Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40185.702ON1769176985220.0
AFR286W5.702ON1758177136830.0
SAKL0E14916g5.702ON1779179335680.0
KLLA0A00594g5.702ON1748180329130.0
Kwal_55.196975.702ON1760179526220.0
KLTH0E01056g5.702ON1771171826110.0
ZYRO0G06600g5.702ON1820176024220.0
TDEL0B021905.702ON1810177924180.0
Suva_11.3315.702ON1898172323120.0
YKR095W (MLP1)5.702ON1875176622820.0
Smik_11.3585.702ON1878173022680.0
Skud_11.3345.702ON1885177622650.0
NCAS0A032005.702ON1788175820820.0
CAGL0G02497g5.702ON1780178119410.0
NDAI0E050405.702ON1973175918260.0
Suva_9.395.702ON1682181311321e-127
TBLA0E017305.702ON1820120811071e-123
Skud_9.195.702ON1680179410951e-122
NCAS0G002305.702ON1735177210571e-117
YIL149C (MLP2)5.702ON1679161110021e-110
Smik_9.205.702ON168217959801e-107
KAFR0D022205.702ON167416648841e-95
KNAG0C065905.702ON165115957492e-79
KAFR0H002105.702ON145410036921e-72
KNAG0L021405.702ON160817286473e-67
NDAI0F002905.702ON15546336197e-64
Kpol_1043.705.702ON13214994783e-47
TPHA0E002305.702ON12847853111e-27
TPHA0D046105.702ON11832122644e-22
Kpol_2001.755.702ON10063141453e-08
Suva_6.528.68ON1264244950.029
SAKL0C11374g3.213ON15896840.13
ZYRO0G20262g2.427ON20897830.30
AEL337C7.101ON1097190850.40
AAL085C5.296ON833144840.56
Skud_6.648.68ON1230244811.2
ADL037W4.46ON887140801.8
CAGL0D00638g4.268ON693383792.1
KAFR0E004401.490ON467118782.2
Ecym_53454.238ON1366421782.6
Smik_6.718.68ON1228133783.1
TBLA0A054301.81ON79566773.2
KLTH0D09504g8.604ON718226755.4
Smik_6.848.94ON839108765.4
ZYRO0G04312g1.371ON533137756.0
SAKL0H21208g4.86ON411113746.9
SAKL0C10450g3.130ON800160747.3
TDEL0D016201.295ON1223276747.9
YFL008W (SMC1)8.68ON122569748.1
TDEL0C009608.68ON1222141748.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4018
         (1769 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...  3287   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...  1423   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...  1379   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...  1126   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...  1014   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...  1010   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   937   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   936   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   895   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   883   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   878   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   877   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   806   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   752   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   707   0.0  
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   440   e-127
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   431   e-123
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   426   e-122
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   411   e-117
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   390   e-110
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   382   e-107
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   345   1e-95
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   293   2e-79
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   271   1e-72
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   253   3e-67
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   243   7e-64
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   188   3e-47
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   124   1e-27
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...   106   4e-22
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    60   3e-08
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...    41   0.029
SAKL0C11374g Chr3 complement(1025308..1025784) [477 bp, 158 aa] ...    37   0.13 
ZYRO0G20262g Chr7 complement(1674553..1675179) [627 bp, 208 aa] ...    37   0.30 
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    37   0.40 
AAL085C Chr1 complement(192432..193783,193783..194932) [2502 bp,...    37   0.56 
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...    36   1.2  
ADL037W Chr4 (628992..631655) [2664 bp, 887 aa] {ON} Syntenic ho...    35   1.8  
CAGL0D00638g Chr4 complement(80947..83028) [2082 bp, 693 aa] {ON...    35   2.1  
KAFR0E00440 Chr5 complement(97048..98451) [1404 bp, 467 aa] {ON}...    35   2.2  
Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON...    35   2.6  
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...    35   3.1  
TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa] ...    34   3.2  
KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly...    33   5.4  
Smik_6.84 Chr6 (157421..159940) [2520 bp, 839 aa] {ON} YFR002W (...    34   5.4  
ZYRO0G04312g Chr7 (344316..345917) [1602 bp, 533 aa] {ON} weakly...    33   6.0  
SAKL0H21208g Chr8 (1848202..1849437) [1236 bp, 411 aa] {ON} simi...    33   6.9  
SAKL0C10450g Chr3 (950474..952876) [2403 bp, 800 aa] {ON} simila...    33   7.3  
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    33   7.9  
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...    33   8.1  
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....    33   8.4  

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score = 3287 bits (8522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1679/1769 (94%), Positives = 1679/1769 (94%)

Query: 1    MSQRGASDSSISVDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSIS 60
            MSQRGASDSSISVDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSIS
Sbjct: 1    MSQRGASDSSISVDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSIS 60

Query: 61   IDGLKCNFEQKINTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQ 120
            IDGLKCNFEQKINTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQ
Sbjct: 61   IDGLKCNFEQKINTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQ 120

Query: 121  VEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGY 180
            VEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGY
Sbjct: 121  VEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGY 180

Query: 181  KSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSL 240
            KSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSL
Sbjct: 181  KSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSL 240

Query: 241  KSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLL 300
            KSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLL
Sbjct: 241  KSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLL 300

Query: 301  ESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELL 360
            ESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELL
Sbjct: 301  ESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELL 360

Query: 361  SVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVV 420
            SVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVV
Sbjct: 361  SVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVV 420

Query: 421  ELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCS 480
            ELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCS
Sbjct: 421  ELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCS 480

Query: 481  LIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERL 540
            LIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERL
Sbjct: 481  LIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERL 540

Query: 541  VQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHV 600
            VQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHV
Sbjct: 541  VQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHV 600

Query: 601  QRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQD 660
            QRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQD
Sbjct: 601  QRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQD 660

Query: 661  NIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDD 720
            NIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDD
Sbjct: 661  NIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDD 720

Query: 721  LQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKE 780
            LQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKE
Sbjct: 721  LQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKE 780

Query: 781  NTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVS 840
            NTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVS
Sbjct: 781  NTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVS 840

Query: 841  DTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVL 900
            DTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVL
Sbjct: 841  DTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVL 900

Query: 901  ANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYR 960
            ANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYR
Sbjct: 901  ANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYR 960

Query: 961  KNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLD 1020
            KNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLD
Sbjct: 961  KNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLD 1020

Query: 1021 ELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEME 1080
            ELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEME
Sbjct: 1021 ELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEME 1080

Query: 1081 GFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXX 1140
            GFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELL     
Sbjct: 1081 GFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATS 1140

Query: 1141 XXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFS 1200
                           LIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFS
Sbjct: 1141 SDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFS 1200

Query: 1201 KTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXX 1260
            KTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIA     
Sbjct: 1201 KTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQ 1260

Query: 1261 XXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTX 1320
                       TITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVT 
Sbjct: 1261 LQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTE 1320

Query: 1321 XXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQ 1380
                           QERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQ
Sbjct: 1321 LKNELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQ 1380

Query: 1381 TLDKVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKN 1440
            TLDKV               GEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKN
Sbjct: 1381 TLDKVSELESKLSSSANEKNGEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKN 1440

Query: 1441 QIQELTEKIKTLESEIEHSELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEELRM 1500
            QIQELTEKIKTLESEIEHSELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEELRM
Sbjct: 1441 QIQELTEKIKTLESEIEHSELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEELRM 1500

Query: 1501 KXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSKLEAEYEKKTLERIREAEE 1560
            K                       VESTPNAPLIDEETLKSKLEAEYEKKTLERIREAEE
Sbjct: 1501 KLEEIQKQYEEERERELSELKASLVESTPNAPLIDEETLKSKLEAEYEKKTLERIREAEE 1560

Query: 1561 ALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLIKEHQ 1620
            ALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLIKEHQ
Sbjct: 1561 ALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLIKEHQ 1620

Query: 1621 EEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSKI 1680
            EEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSKI
Sbjct: 1621 EEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSKI 1680

Query: 1681 PIDNNNNSSPQGAQPIAIKPSPFQVAFGKAMENTSFGSFKGSLLDSKQFIANTADTSTST 1740
            PIDNNNNSSPQGAQPIAIKPSPFQVAFGKAMENTSFGSFKGSLLDSKQFIANTADTSTST
Sbjct: 1681 PIDNNNNSSPQGAQPIAIKPSPFQVAFGKAMENTSFGSFKGSLLDSKQFIANTADTSTST 1740

Query: 1741 LTGNVGTNTNKRQSEDELAQSPEKRPKDD 1769
            LTGNVGTNTNKRQSEDELAQSPEKRPKDD
Sbjct: 1741 LTGNVGTNTNKRQSEDELAQSPEKRPKDD 1769

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score = 1423 bits (3683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 828/1771 (46%), Positives = 1192/1771 (67%), Gaps = 42/1771 (2%)

Query: 13   VDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKI 72
            VDYS++AA L +++ +VQ+L E +V   + +   F +++A+N RL +SI   +   E  +
Sbjct: 16   VDYSRLAARLGLEQGQVQQLGEQLVRTLWGREQAFRQLEAENTRLKVSIGAAESACEHGV 75

Query: 73   NTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIA 132
               +E+ ++L ++  ++Q+ + +           +A       +++ Q+EE ++ +    
Sbjct: 76   EALRERQQQLAAEAGAQQRGQGEAGSAG------RAGGPSVPERVQQQLEETERRVAAGD 129

Query: 133  SAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQ 192
            SA++D+ +LLEEKISDL AS++E +R+L  NKELR+  ++LEF +Q  +SQ LRE++EIQ
Sbjct: 130  SARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQ 189

