMD+Q
Sbjct: 470  NITVLIVEDNVINQTILASFLRKHKI-SYRIAKNGREAVEKW-----KEGGIHLIFMDLQ 523

Query: 1037 MPKMDGLIATRNIR-----KELNYTYP-----------------------IVALTAFADD 1068
            +P M G+ A + IR     K +    P                       +VA TA    
Sbjct: 524  LPVMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSL 583

Query: 1069 SNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
            ++ +  L SG + +L+KP+    L K + E+
Sbjct: 584  TDKREALVSGCNDYLTKPVNLHWLSKKITEW 614

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 6/72 (8%)

Query: 980  VLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPK 1039
            VL+ EDN +NQ ++   L+  GI   ++A DG EA+EK      +    +++ MD+Q+P 
Sbjct: 396  VLIVEDNAINQAILALFLRKNGI-SYKVAKDGVEAIEKW-----KEGDSHLILMDLQLPL 449

Query: 1040 MDGLIATRNIRK 1051
            + GL AT+ IR+
Sbjct: 450  LSGLEATKKIRE 461

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 69/150 (46%), Gaps = 36/150 (24%)

Query: 980  VLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPK 1039
            VL+ EDN +NQ ++   L+   I   ++A +G EA++K      +    +++FMD+Q+P 
Sbjct: 513  VLIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVDKW-----KEGGLHLIFMDLQLPV 566

Query: 1040 MDGLIATRNIRK---------------------------ELNYTYP---IVALTAFADDS 1069
            + G+ A + IR+                           + N T     IVA TA    +
Sbjct: 567  LSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNSLT 626

Query: 1070 NIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
            + +  L SG + +L+KP+    L K + E+
Sbjct: 627  DKREALISGCNDYLTKPVNLHWLSKKITEW 656

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 69/150 (46%), Gaps = 36/150 (24%)

Query: 980  VLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPK 1039
            +L+ EDN +NQ ++   L+   I+  ++A +G EA++K      +    +++FMD+Q+P 
Sbjct: 567  ILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKW-----KEGGIHLIFMDLQLPV 620

Query: 1040 MDGLIATRNIRK----------------------------ELNYTYP--IVALTAFADDS 1069
            + G  A + IR+                            + +   P  IVA TA    +
Sbjct: 621  LSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASNSLA 680

Query: 1070 NIKVCLESGMDGFLSKPIKREKLRKILLEY 1099
            + +  L +G + +L+KP+    L K + E+
Sbjct: 681  DKRAALIAGCNDYLTKPVNLHWLSKKITEW 710

>ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL033C (RIM15)
          Length = 1569

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 63/125 (50%), Gaps = 12/125 (9%)

Query: 977  NFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQ 1036
            N  VL+ E   +++  + R L+  G   + +   G+E + +  +       ++++   ++
Sbjct: 1437 NMDVLLCEPIPIHRYRLTRDLESLGCSVVAVGT-GDEIVRRATSGVR----FDLIITTLK 1491

Query: 1037 MPKMDGLIATRNIRK--ELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRK 1094
            +PK+  +  TR +R+   +N T PIVA+T    D+   +      D  L +PI  E+LRK
Sbjct: 1492 LPKIGAVDITRLLRQTTSINCTTPIVAVTVNYHDAGTHI-----FDDVLERPIGTEQLRK 1546

Query: 1095 ILLEY 1099
            ++ +Y
Sbjct: 1547 LVSKY 1551

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 72/144 (50%), Gaps = 13/144 (9%)

Query: 971  VGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNI 1030
            +  +  N  VLV E   +++  + R L+  G   + ++  G+E + +  +       +++
Sbjct: 1382 ISDIAYNMDVLVCEPIPIHRFKLTRDLESLGCSVVSVSM-GDEMVRRATSDVK----FDL 1436

Query: 1031 VFMDVQMPKMDGLIATRNIRK--ELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIK 1088
            +F  +++PK+  +   + +R    +N T  I+A+TA+  ++  + C     D  L +P+ 
Sbjct: 1437 IFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QAC---AFDEVLERPVS 1492

Query: 1089 REKLRKILLEYCPVLNKSVSTTTN 1112
             ++LR +LL+Y   L KS  +  N
Sbjct: 1493 VQQLRSLLLKYS--LKKSQESEEN 1514

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 42/71 (59%), Gaps = 6/71 (8%)

Query: 980  VLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPK 1039
            VL+ EDN +NQ ++   L+   I   ++A +G EA++K      +    +++ +D+Q+P 
Sbjct: 464  VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVDKW-----KQGGIHLILLDLQLPI 517

Query: 1040 MDGLIATRNIR 1050
            + G+ AT+ IR
Sbjct: 518  LSGIEATKEIR 528

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 50/96 (52%), Gaps = 12/96 (12%)

Query: 1008 ACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRK--ELNYTYPIVALTAF 1065
            A +GEE + +          ++++   +++PK+  +   + IR    +N T PIVALT +
Sbjct: 1468 AGNGEELVRRATTGVK----FDLIITAMKLPKLGAIDIAKLIRHTNSVNCTTPIVALTVY 1523