Query: 193  RLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNS 252
            RL QEL LV+SNA+W + +L  KN+QLNS+REKTN E+Q+   ++N +K++LE   AN +
Sbjct: 190  RLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVA 249

Query: 253  TLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLE 312
             L++K  ELS QLQ+ L ETK+L D L++EK+EF REM+LKQRLI+LL  QV++MK DLE
Sbjct: 250  ALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLE 309

Query: 313  NAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVN-----GKNG 367
             AY  A   GMS  E+++LL++L DTKK LE +QA   +LE T+ ELL  +     G+NG
Sbjct: 310  KAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNG 369

Query: 368  VAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIP 427
            +   ++NV   S  S ISTV    GD+  L+KQLVQERR KEELQ QVESFVVELEHKIP
Sbjct: 370  IE--HANVGSPSGGSTISTV---YGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIP 424

Query: 428  ILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSD 487
            +LNSFK+R + LE++LN VTLLLE+TA++RD+K +++ QYKNK+ +YE+QV  L+ QRSD
Sbjct: 425  VLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSD 484

Query: 488  LAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVI 547
            LA QVQ LL+ +SVRDD+ GPLT +EVEFVK++ S  D A  SDTQ IIS RLV+FKSV+
Sbjct: 485  LARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVV 544

Query: 548  ELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQL 607
            ELQ KNAELLN IRQLA KLE EE K++ ++KS+E  TV EAKEAILSLQEHVQ LEDQL
Sbjct: 545  ELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQL 604

Query: 608  KIVSKERDAFKLANSANKQGDSAP----SSTYQSKKLDEHIMELEKRLKNLAEQSQDNIK 663
            + V+ ERD+FKL  S  K  +S P    ++  Q +++ + I  LE RLK +AE+S+ + K
Sbjct: 605  ETVTTERDSFKLLVSEGK-NNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAK 663

Query: 664  LLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQR 723
            +LN+EIKALYK+ S++ + LE+ERSS+ LA+E+L LIQ +L L K EN +L  R+  LQ 
Sbjct: 664  MLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQA 723

Query: 724  VLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTT 783
            +LL+QD + QSTI+E ++ KS+L +++S+L IL SERDFLRK+EA+LK ENE+L K+N  
Sbjct: 724  LLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNND 783

Query: 784  SKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTS 843
            S++L+ QL+T Q+ERD L+EE +  Y   IE+L+ +L  T++ L R+ REY+E   S ++
Sbjct: 784  SQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSST 843

Query: 844  QYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANA 903
            Q KWFQ+K+DSL E+L +++  L+ KT+ ++ L+    S T+KLE A +  Q  S++  +
Sbjct: 844  QCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLES 903

Query: 904  DDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNI 963
            D  + ++++L K+L++AN  L+ AYS+IE+YK+ +  +E+ ++  + A+++++   ++  
Sbjct: 904  DHAS-RVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYN-AVQDNKDGSKQAA 961

Query: 964  ALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELK 1023
              LE E   L   IA+ ND+IK L  EL+ +++   +E+SEL +K++ L   ++ ++E K
Sbjct: 962  ISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAK 1021

Query: 1024 SEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFK 1083
            ++Y++KI++LQ DL +Q S  N+A+  Y+  LQK A++++ I  LR+ S+ YKSE+  FK
Sbjct: 1022 ADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFK 1081

Query: 1084 RSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXXXX 1143
             +A EA+  LERNEQ+W QQ AD+E+ L LA QR EEL+TQNRLLYDQ+ELL        
Sbjct: 1082 SAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSSL 1141

Query: 1144 XXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQ 1203
                        LI+TLRRERDILETK+DVS REEK+LRQRL L K+EL+N+R + S+++
Sbjct: 1142 EPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESK 1201

Query: 1204 ATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXXXXX 1263
                +   + ++QE++ EKLNQLNLLRE N++LRNES+K  E ++  QNEI         
Sbjct: 1202 GLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQP 1261

Query: 1264 XXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTXXXX 1323
                    T T++E++Q+++LLKEES RWKQRSQDILHKYERIDP E++KLA E+     
Sbjct: 1262 MEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKA 1321

Query: 1324 XXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLD 1383
                        QERFRKLRKQANERLDEFKAAKAKVESE E     K+QLEA+L++  +
Sbjct: 1322 ELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEARE 1381

Query: 1384 KVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKNQIQ 1443
            K+                + + +  ELEE +    +A   +  +K+E + SE+  K Q+ 
Sbjct: 1382 KITSLETQLTERPASE--DDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLD 1439

Query: 1444 ELTEKIKTLESEIEHSELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEELRMKXX 1503
            EL ++++T++     S   +  S+       ++E+ KK+ EEE++ LI+   +EL  +  
Sbjct: 1440 ELNKQLETIQKNSAPSSGHSDPSSYHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLE 1499

Query: 1504 XXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSKLEAEYEKKTLERIREAEEALK 1563
                                    +  A   + E LK K E EYE++TL+RIREAEEALK
Sbjct: 1500 ASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALK 1559

Query: 1564 KRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLIKEHQEEM 1623
            KRIRLPSEERINQVIER+Q+AL+QEF  +V A AL L KENP+S   D A LIK+HQ+E+
Sbjct: 1560 KRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEI 1619

Query: 1624 DKLEA----KFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSK 1679
             +L+     KF+ QL  V+KKAFEEG+QQ +MKVKLLESKI+KLE Q  K  L  +VP+K
Sbjct: 1620 VQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQA-KAPLGTNVPTK 1678

Query: 1680 IPIDNNNNSSPQGAQPIAIKPSPFQVAFGKA-MENTSFGSFKGSLLDSKQFIANTADTST 1738
            IP++   N+ P  AQ + +KPSPFQ+A+ +A   N  F   K S    ++ + +  D+ +
Sbjct: 1679 IPLE---NTQPL-AQQVPVKPSPFQLAYAQATFGNVPFLFNKNS---EQKKVEHQDDSDS 1731

Query: 1739 STLTGNVGTNTNKRQSEDELAQSPEKRPKDD 1769
               TG    N NKRQSED   +SP K+ +++
Sbjct: 1732 HQNTG----NGNKRQSEDRAEESPGKKLREE 1758

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score = 1379 bits (3568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 827/1793 (46%), Positives = 1187/1793 (66%), Gaps = 67/1793 (3%)

Query: 13   VDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKI 72
            +D + +++FLE+D +KV  LD ++V    +KAN+F ++KA N++ S+++D LK + E++ 
Sbjct: 16   IDVTTISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRS 75

Query: 73   NTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIA 132
              FK Q+EK+  +  S ++EK   EDEK KL++EKA  S EV  L+SQ+ E KQ  EI  
Sbjct: 76   EAFKLQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQLTELKQQNEIFR 135

Query: 133  SAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQ 192
            S+KQDV +LL EKI DL AS++E+ +LL   K LRK  ++LE  +Q +KS +LR K+E+Q
Sbjct: 136  SSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQ 195

Query: 193  RLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNS 252
            RL QE+NL+KSN  WL KEL SK+E+  S+R++ NSELQ    ++NS++S+LE  R+++ 
Sbjct: 196  RLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIERSSSQ 255

Query: 253  TLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLE 312
            TLK++  +LS QLQ+K+ E K L D  + EK+EFTREM+LKQRLIDLLE Q+ S K++LE
Sbjct: 256  TLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELE 315

Query: 313  NAY-QSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVI 371
            +A  +S + +     E++++++ELI+TKK LE ++++ +KLE TV+ELLS +G+ G    
Sbjct: 316  SARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETVDELLSTDGERGAG-- 373

Query: 372  NSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNS 431
              N S  SLDSK S VPKL GDIG+LKK+L+QERRQKE+LQ QVE+FV+ELEHK+P+LNS
Sbjct: 374  --NTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNS 431

Query: 432  FKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQ 491
            FKERT+MLE+EL+DV L+LE+T+K +++K  EL   K+KI +YE+Q+ SL+ QRSDLAHQ
Sbjct: 432  FKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQ 491

Query: 492  VQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQS 551
            VQ+LL+Q+SVR+D++GPLT +E  F+K+II+S +   + D Q IISERLV+F+S++ELQ 
Sbjct: 492  VQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQE 551

Query: 552  KNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVS 611
            KN ELLN+IR LADKLE EEK+S+ + K VE++TVKEAKEAIL+LQE+ + LE QL+I++
Sbjct: 552  KNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLESQLEIIA 611

Query: 612  KERDAFKLANSANKQGDSAPSSTYQSKK-----LDEHIMELEKRLKNLAEQSQDNIKLLN 666
            KERDAFK+  +++K   + PS+   S+       +E I ELE  L +L E+S  NIKLLN
Sbjct: 612  KERDAFKIL-ASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLN 670

Query: 667  DEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLL 726
            +EI +LY+A+++ +V LE+ERSS++LAE+R KLI +TL +TK EN EL KR   LQ  +L
Sbjct: 671  EEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENIL 730

Query: 727  KQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKI 786
            KQD KTQ TI+ +I+ KSQLS L S+L    SERD LR I+  LK ENE+L++E    +I
Sbjct: 731  KQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLSEERNNMRI 790

Query: 787  LVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQYK 846
            L++QLQTLQ ER+ LLEE Q N++    KLE++L +T E L  +++E  +   +  SQ K
Sbjct: 791  LITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEK 850

Query: 847  WFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDI 906
            W+Q K D LNE+L+N+R+ L  K   I+ L+L  +SL  KLEE+E R Q+++ L  ++ +
Sbjct: 851  WYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESV 910

Query: 907  TDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALL 966
              + ETLR+ LEK  I LADAYSQ+EQYKSMA  SE+SA  I  ALE+S+A Y + I  L
Sbjct: 911  ESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETL 970

Query: 967  EQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEY 1026
             +ER    DQ+ +L DQI +LN+EL+HQKSQ +S+ S+  + L  L+  Q  LD +K+EY
Sbjct: 971  TKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAEY 1030

Query: 1027 EEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSA 1086
            E+KISK+QEDL QQ SYAN AQKNYEQELQKHADV+K ISLLR E+QKYKSE E  + +A
Sbjct: 1031 EQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNAA 1090

Query: 1087 SEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXXXXXXX 1146
              AK ALE++E SW +Q +D E +L LA QR E+LN Q+++LYDQ++ L           
Sbjct: 1091 ENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGKPTSSEDL 1150

Query: 1147 XXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQATA 1206
                     L+ +LRRE+DILETKL+VS REEK+LRQ+L L +++LE  R+E SK Q  A
Sbjct: 1151 MPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQRAA 1210

Query: 1207 PDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXXXXXXXX 1266
              +    + QE+IM +LNQLNLLRESN+TLRNE++K  E+S+  + E+            
Sbjct: 1211 SGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLES 1270

Query: 1267 XXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTXXXXXXX 1326
                   ++ E+D QISL  EE+ RWKQRSQDILHKYERIDP EHQKLAD+V+       
Sbjct: 1271 KVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIK 1330

Query: 1327 XXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVX 1386
                       RF++L++QA+E+L+  K A++ + S+   +   K +LE +L    ++V 
Sbjct: 1331 SKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVK 1390

Query: 1387 XXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKNQIQELT 1446
                           E + L+E+LE  +A  +E    +  + + +A  EK+L  +I+ L 
Sbjct: 1391 NLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLM 1450

Query: 1447 EKIKTLESEIEHSELEAKNSNDSP-----DFAPIVENMKKKFEEEKQVLIQEKDEELRMK 1501
             KIK LE ++E ++ E+ N          + + IVEN+K +FEEEK  +I +K+ ELR  
Sbjct: 1451 NKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESELR-- 1508

Query: 1502 XXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSKLEAEYEKKTLERIREAEEA 1561
                                   + +    P ++ + +K K E EYE+KT +RIRE+ E 
Sbjct: 1509 --EQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRESNEQ 1566

Query: 1562 LKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLIKEHQE 1621
            LKKRIRLP+EE+IN+++E+++  L+ EFE  V+ +A E+ K    S    T +++++H++
Sbjct: 1567 LKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNST-EVLEKHKQ 1625

Query: 1622 EMDKL----EAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVP 1677
            +++ L    + KFDE +A ++K+AFEEGKQQ  MK   LE KIAKLE Q   I  ++S  
Sbjct: 1626 DLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQ---IKAHDSA- 1681

Query: 1678 SKIPIDNNNNSSPQGAQP------------------IAIKPSPF---QVAFGKAMENTSF 1716
              IPI++N++++P  + P                  +  KP PF     AFG     T+ 
Sbjct: 1682 --IPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAHFAFGMPFGQTTS 1739

Query: 1717 GSFKGSLLDSKQFIANTADTSTSTLTGNVGTNTNKRQSEDELAQSPEKRPKDD 1769
             SF+        F +   + +          N+ KR SE+ +  SPEK+PK++
Sbjct: 1740 NSFQNP------FNSQPPEQT---------PNSPKRPSEEPVGGSPEKKPKEN 1777

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score = 1126 bits (2913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/1803 (39%), Positives = 1122/1803 (62%), Gaps = 123/1803 (6%)

Query: 16   SKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTF 75
            S+VA FL+VD+  +Q+++  ++     K  +  K K++N+R++ ++D LK   E K+ +F
Sbjct: 8    SRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESF 67

Query: 76   KEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAK 135
            K  + +L   +   + E+   E+EK +L+   +Q++  +++L  ++E  +Q  E+  ++K
Sbjct: 68   KIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQVTKRIIELEQEIEVERQQKELADASK 127

Query: 136  QDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLH 195
            QD+ + L EKI +L+++K + +    ANKELR+  ++ E  +Q  ++ ELR KSEI R+ 
Sbjct: 128  QDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSEILRME 187

Query: 196  QELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLK 255
            QE+ L++ N DWL+ +L +K  QLN FRE T SELQ+   +V++++S+LE AR +N  LK
Sbjct: 188  QEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTSNQKLK 247

Query: 256  AKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLENAY 315
                 L  QL++KL E K++ D  N  K+E T+EMSLKQR+ID LE  + S+K +++   
Sbjct: 248  QSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKEMDATK 307

Query: 316  QSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSNV 375
             + + +  +  E+D+L++EL   K  L+A+++  IKL+ T++EL S      + + +S V
Sbjct: 308  NNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTS-----NIKLEDSEV 362

Query: 376  SDTSLDSK--ISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSFK 433
             +T+  S+  +S +PKL GD+G+LKKQLV E+RQK+EL+ QVE+FVVELEHKIP+LNSFK
Sbjct: 363  GNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVLNSFK 422

Query: 434  ERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQ 493
            ER++MLERELN+VT+LLEST K RDQK+ +L+  K  + +YE+Q+ SL  QR DLAHQ+Q
Sbjct: 423  ERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVDLAHQIQ 482

Query: 494  YLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQSKN 553
            YLL+  S++ +  GPL+ +E++FVK + +S++    SDTQGII++RLV+F+SV+ELQ KN
Sbjct: 483  YLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVVELQQKN 542

Query: 554  AELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKE 613
            +ELL+TIR LAD+LE  E +++ +++ +E +TV+EAKE IL+L +H Q LE+QL I+SKE
Sbjct: 543  SELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQLVILSKE 602

Query: 614  RDAFKLANSANKQGDSAPSS-TYQSKKLDEHIMELEKRLKNLAEQSQDNIKLLNDEIKAL 672
            RDA+K  +     G + P + TY S   D+ + +LE RL  + +++++N K  + E   L
Sbjct: 603  RDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSENSNL 662

Query: 673  YKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKT 732
             K   E+++  E E++S+ LAE+RL L+QSTL L+K +  EL KRS DLQ +L KQD++T
Sbjct: 663  RKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQDKRT 722

Query: 733  QSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKILVSQLQ 792
            Q T+D +I TKS LS++ S+L+IL SE+ F+ K++ ELK ENE  +KE+   K+L++QLQ
Sbjct: 723  QETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIAQLQ 782

Query: 793  TLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTS----QYKWF 848
            TLQRER++LL+E Q +Y++ + KLE +L  + E    R  E E+      S    QY WF
Sbjct: 783  TLQREREMLLKETQNSYKEKLRKLEIELSGSLE----RLEEIEKNTTGIASNKEHQYNWF 838

Query: 849  QAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITD 908
            Q K+D L  +    + TL+EK   ++ +Q      +AKL+EAE R QSY++L+N DD  +
Sbjct: 839  QEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQN 898

Query: 909  KIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQ 968
             +ETLR+ LEK N+ L+D+YSQIE +K++A+ S QS  E+S+A EE+Q   +K I  LE 
Sbjct: 899  LVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLEN 958

Query: 969  ERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEE 1028
            ER  L   + +LNDQ+KDLN+E+ HQKS+ Q+E++  ++++S LQ  + S+D  K++YEE
Sbjct: 959  ERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEE 1018

Query: 1029 KISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASE 1088
            KI+ +Q+DL  Q  YAN++Q++YE ELQKHADV+KTI+ LR E+Q YKS++E  K  +  
Sbjct: 1019 KIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQL 1078

Query: 1089 AKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXXXXXXXXX 1148
            A   L+ +E+ W +Q  + E +LS+ +QR +EL+TQN+LLYDQ+ELL             
Sbjct: 1079 AMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELL------NKTEDRD 1132

Query: 1149 XXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQATAPD 1208
                   L+++LRRERD+LETKL+V++ E+ +L+QRL +AK+E+E++  + S+ + ++ +
Sbjct: 1133 NSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSE 1192

Query: 1209 SIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXXXXXXXXXX 1268
            S    E QE IM++L+QL+LLRESNVTLR+E+  + ++  + ++++              
Sbjct: 1193 SAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSI 1252

Query: 1269 XXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTXXXXXXXXX 1328
                  I  ++Q++   KEE+ RWK RSQDILHKYERIDP EH KL +E+          
Sbjct: 1253 SSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTT 1312

Query: 1329 XXXXXXX-------QERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQT 1381
                          + +F+++R QA +RL+  K  +  + SE   ++ AK+Q+EA+L + 
Sbjct: 1313 KDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKC 1372

Query: 1382 L-------DKVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEAVADIKAEAASS 1434
                    +++                +   L+E+L  ++     A+      K E  ++
Sbjct: 1373 KTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENAS------KTEQNNA 1426

Query: 1435 EKDLKNQIQELTEKIKTLESEIEHSELEAKNS------NDSP----DFAPIVENMKKKFE 1484
            + D K  I+ LTE ++ L S+I+  E EA N+      + +P    D   IV+N+K +FE
Sbjct: 1427 DSDEK--IKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFE 1484

Query: 1485 EEKQVLIQEKDEELRMKXXXXXXXXXXXXXXX------------XXXXXXXXVESTPNAP 1532
             EK+ LI++K++ELR K                                   V+S P+ P
Sbjct: 1485 AEKEQLIKDKEKELRSKFEAEKESAWNSREEELRKQFEEREKRIREECEKTTVQS-PSQP 1543

Query: 1533 L--IDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFE 1590
               ID + LK++ E EYEK+TLE+I+ AEEALKKRIRLP++++I++++E R+  L++ FE
Sbjct: 1544 TLDIDIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFE 1603