Query: 1066 ADDSNIKVCLESGM-DGFLSKPIKREKLRKILLEYC 1100
              D+      ES + D  L KP+  E+LRK++ +Y 
Sbjct: 1524 YHDAK-----ESKVFDDVLEKPVSVEQLRKLVSKYA 1554

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 34/81 (41%), Gaps = 15/81 (18%)

Query: 804 ISIEVEDTGPGIDPSLQESVF-----------KPFVQGDQTLSRQ----YGGTGLGLSIC 848
           + I + D G GIDP +++ VF           K     D  L  Q      G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 849 RQLSTMMKGTMKLHSEVGVGS 869
           +    +  GT+ + S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} similar to
            Ashbya gossypii ACR218W
          Length = 1694

 Score = 36.2 bits (82), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 61/128 (47%), Gaps = 16/128 (12%)

Query: 977  NFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQ 1036
            N  VL+ E   +++  + R L+L G   + +   G+E + +  +       ++++   ++
Sbjct: 1561 NMDVLLCEPIPIHRYRLARDLELLGCSVVAVGT-GDEIVRRATSGV----RFDLIITTLK 1615

Query: 1037 MPKMDGLIATRNIRK--ELNYTYPIVALTAFADD--SNIKVCLESGMDGFLSKPIKREKL 1092
            +PK+  +   R +R    +N   PIVA+     D  SNI        D  L +PI  E+L
Sbjct: 1616 LPKIGAIDIARLLRHTTSINCNTPIVAVAVNYHDVGSNI-------FDDVLERPIGVEQL 1668

Query: 1093 RKILLEYC 1100
            RK++ +Y 
Sbjct: 1669 RKMVSKYA 1676

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 35.8 bits (81), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 60/125 (48%), Gaps = 17/125 (13%)

Query: 978  FKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQM 1037
            F +L+ + + +  E  K +L+   I  +++  D  +  EK+ N       Y++V +D  +
Sbjct: 492  FHILIIDADPMFIERCKTVLEQYRI-TVDIMQDWPKTKEKILNKC-----YDLVIIDAHV 545

Query: 1038 -----PKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKL 1092
                 P ++ ++++      + Y  PI+ +T+  +D  +   L+ G++  L KP    KL
Sbjct: 546  KFLNVPILESMLSS------IQYHPPIILMTSSLNDQQLIFYLQHGINSILEKPFHSHKL 599

Query: 1093 RKILL 1097
             K L+
Sbjct: 600  LKFLV 604

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 36/71 (50%), Gaps = 7/71 (9%)

Query: 452 SVDIARAIG-------IEVPSSHPSERVDAFTTSANWIETRVPVYRRLFSDELSELTDTF 504
           ++D  R+ G       +++    PS     F  +   ++T+V  Y    +++L+E+T+  
Sbjct: 606 TLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEMTEEN 665

Query: 505 NSMTDELDRHY 515
           N+M + LD H+
Sbjct: 666 NNMKEYLDEHF 676

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
           similarities with uniprot|Q04257 Saccharomyces
           cerevisiae YML002W and some similarities with
           uniprot|Q04257 Saccharomyces cerevisiae YML003W
           Hypothetical ORF
          Length = 1067

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 56  VYFTTNYKSLR--ADRLTVAAQLTSAQINQTLNIIYYQCYWLSSRDSIQNAL 105
           +YF    +S+   A+R+ +   LT A+I + +++I  +  WL++RDSI+  +
Sbjct: 194 LYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDSIRQII 245

>TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1602

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 41/76 (53%), Gaps = 10/76 (13%)

Query: 1028 YNIVFMDVQMPKMDGLIATRNIRK--ELNYTYPIVALTAFADDSNIKVCLESG--MDGFL 1083
            ++++   +++PK+  +   R ++    +N T P+VA+T +  ++       SG   D  L
Sbjct: 1513 FDLIITALKLPKLGAVDIVRLLKHTNSINATTPVVAVTNYYQEA------VSGNVFDDVL 1566

Query: 1084 SKPIKREKLRKILLEY 1099
             KP+  ++LRKI  +Y
Sbjct: 1567 EKPVAYDQLRKIAAKY 1582

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 32.3 bits (72), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 41/76 (53%), Gaps = 8/76 (10%)

Query: 1028 YNIVFMDVQMPKMDGLIATRNIRKELN---YTYPIVALTAFADDSNIKVCLESGMDGFLS 1084
            ++++   +++PK+ G I    + K+ N    T PIVA+T +  ++          D  L 
Sbjct: 1680 FDLIMTALKLPKL-GAIDIVQLLKQTNGANSTTPIVAITNYFQEAATSRVF----DDVLE 1734

Query: 1085 KPIKREKLRKILLEYC 1100
            KP+K ++L+K++ +Y 
Sbjct: 1735 KPVKLDELKKLVAKYA 1750

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,667,467
Number of extensions: 4218160
Number of successful extensions: 14251
Number of sequences better than 10.0: 96
Number of HSP's gapped: 14478
Number of HSP's successfully gapped: 130
Length of query: 1125
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1005
Effective length of database: 39,721,479
Effective search space: 39920086395
Effective search space used: 39920086395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)