Query: 1591 LRVRARALELFKENPESFVGDTAKLIKEHQEEM----DKLEAKFDEQLALVRKKAFEEGK 1646
             +V  +A +L  E     +G+ A  +++H+ E+    D +  +F+  LA +++K+FEEGK
Sbjct: 1604 EKVNEKAQKLAGE-----IGNDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGK 1658

Query: 1647 QQLVMKVKLLESKIAKLEGQPNKINLNNSVPSKIPIDNN-NNSSPQGAQPIAIKPSPFQV 1705
            QQ+ +K+K LESKI  LE Q + I          P++N+ +N S     P+         
Sbjct: 1659 QQVSLKLKFLESKIRNLEQQKSTIK---------PVENDTSNMSAAFQAPV--------- 1700

Query: 1706 AFGKAMENTSFGSFKGSLLDSKQFIANTADTSTSTLTGNVGTNTNKRQSEDELAQSPEKR 1765
             FG      S  +F             T+  STS ++       NKR  +D   + PEKR
Sbjct: 1701 -FG------SHSTF-------------TSPFSTSEISP------NKRPIDDTATEQPEKR 1734

Query: 1766 PKD 1768
             K+
Sbjct: 1735 HKE 1737

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score = 1014 bits (2622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/1795 (37%), Positives = 1071/1795 (59%), Gaps = 102/1795 (5%)

Query: 18   VAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFKE 77
            VA+FLE+D   +  +  ++      K  EF +++A+N++ S++ID L+ +   K+   K+
Sbjct: 21   VASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACKD 80

Query: 78   QVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAKQD 137
            Q+  LL ++ + + E  Q E  + +   E+ +   +   LR++ E  +Q  +++ + K D
Sbjct: 81   QIHSLLQEIEAVRAENLQLEQRRAQCDAERQRSINDSDTLRARNEALEQQKQVLEANKND 140

Query: 138  VTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLHQE 197
            V +LL EKI D+A  ++E++RLL   + LR+ +++LE   + YKS+EL+ K++  +L Q+
Sbjct: 141  VAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQLSQK 200

Query: 198  LNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAK 257
            ++L+ +N +WL  +L  KN + N++R++T SEL +  +++ + +  L+ A     TL+ +
Sbjct: 201  VSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLREQ 260

Query: 258  TAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLE--NAY 315
              +  ++L+ +    KKL D L + K+EFTREMSLKQRL++LLE QVS++KS+LE  N+ 
Sbjct: 261  NGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFKNSP 320

Query: 316  QSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSNV 375
            Q A+ +  +T  + Q+ DEL+   + LE ++ +  KLE TV +LLS + K          
Sbjct: 321  Q-ASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKTI-------- 371

Query: 376  SDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSFKER 435
                  S   ++P L  DIGILKKQ++ ERRQKE LQNQVE+FVVELE+K+P+L+SFK+R
Sbjct: 372  ------SGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDR 425

Query: 436  TDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYL 495
             D+LE+EL +   +L+S +K +D+   +L + K++I + ESQ+ +L  QRSDLA QVQYL
Sbjct: 426  NDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYL 485

Query: 496  LMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQSKNAE 555
            L+Q++VR D+HGPL+ +E  FVK++++ E+  P  D QGIISERLV+FK+++ELQ+KNA+
Sbjct: 486  LIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNAD 545

Query: 556  LLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKERD 615
            LL+T+R LA++LE EE+K + + +++E  T+ EAKEAI++LQ+H+Q LE ++ ++++ERD
Sbjct: 546  LLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERD 605

Query: 616  AFKLANSANKQ----GDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIKLLNDEIKA 671
            A+K   S        G     +   S+  D  I ELE+ L     +++ N+KLL  E + 
Sbjct: 606  AYKAIQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQE 665

Query: 672  LYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEK 731
            L ++KSE+ V +E+E+SS++LAEERLK+ +S+L LTK+EN EL+KR   L+  L KQD +
Sbjct: 666  LARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLAKQDTR 725

Query: 732  TQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKILVSQL 791
            TQ TI E+I  KSQL+ L+++L    ++ + L     +LK  NE LTKE     ILV+QL
Sbjct: 726  TQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNELTILVTQL 785

Query: 792  QTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQYKWFQAK 851
            QTLQ+ERD LL+++  N++  I+ LE+++ + R  L ++  E  +   +  S+ +W+Q K
Sbjct: 786  QTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEK 845

Query: 852  VDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITDKIE 911
            +D+LNE L +    L  KT  I+ LQ     LT+KL +AE ++QSYSVL   DD+  + +
Sbjct: 846  IDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQTD 905

Query: 912  TLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQERK 971
             LR  LEK  INL DA+SQ+++YK +   ++++   ++ ALE S+ ++   +  L++ER 
Sbjct: 906  ALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERD 965

Query: 972  SLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEEKIS 1031
            +L++  A+L DQ+ +LNSELD+QK+  ++ K E  K    ++ ++ +L  +K +Y+ ++S
Sbjct: 966  ALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELS 1025

Query: 1032 KLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASEAKS 1091
            KL EDL QQA YAN+AQ+NYEQELQ+HADV+KTIS LREE+QK+K+++   + S +E K 
Sbjct: 1026 KLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKK 1085

Query: 1092 ALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXXXXXXXXXXXX 1151
            +LE NE  W  Q  + E+Q SL+ QR E+L+TQNRLL+DQ+ L                 
Sbjct: 1086 SLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISL---KDTDSIPINDELKS 1142

Query: 1152 XXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQATAPDSIF 1211
                LI TL+RE DIL+TKL+++ R+E  L+Q+L   + EL   + E  K+Q T+     
Sbjct: 1143 EARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSI 1202

Query: 1212 ARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXXXXXXXXXXXXX 1271
              E   +I+E+LNQ+NLLRESN+TLRNE ++  +++Q  +  +                 
Sbjct: 1203 MIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTL 1262

Query: 1272 TITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTXXXXXXXXXXXX 1331
              ++  +D+QISL+ EE +RWKQRSQDIL KYER+DP EH+KLA+E++            
Sbjct: 1263 QRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQQ 1322

Query: 1332 XXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVXXXXXX 1391
                ++RF++L+KQA ERLD  +  +  + +E      ++  LE  L +  +K       
Sbjct: 1323 RSELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQES 1382

Query: 1392 XXXXXXXXXGEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKNQIQELTEKIKT 1451
                       + + +++L++      +A   + ++    +  E+ L+ +++   + +K 
Sbjct: 1383 IKATEENEIENSSATRDQLQDALQKLEDAQARINEMSTAPSQEEQTLREELERTRQHVKQ 1442

Query: 1452 LESEIEHSE------LEAKN--SNDSPDFAPI---VENMKKKFEEEKQVLIQEKDEELRM 1500
            LE  +  ++       EAKN  S    + A +   + +   K   EK+  I+EK E+ R+
Sbjct: 1443 LEEHLAKTQNEVRVLEEAKNQVSGTEAEIARVKTELIDHSNKLLAEKEAEIKEKYEKQRL 1502

Query: 1501 KXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSKLEAEYEKKTLERIREAEE 1560
            +                       + S+ +    D E LK + E EYE++T++RI EA E
Sbjct: 1503 E---------------DKAELEKSLASSESLKSSDIENLKKEWEEEYEQRTIKRIEEANE 1547

Query: 1561 ALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLIKEHQ 1620
             L+KRIRLP+EE+IN++IE R+R LD+EFE +++ R  EL  E P        +++K H+
Sbjct: 1548 ILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKP--LPATFTEVMKRHK 1605

Query: 1621 EEMDKLEA----KFDEQLALVRKKAFEEGKQQLVMKVKLLESKI-------AKLEGQPNK 1669
            +E++KL+A    + DE++A  +KKAF+EGKQQ  MK   LE KI            +P+ 
Sbjct: 1606 QEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLEKKIAKLEAQAKAAAEKPDD 1665

Query: 1670 INLNNS------VPSKIP-IDNNNNSS------PQGAQPIAIKPSPFQVAFGKAMENTSF 1716
              +N+        PS I  I +  + +       +G +PI   P P              
Sbjct: 1666 TTVNSPDRKQLDKPSPIAEISHQEDKTHIAEELAEGPRPITTSPIP-------------- 1711

Query: 1717 GSFKGSLLDSKQF-IANTADTSTSTLTGNVGTNTNKRQSEDELAQSPE-KRPKDD 1769
             S  G L+D+     +N A+ S ST          KR SE  L +SP+ K+ K D
Sbjct: 1712 PSSSGELIDNSSVEPSNDANDSVST----------KRPSEVSLEESPDSKKHKSD 1756

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score = 1010 bits (2611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/1718 (39%), Positives = 1050/1718 (61%), Gaps = 72/1718 (4%)

Query: 21   FLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFKEQVE 80
            FL ++  ++  +D  +V     KA EF +++A+N+R S+++D L+ + E+K+   K+QV 
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 81   KLLSDVASRQQEKQQTEDEKLKLMNEKAQL--SMEVLKLRSQ-VEEAKQGMEIIASAKQD 137
             LL ++ S + E  Q E  KL+L +EK +     E L++R + +E+ KQ +E   S+K D
Sbjct: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALE---SSKND 138

Query: 138  VTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLHQE 197
            V +LL EKIS+L++ K+E+D L+  N+ LR+ ++DLE   +  KS++L+ K+E+ RL QE
Sbjct: 139  VARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQE 198

Query: 198  LNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAK 257
            L+L +SN++WL  +L  KN + N++R  T S+L    +++ +L+ +L+ +   N +L+  
Sbjct: 199  LSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLREH 258

Query: 258  TAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLE--NAY 315
             A ++N L+ +L   KKL D LN+EK+EFTREMSLK+RL+DLLE QV S+KSDLE  +  
Sbjct: 259  NARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTA 318

Query: 316  QSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSNV 375
               +    S P  + L +EL    + LE ++ +  KLE TV +L+S + ++ +       
Sbjct: 319  GEGDDGSFSNP-LNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRLK------ 371

Query: 376  SDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSFKER 435
              +S     ++V  L GDI +LK+Q++ E+RQKE LQNQVE+FVVELE K+P+L+SFK+R
Sbjct: 372  --SSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDR 429

Query: 436  TDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYL 495
             DMLE +L +   +LES +K ++   ++L + K +I+++E Q+  L  QRSDLA QVQYL
Sbjct: 430  NDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYL 489

Query: 496  LMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQSKNAE 555
            L+Q SVR D+ GPLT +E+ FV+RI+   D + + DTQ +ISERLV+F+ ++ELQSKN++
Sbjct: 490  LIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSD 549

Query: 556  LLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKERD 615
            LL TIR LADKLE EE++S+ R K+VE   ++EAKEAI++LQEH Q LE ++++++KERD
Sbjct: 550  LLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERD 609

Query: 616  AFKL----ANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIKLLNDEIKA 671
            A+K      N+ NK  + A +++    K+   + +LE+ L    E+++ N+K+LN EI+ 
Sbjct: 610  AYKAIQPSTNNGNKITEHALANS--KGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQE 667

Query: 672  LYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEK 731
            L + K+++ + +E+ER+SK LAEERLK+ Q +L LTK+EN EL+KR   +Q  LLKQD K
Sbjct: 668  LLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTK 727

Query: 732  TQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKILVSQL 791
            TQ T+  +I  +S+L+ L S+L    ++ + L   + +     E LT E     ILV+QL
Sbjct: 728  TQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQL 787

Query: 792  QTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQYKWFQAK 851
            QTLQ ERD LL E + +Y++ ++ LE +  + R  L R+  E+ +   ++ S+ +W+Q K
Sbjct: 788  QTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEK 847

Query: 852  VDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITDKIE 911
            +DSLNE L      L+ +  +   L+   K L  +L+E E + QSY VL   DD+  + E
Sbjct: 848  IDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTE 907

Query: 912  TLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQERK 971
             LR  LEK+ I L DAYSQIE+++S  K +E++   I+ A E  +  + K+   ++++  
Sbjct: 908  ALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKED 967

Query: 972  SLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEEKIS 1031
             L  Q+  L  QI +LN+EL HQK Q  SEK+EL  +L  LQ +Q +++ +K  YE+++ 
Sbjct: 968  ELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLG 1027

Query: 1032 KLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASEAKS 1091
            KL +DL QQA++AN+AQ+NYEQELQ+HADV+KTIS LREESQKYK++    + S  + + 
Sbjct: 1028 KLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEK 1087

Query: 1092 ALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXXXXXXXXXXXX 1151
             L+ ++  W  Q  + E+QL    QR E+L  QN LL DQ++ L                
Sbjct: 1088 TLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLD-LEAKDPNSELGQSEPQE 1146

Query: 1152 XXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQA-TAPDSI 1210
                LI +LRRERDIL+TKL+VS R E +  ++L   + EL   + E S  QA ++ +SI
Sbjct: 1147 KVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQALSSQNSI 1206

Query: 1211 FARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXXXXXXXXXXXX 1270
             A E   +++E+LNQLNLLRESN+TLR+E +K  ++ Q  + +I                
Sbjct: 1207 MADE-HNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELAS 1265

Query: 1271 XTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTXXXXXXXXXXX 1330
               ++  +D QISL+ EE++RWKQRSQDIL K+ERIDP EH+KL +E++           
Sbjct: 1266 LKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKAD 1325

Query: 1331 XXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVXXXXX 1390
                 ++RF++L+KQA ERLD  KA +  +  E      A++ +E +L +  D       
Sbjct: 1326 QNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQD--VNKAL 1383

Query: 1391 XXXXXXXXXXGEADSLKE-ELEELRANFIEANEAVADIKAEAASSEKDLKNQIQELTEKI 1449
                       +ADS  + ELE       +A +   DI+++ A  EK L+++++++    
Sbjct: 1384 QESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHA 1443

Query: 1450 KTLESEIEHSELEAKNSNDSPDFAPI----VENMKKKFEEEKQVLIQEKD-------EEL 1498
            + LE  ++ +  E ++  +    A      +E MK+  EE    LI EK+       EEL
Sbjct: 1444 EELERRLDEARREVESLEEVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEEL 1503

Query: 1499 RMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSKLEAEYEKKTLERIREA 1558
            R+K                        E+  + P +D ETLK + E +YE+KT++RI E+
Sbjct: 1504 RLKEKATYEKELE--------------ENGKHTP-VDIETLKKQWEEDYEQKTIKRIEES 1548

Query: 1559 EEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPE--SFVGDTAKLI 1616
             E L+KRIRLP+EE+IN+++E R+  L+QEFE +++ RA EL  E P+  SF     +++
Sbjct: 1549 NEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFT----EVM 1604

Query: 1617 KEHQEEMDKLEA----KFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINL 1672
            K H++EM+KL+A    + DE++A VRKKAF+EGKQQ  MK   LE KIAKLE Q  K + 
Sbjct: 1605 KRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQV-KASG 1663

Query: 1673 NNSVPSKIPIDNNNNSSPQGAQPIAI-KPSPFQVAFGK 1709
              +VPS  P   N   SP   +P+ I + SP + A  +
Sbjct: 1664 TEAVPS-APTSKN---SP-TEKPVRILEASPLEDALSR 1696

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/1760 (37%), Positives = 1041/1760 (59%), Gaps = 102/1760 (5%)

Query: 6    ASDSSISVDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLK 65
            + D+   V   K++AF  V E ++  +D  ++T+   K  +F+++K+ N+RL+++ID +K
Sbjct: 14   SGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIK 73

Query: 66   CNFEQKINTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAK 125
                ++    K ++E L+ D  S + E+ Q ++E  +   +K ++  EV  L+ ++ +  
Sbjct: 74   TVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSDLD 133

Query: 126  QGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQEL 185
            Q  E +   K++V  +LEEKI +L + + ES + L  +K LR+  ++LE  +Q  KS+EL
Sbjct: 134  QERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKEL 193

Query: 186  REKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLE 245
            R++SEIQ + Q L +++ N+ WL +E+ SK EQL S R K + EL     +  S K++L+
Sbjct: 194  RDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQ 253

Query: 246  FARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVS 305
              ++ N  +  K  EL+  LQEKL+E K L+D L  EK+EF  EMS+KQ+LIDLLE+QV 
Sbjct: 254  LEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVK 313

Query: 306  SMKSDLENAYQSAN----QNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLS 361
            S++ +L  +    N     +G    E ++L+ ELI  K+N E ++ E ++LEA V EL+ 
Sbjct: 314  SLQGELNASLDKDNVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQELIP 373

Query: 362  VNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVE 421
              G +    IN+  S  SL +K S++     D+GILKK+L++ER QKE LQ QVESF+VE
Sbjct: 374  --GDDSQDDINNTSSFISLRNKDSSLR----DMGILKKELIKERHQKERLQRQVESFIVE 427

Query: 422  LEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSL 481
            LE+KIP++NSFKERT MLE+ELNDV LLL+ T+ +++++  E      K+ + ES + +L
Sbjct: 428  LEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTL 487

Query: 482  IVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLV 541
              QR+DLAHQVQ+LLM +SV+ D+ G L+ +EV F+KRI++++D   +SD+Q +ISERLV
Sbjct: 488  TRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLV 547

Query: 542  QFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQ 601
            +F ++  LQ KN ELL T+R+LA+KLE EEK    ++++ E  T+KEAKEAI+SLQ++  
Sbjct: 548  EFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNA 607

Query: 602  RLEDQLKIVSKERDAFKLA---NSANKQGDSAPSSTYQSKKL---DEHIMELEKRLKNLA 655
             LE +++I++KE DAFK     N +++ G  + + T  ++     +E +  LE RL +L 
Sbjct: 608  NLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLT 667

Query: 656  EQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELH 715
             +S  N K+LN+EI  LY++K+++++ LE+ERSSK L EERLKLIQ TL LT+ EN +L 
Sbjct: 668  VESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLV 727

Query: 716  KRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENE 775
            KRS +LQ +  +QD +T  T++E+IA  S+L+ L +K+A L +E++ L+  E   +    
Sbjct: 728  KRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYL 787

Query: 776  ALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYE 835
             L++E  + +I+VSQLQTLQ ER+  L+E QT Y++N++ LE +  + R  L  +T+E E
Sbjct: 788  KLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAE 847

Query: 836  EQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQ 895
            +   S  +Q +W+Q K+DS+  +  + ++ LQ KT  +  L+   + L  ++EE+E R Q
Sbjct: 848  DMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQ 907

Query: 896  SYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEES 955
            SY VL+ ++  T    +LRK LEK  INL+D Y++I+QYK++   +E+S  ++++     
Sbjct: 908  SYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASG 967

Query: 956  QANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGS 1015
            +   +  +  L+ E+  L D +A LN+ +  L   L       ++EK+ L KK++ L+  
Sbjct: 968  KQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETE 1027

Query: 1016 QRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKY 1075
             +   +LK EY+ +I KLQ DL QQAS+AN+AQ+NYE+ELQK ++V+KTIS LRE+SQK 
Sbjct: 1028 SKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKD 1087

Query: 1076 KSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELL 1135
            +  +   K S  + +  LE+NE+SW  Q  + E QL  ++Q  E+L+TQN LLYDQ+EL 
Sbjct: 1088 RIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELF 1147

Query: 1136 XXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENV 1195
                                ++  LRRERDIL TKL VS REE+ LR  L   + EL+  
Sbjct: 1148 SKDNSDGVNGETAEVRE---ILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTT 1204

Query: 1196 RLEFSKTQA--TAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNE 1253
            + + S+ Q   T    +  +   E+I+E+LNQLNLLRESN+TLRN +++  ++++  Q E
Sbjct: 1205 KRQLSQFQKEITTHSELIGQ--HEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEE 1262

Query: 1254 IAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQK 1313
            +                   ++ E+DQQ++L KEE++RWK+RSQ+ILHK++RIDP +H++
Sbjct: 1263 LNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKE 1322

Query: 1314 LADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQ 1373
            L ++V+                 +RF +L+KQA+E+L+  K A+  + ++   +  AK++
Sbjct: 1323 LKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSE 1382

Query: 1374 LEAELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEAV----ADIKA 1429
            LE +      KV                    L+E L     N  E  E+V    +D   
Sbjct: 1383 LEGKFEAEERKVHE------------------LQERLN-AHGNDTETVESVQKELSDALE 1423

Query: 1430 EAASSEKDLKNQIQELTEKIKTLESEIEHSELEAKNSND----------SPDFAPIVENM 1479
             +   E++L   +Q+  E  K L  EI+  +LE  +  +          S D + +VE+M
Sbjct: 1424 HSRELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESM 1483

Query: 1480 KKKFEEEKQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETL 1539
            ++ FEEEK   ++EK EEL+                           + P    ++ E +
Sbjct: 1484 RRSFEEEKINFLKEKTEELKKLEEEKHTLQVNG--------------NEPQQQPVNYEEI 1529

Query: 1540 KSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALE 1599
            K + E+E E+  L+RI EAEE LKKRIRLP+EERI QV+E+++ AL++ ++ ++      
Sbjct: 1530 KRQWESEQEESILKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSS 1589

Query: 1600 LFKENPESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESK 1659
            L   +     G+ + L K+ +++   L+ KF+ ++  V+KKAFEEGKQQ  MK  LLE K
Sbjct: 1590 LESSD-----GNNSDLKKQLEKD---LQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLERK 1641

Query: 1660 IAKLEGQ-------PNKINLNNS------VPSKIP----IDNNNNSSPQGAQPIAIKPSP 1702
            I+KLE Q       P+K +   S      +PSKI       N +  +P  +    +K  P
Sbjct: 1642 ISKLESQLHGKVDSPDKSSSETSSVPKPNLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDP 1701

Query: 1703 FQVAFGKAMENTSFGSFKGS 1722
             +  F       +F SF G 
Sbjct: 1702 SKPTF-------NFSSFSGG 1714

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/1779 (36%), Positives = 1022/1779 (57%), Gaps = 104/1779 (5%)

Query: 17   KVAAFLEV--DEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINT 74
            ++A FL +  DE K    D  +      K  EF+ ++++N+RL  ++D LK     K+++
Sbjct: 19   RIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDS 78

Query: 75   FKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASA 134
             K++ E+L+ +  + +Q + + E++  +L  EK     ++  ++ +++   +   ++ S 
Sbjct: 79   LKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNVLKSN 138

Query: 135  KQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRL 194
            KQ+V KLLEEKIS+L ASK ES  L+  NK LR+  ++ +  +Q  K   L +KSE++ +
Sbjct: 139  KQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELEIV 198

Query: 195  HQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTL 254
             Q++ ++  + +WL KE+ SK EQL  +R++ ++ELQ   ++V  LK+  +  +++   L
Sbjct: 199  KQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSREFL 258

Query: 255  KAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDL--- 311
              K  E+S  LQ KL E KKL+D LNTEK+EF+REMSLKQ+L+DL + Q+ S K +L   
Sbjct: 259  LKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELRLT 318

Query: 312  ENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVI 371
            E  + S   + + + ++ + +D+L   ++ LE +  E ++L+A VNE++           
Sbjct: 319  EEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMG---------- 368

Query: 372  NSNVSDTSLDSKIS-TVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILN 430
              +  +  LDS  + ++PKL GDIG+LKKQL++ER QKE LQ Q+ESFVVELE+K+P++N
Sbjct: 369  --DSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVIN 426

Query: 431  SFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAH 490
            S KER+  LE+EL+D+ LLLE T+ ++++KT EL     KI   E    +LI QRSDLA 
Sbjct: 427  SLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLAR 486

Query: 491  QVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQ 550
            QVQ+LL   ++++D+ GPLT  EV F+K+II +E+ + +SD+Q II+ERLV+FK +  LQ
Sbjct: 487  QVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATLQ 546

Query: 551  SKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIV 610
             +N ELL T R LAD+LE+EEK S  R+ S+E +T+ EAKEAI++LQE    +E ++  +
Sbjct: 547  ERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTI 606

Query: 611  SKERDAFKLANSANKQ-----GDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIKLL 665
             KERDA+K   S   Q     GD+      Q  +  E I  LE +L  L  ++  N +LL
Sbjct: 607  EKERDAYKAILSQTSQSFDNLGDADRMKDSQENQ--ELIKSLEDKLSTLTTETSKNNELL 664

Query: 666  NDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVL 725
            N EI+ LY++K+++T+  E+ERSS+ LAE+RLKL+QSTL +TK EN EL +RS +LQ +L
Sbjct: 665  NQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSIL 724

Query: 726  LKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSK 785
             KQ+ +   T+++ I+ +S+LS L ++ A L +E+  L+     L+ E + ++ E  +  
Sbjct: 725  SKQEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLN 784

Query: 786  ILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQY 845
            ++V+QLQTLQ ER+ LL+E+Q +++  I +LE    E +  +  +  E +    +  +Q 
Sbjct: 785  LMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQT 844

Query: 846  KWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADD 905
            KWFQ K+D ++      R  L  KT ++  L+L    L  K+EE++ R  SY  L +A +
Sbjct: 845  KWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGN 904

Query: 906  ITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIAL 965
                   LRK+LEK  I L  AYSQ E++K ++  +E++   +S   EE     + N   
Sbjct: 905  GETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEK 964

Query: 966  LEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSE 1025
               E+  L   ++ L   I  LN+E   QK++++ EK+E++KKL  L+ S+ SL ++K E
Sbjct: 965  YLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKE 1024

Query: 1026 YEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRS 1085
            Y++K+ +LQ+DL QQ +YAN AQKNYE+ELQKHA+V+K IS LR E Q  +SE++  K S
Sbjct: 1025 YDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKAS 1084

Query: 1086 ASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXXXXXX 1145
              +AK  LE  E+SW  Q  +L++ +   +++ + +++QN+LL+ QVELL          
Sbjct: 1085 EQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELL---SKSEREF 1141

Query: 1146 XXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQAT 1205
                      L+++LRRERDILETKL VS REEK+L Q+    + EL   R +  K Q  
Sbjct: 1142 ENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQEN 1201

Query: 1206 APDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXXXXXXX 1265
              +     +  E IME+LNQ+NLLRESNVTLRN      E++   Q+E+           
Sbjct: 1202 DSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLN 1261

Query: 1266 XXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTXXXXXX 1325
                    +I E+DQ+I LL +E+ RWK+RS DIL ++E+IDP E++KL +E++      
Sbjct: 1262 SELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKEL 1321

Query: 1326 XXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKV 1385
                       +RF +L+KQA+E+L+  K A+A + +E   +   K ++E  L +T  KV
Sbjct: 1322 EAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKV 1381

Query: 1386 XXXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEAVADIK---AEAASSEKDLKNQI 1442
                            E DS     E+LR    +A E   +I+    E   S + L +Q+
Sbjct: 1382 LNLEKLLT--------ERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQL 1433

Query: 1443 QE----LTEKIKTLESEIEHSELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEEL 1498
             E    L E+++  + +   S LE      S   + +VE+MKK FEEEK   IQEK EE 
Sbjct: 1434 NEEINSLKEQVRIFKEKENDSTLEG-----SQGLSNVVESMKKAFEEEKIKFIQEKTEEY 1488

Query: 1499 RMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPL--IDEETLKSKLEAEYEKKTLERIR 1556
              K                          +P  P+   D  +LK + E EYE  + +RI+
Sbjct: 1489 NKKFEEEKAKLSSEN-------------GSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQ 1535

Query: 1557 EAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLI 1616
            EAEE LKKRIR+P+EERI +V+++R+  L++EF+ R++   L+     PE   G  AK  
Sbjct: 1536 EAEENLKKRIRMPTEERIKKVLDKRKTELEEEFQRRLKENNLQ-----PE---GGDAKER 1587

Query: 1617 KEHQEEMD-KLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNS 1675
            +E +++++ + EAK+ E LA  +KKAFEEGKQQ  MK  LLE KI+KLE Q N  + NN 
Sbjct: 1588 EELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLN--SSNNP 1645

Query: 1676 VPSK-------IP--ID-----NNNNSSPQGAQPI---------AIKPSPFQVAFGKAME 1712
             P K       +P  ID     N    +P   + +         + +PS     F  A+ 
Sbjct: 1646 TPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTSALP 1705

Query: 1713 --NTSFGSFKGSLLDSKQFIANTADTSTSTLTGNVGTNT 1749
              N  FG     +  +  F   ++   +    G+ G NT
Sbjct: 1706 GNNNVFG-----MKPTFSFTPGSSQPESRPTFGSTGFNT 1739

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/1723 (36%), Positives = 1007/1723 (58%), Gaps = 105/1723 (6%)

Query: 1    MSQRGASDSSISVD------YSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADN 54
            MS R AS  S   D       + +A+F +    +V+ +D  +VT    K  +F+++K++N
Sbjct: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSEN 60

Query: 55   MRLSISIDGLKCNFEQKINTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEV 114
            +++++++D LK N  +KIN+ K ++E +L      ++E+  T  +   +  EK  LS E+
Sbjct: 61   IQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL 120

Query: 115  LKLRSQVEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLE 174
              ++ ++ +  +  + I S++Q   K+L+E++ +L   K  S+   +  K+LR + ++LE
Sbjct: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180

Query: 175  FIIQGYKSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGY 234
               Q Y S +L  KS+++R  QELNL++SN DWL KEL SKN+Q  S+R+KTN+ +    
Sbjct: 181  TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR 240

Query: 235  EQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQ 294
              +N +++  +  + NN  L+ K  ELS  LQEKL++ K L+D  N+EK +F+ E++LKQ
Sbjct: 241  NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ 300

Query: 295  RLIDLLESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEA 354
            RLIDLLESQ++++K +L N  +S N + +++ +  QL+ E     K+L+ T+ + ++ E 
Sbjct: 301  RLIDLLESQLNAVKEELNNTRES-NYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCEN 359

Query: 355  TVNELLSVN---GK-NGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEE 410
                L S+    GK +G+    SN                 GD  +LKKQL++E+R KE 
Sbjct: 360  ECLRLSSITEEAGKEDGILTSKSN-----------------GDFILLKKQLIKEKRAKEH 402

Query: 411  LQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNK 470
            LQNQ+ESF+VELEHK+PI+NSFKERTD LE ELN+  LLLE T+ +++ K  EL     K
Sbjct: 403  LQNQIESFIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEK 462

Query: 471  INNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAP-K 529
            +  Y+ ++  L  QR DL  Q+QYLL+  SV +D+ GPL ++E++F++ I+ ++D A  +
Sbjct: 463  LAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTE 522

Query: 530  SDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEA 589
            SD+Q I++ERLV+F+ +I+LQ KN+ELL   R LADKLE  E KS+  LK++E +T+ EA
Sbjct: 523  SDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEA 582

Query: 590  KEAILSLQEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQ-----SKKLDEHI 644
            KEAIL+LQ    +LE ++  + KER+ FK  N    Q  S  +S  Q      ++L+   
Sbjct: 583  KEAILTLQSQKVQLESKIHELEKEREKFK--NWTMDQETSPNNSVIQQLTETKRELESQT 640

Query: 645  MELEKRLKNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTL 704
             +L+ R+  +  +S +N+ LLN E++ LY +KS +++ L +E+SS++LAEER KL+ +TL
Sbjct: 641  QDLQARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTL 700

Query: 705  SLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLR 764
             L K EN +L KRS +LQ  + KQD KTQ T+++ ++ KS+LS + ++L+ L  ER    
Sbjct: 701  DLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKI 760

Query: 765  KIEAELKNENEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETR 824
            ++E  LK E   L+ E T+  I+V+QLQTLQ+ER+ LL+E + + +  I+ L++  +E +
Sbjct: 761  ELEKNLKQELSELSSEKTSLHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELK 820

Query: 825  EHLVRRTREYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLT 884
               +R+ +  ++    + S+ +W+Q K+++L +  ++   +L EK   +E  Q   KSL 
Sbjct: 821  TEAIRKDQYIKQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLE 880

Query: 885  AKLEEAELRTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQS 944
             ++EE ++R  +Y+VL  +  I D  ++LR+ LEK+ INL DAYSQI++YK + + +++S
Sbjct: 881  KEIEENKIRLHTYNVLDES--IND--DSLRRELEKSKINLTDAYSQIQEYKKLYETTDKS 936

Query: 945  AVEISKALEESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSE 1004
              E+S  L+ES   +   I  L  E+ SL D+++LL +Q+ +LN+ELD Q    + EK+E
Sbjct: 937  LQEMSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAE 996

Query: 1005 LIKKLSILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKT 1064
              KK+SILQ + + ++ +K+EYE K+SK+Q+DL QQ  YAN AQ NYEQELQKHADV+KT
Sbjct: 997  FKKKISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKT 1056

Query: 1065 ISLLREESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQ 1124
            IS LRE+   YK ++E    +  + + AL+ NE +W  Q   L  QL L+  R E+L++Q
Sbjct: 1057 ISELREQLHTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQ 1116

Query: 1125 NRLLYDQVELLXXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQR 1184
            N+LLYDQ+EL                     LI TLRRERDIL+TK+ V+ R+ K+LRQ+
Sbjct: 1117 NKLLYDQIELYTTTGNKPTDAKSGSVLNNDILI-TLRRERDILDTKVAVAERDAKMLRQK 1175

Query: 1185 LGLAKTELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYL 1244
            + L   EL+  R +   ++       F  +  +++MEKLNQLNLLRESN TLRNE     
Sbjct: 1176 ISLIDVELQEARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSN 1235

Query: 1245 EQSQHFQNEIAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYE 1304
             +++  Q+E+                   +I E++Q+I L KEE  RWK+RSQDI+ K++
Sbjct: 1236 SKNKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQ 1295

Query: 1305 RIDPVEHQKLADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEF 1364
            ++   +++KL  E+                 +E+F +LR+QA E+L   K ++     + 
Sbjct: 1296 QLSSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQL 1355

Query: 1365 EAVSIAKAQLEAELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEAV 1424
              +  AK  LE  L     ++                    L+E+ EE        N   
Sbjct: 1356 NELKDAKLALEKSLNNANARIQELEDAKVAENRNQLSMIKKLQEDTEE--------NSKE 1407

Query: 1425 ADIKAEAASSEKDLKNQIQELTEKIKTLESEIE-----HSELEAKNSNDSPDFAPIVENM 1479
             + K E  +   D  + +++L E+I  L+ E+E       + +A    +  D + +VE+M
Sbjct: 1408 LETKLEENAISYD--STVKKLNEEIGILKEELEKQRQIQQQFQAAAGTEQDDLSKVVESM 1465

Query: 1480 KKKFEEEKQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETL 1539
            K+ FEE+K   I+EK  E+  K                           P+   IDE  +
Sbjct: 1466 KRSFEEDKIKFIEEKTREVNQKIREFQEAQEAEETGLK-----------PSNINIDE--I 1512

Query: 1540 KSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRAR--- 1596
            K + EAE+ ++  ++IREAEEALKKRIRLP+EE+I+++IER++  L++EF+ +V  R   
Sbjct: 1513 KKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLKS 1572

Query: 1597 ------ALELFKENPESFVGDTAKLI-----KEHQEEM--------------DKLEA--- 1628
                    ++F++  ES + +  K +     K+ QE++              DKL A   
Sbjct: 1573 ISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIISSDDKDKLRADIE 1632

Query: 1629 -----KFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQ 1666
                 +F+ +L  ++KK+FEEGKQQ +MK  LLE K+AK+E Q
Sbjct: 1633 AQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQ 1675

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  883 bits (2282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/1766 (36%), Positives = 1029/1766 (58%), Gaps = 127/1766 (7%)

Query: 18   VAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFKE 77
            +A+F      +V+  D  +V     K  +F+++K++N+++++S D LK +  +KI+  K 
Sbjct: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGLKT 83

Query: 78   QVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAKQD 137
            ++E ++ +    ++E+  T  +   + NEK +LS E+  ++ ++++  +  +   S +Q 
Sbjct: 84   EMENVIRENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTEEKKETQSNQQR 143

Query: 138  VTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLHQE 197
              K+L+E++ ++   + E++R  +  K+LR + +DLE   QGY + +L  ++E++R  QE
Sbjct: 144  TLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLNSRTELERKTQE 203

Query: 198  LNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAK 257
            L L++SN DWL KEL SKNEQ  S+R+KT+  + +   ++N L++  +  R NN  LK K
Sbjct: 204  LTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQMERTNNDVLKQK 263

Query: 258  TAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLEN---- 313
              ELS  LQEKL+E K L+D LN+EK+EF+ EMSLKQRL+DLLESQ++++K +L +    
Sbjct: 264  NNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNAVKEELNSIREL 323

Query: 314  --AYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVI 371
              A   A+ +   TPE + LL EL  TK+ L   + E ++L                   
Sbjct: 324  NTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRL------------------- 364

Query: 372  NSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNS 431
             S+++D + +   +   K   D   LKKQL++ERR KE LQNQ+E+F+VELEHK+PI+NS
Sbjct: 365  -SSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINS 423

Query: 432  FKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQ 491
            FKERTDMLE ELN+  LLLE T+ +++ K  ELN    K+   E+ + +L  QR DL  Q
Sbjct: 424  FKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQ 483

Query: 492  VQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEA-PKSDTQGIISERLVQFKSVIELQ 550
            +QYLL+  SV +D+ GPL ++E++F++ I+  +D    +SD+Q +++ERLV+FK++I+LQ
Sbjct: 484  IQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQ 543

Query: 551  SKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIV 610
             KNAELL  +R LADKLE +EKKS+  L+ +E++TV EAKEAI++L+     LE   +I 
Sbjct: 544  EKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLES--RIE 601

Query: 611  SKERDAFKLANSANKQGDSAPSSTYQ-----SKKLDEHIMELEKRLKNLAEQSQDNIKLL 665
              +++  +L  S   +  S  + T +      + L+  + +L+ R+  +  +S +N+ LL
Sbjct: 602  ELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLL 661

Query: 666  NDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVL 725
            N EI+ LY +KS++++ L +E+SS++LAEER KL+ +TL LTK EN +L KR D LQ  +
Sbjct: 662  NKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTI 721

Query: 726  LKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSK 785
            LKQD KT  T++E ++ KS+LS + ++L  L  E+     +E  LK E   L+ E  + +
Sbjct: 722  LKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLR 781

Query: 786  ILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQY 845
            I+V+QLQTLQ+ER+ LLEE + + +K I++LE  L E ++   ++    ++    + S  
Sbjct: 782  IMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNI 841

Query: 846  KWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADD 905
            +W+Q K+++L +  ++   ++  K   IE LQ   KSL  ++EE ++R  +Y+V+    D
Sbjct: 842  EWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVM----D 897

Query: 906  ITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIAL 965
             T   ++LRK LEK+ INL DAYSQI++YK + + + QS  + +  L+ES  ++   I  
Sbjct: 898  ETINDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKN 957

Query: 966  LEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSE 1025
            L  E+ SL D+I+LL +Q+ +LN+ELD QK   + EK++  K++SILQ + + ++ +KSE
Sbjct: 958  LTDEKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSE 1017

Query: 1026 YEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRS 1085
            YE K+SK+Q DL QQ  YAN AQ NYEQELQKHADV+KTIS LRE+   YK +++    S
Sbjct: 1018 YESKLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLS 1077

Query: 1086 ASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXXXXXX 1145
              + ++AL+ NE+SW  Q   L  QL L+  R E+L++QN+LLYDQ+++           
Sbjct: 1078 RDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIY--TAADKEVN 1135

Query: 1146 XXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVR--LEFSKTQ 1203
                      +++TLRRERDIL+TK+ V+ R+ K+LRQ++ L   EL++ R  L+ S+ +
Sbjct: 1136 NSTNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVE 1195

Query: 1204 ATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXXXXX 1263
                 SI   +  + IMEKLNQLNLLRESN+TLRNE +    + +  Q+E+         
Sbjct: 1196 KENHSSII--QQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAP 1253

Query: 1264 XXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTXXXX 1323
                      ++ E++Q++ L KEE  RWK+RSQDIL K+E++   +++KL  E+     
Sbjct: 1254 IESELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKE 1313

Query: 1324 XXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLD 1383
                        +E+F +LR+QA ERL   K ++  +  +  ++  AK  LE  L++   
Sbjct: 1314 ELENKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANA 1373

Query: 1384 KVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKNQIQ 1443
            ++                +      +LE +R    +A +A  +++A+   S    ++ I 
Sbjct: 1374 RI----------EELQNAKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTIN 1423

Query: 1444 ELTEKIKTLESEIE-----HSELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEEL 1498
             L E+I TL+ EIE       +L+A ++N+  D + IVE+MKK FEE+K   I+EK +E+
Sbjct: 1424 GLNEEITTLKEEIEKQRQIQQQLQATSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEV 1483

Query: 1499 RMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPL-IDEETLKSKLEAEYEKKTLERIRE 1557
              K                        +   N P  I+ E +K K E+E+E++  ++IRE
Sbjct: 1484 NEK--------------------ILEAQERLNQPSNINMEEIKKKWESEHEQEVSQKIRE 1523

Query: 1558 AEEALKKRIRLPSEERINQVI---------------ERRQRALDQEFELRVRARA-LEL- 1600
            AEEALKKRIRLP+EE+IN++I               E R ++++Q  E+ V  R  LE  
Sbjct: 1524 AEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSMEQSGEIDVVLRKQLEAK 1583

Query: 1601 FKENPESFVGDTAKLIKEH-----------QEEMDKLEA--------KFDEQLALVRKKA 1641
             +E  +    +  K ++E             +E DKL A        +F+ +L  ++KK+
Sbjct: 1584 VQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLREEFNNELQAIKKKS 1643

Query: 1642 FEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSKIPIDNNNNSSPQGAQPIAIKP- 1700
            F+EGKQQ +MK  LLE K+AK+E Q ++   +   P   P   NN  +P    P  I+  
Sbjct: 1644 FDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESP---PKSVNNVQNPLLGLPRKIEEN 1700

Query: 1701 --SPFQVAFG-----KAMENTSFGSF 1719
              SPF          K    +S G F
Sbjct: 1701 SNSPFNPLLSGEKLLKLNSKSSSGGF 1726

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/1730 (36%), Positives = 1016/1730 (58%), Gaps = 148/1730 (8%)

Query: 18   VAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFKE 77
            +A+F      +V+ ++  ++     K  +F+++K++N+++++S D LK N  +KI+  K+
Sbjct: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83

Query: 78   QVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAKQD 137
            ++E L+      ++E+  T D+     NEK ++S E+  ++ + ++  +  + +   +Q 
Sbjct: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143

Query: 138  VTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLHQE 197
              K+L+E++ +L  ++ +++R     K LR + IDLE   Q   + +L  ++E++R  QE
Sbjct: 144  TLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELERKAQE 203

Query: 198  LNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAK 257
            LN+++S  DWL KEL SKNEQ  S+R+KT+  +     ++N L+S  +  +  N  L  K
Sbjct: 204  LNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQK 263

Query: 258  TAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLEN--AY 315
              ELS  LQEKL+E K L+D L++EK+EF+ E++LKQRL+DLLESQ++++K +L++    
Sbjct: 264  NDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELDSTRGL 323

Query: 316  QSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSNV 375
            +++N +     EK+ L+ EL  TK+ L   ++E I+L + + E                 
Sbjct: 324  ETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGE----------------- 366

Query: 376  SDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSFKER 435
               + +   S+  +   D  +LKKQL++E+R KE LQNQ+ESF++ELEHK+PI+NSFKER
Sbjct: 367  ---TDEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKER 423

Query: 436  TDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYL 495
            TD LE ELN+  LLLE T+ +++ K  EL+    K+   E+ + +LI QR DL  QVQYL
Sbjct: 424  TDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYL 483

Query: 496  LMQLSVRDDAHGPLTEQEVEFVKRIISSE-DEAPKSDTQGIISERLVQFKSVIELQSKNA 554
            L+  SV  D+ GPL ++E+ F++ I+ ++ D A ++D+Q I++ERLV+F+S+IELQ KN 
Sbjct: 484  LITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNT 543

Query: 555  ELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKER 614
            ELL  +R LAD+LE  E +S+  L+ +E++T+ EAKEAIL+L+   ++LE +++ + KE 
Sbjct: 544  ELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKEC 603

Query: 615  DAFK--LANSANKQGDSAPSSTYQSKK-LDEHIMELEKRLKNLAEQSQDNIKLLNDEIKA 671
            +  K  L+N      +S      ++K+ L+  I +L+  +  +  +S +N+ LLN EI+ 
Sbjct: 604  ENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQD 663

Query: 672  LYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEK 731
            LY +KS++++ L +E+SS++LAEER KL+ +TL LTK EN +L KR D LQ  +LKQD K
Sbjct: 664  LYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSK 723

Query: 732  TQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKILVSQL 791
            TQ T++E I+ KS+L+   ++L  L  E+      E  LK E + L+ E T  +I+V+QL
Sbjct: 724  TQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQL 783

Query: 792  QTLQRERDILLEEAQTNYRKNIEKLESDLHETR---EHLVRRTREYEEQRVSDTSQYKWF 848
            QTLQ+ER+ LL+E + +Y+  I++LE   +E +    H  +R ++ EE    + S  +W+
Sbjct: 784  QTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEE---DNNSSIEWY 840

Query: 849  QAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITD 908
            Q K++ L +  ++   ++ +K   IE LQ   KSL  +++E ++R  +Y+V+    D T 
Sbjct: 841  QNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVI----DGTI 896

Query: 909  KIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQ 968
              ++LRK LEK+ I+L DAYSQI++YK + + + +S  ++    EES  ++   I  L  
Sbjct: 897  NDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTN 956

Query: 969  ERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEE 1028
            E+ SL ++I+LL +QI +LN+ELD Q    + EK+E  KK+SILQ + + ++ +KSEYE 
Sbjct: 957  EKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYES 1016

Query: 1029 KISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASE 1088
            K+SK+Q+DL QQ  YAN AQ NYEQELQKHADV+KTIS LRE+   Y+ ++     S ++
Sbjct: 1017 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQ 1076

Query: 1089 AKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXXXXXXXXX 1148
             +S L+ NE+SW  Q   L  QL  +  R E+L +QN+LLYDQ+EL              
Sbjct: 1077 LESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDK 1136

Query: 1149 XXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGL-------AKTELENVRLEFSK 1201
                   ++++LRRERDIL+TK+ V+ R+ K+LRQ++ L       A+T+L+N RLE  K
Sbjct: 1137 PALNS--ILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEK 1194

Query: 1202 TQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXXX 1261
                 P  I   +  E IMEKLNQLNLLRESN+TLRNE +   E+ +  Q+E+       
Sbjct: 1195 ----RPTII---QQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDI 1247

Query: 1262 XXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTXX 1321
                        ++ E++Q++ L KEE  RWK+RSQDIL K+ ++   +++KL  E+   
Sbjct: 1248 APIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSL 1307

Query: 1322 XXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQT 1381
                          +ERF +LR+QA ERL   K +   +  +   +  AK +LE  L   
Sbjct: 1308 KVKLDEKTRQGAEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSL--- 1364

Query: 1382 LDKVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEAN---EAVADIKAEAASSEKDL 1438
                                +A++  EELE  +A   + N   +A+  ++ +A +S K+ 
Sbjct: 1365 -------------------DDANTKIEELENAKAE--QDNNQLDAIKRLQQDAENSSKEF 1403

Query: 1439 KNQIQE-----------LTEKIKTLESEIE-----HSELEAKNSNDSPDFAPIVENMKKK 1482
            K +++E           L E+I TL  EIE       +L+++ +N+  D + IVE+MKK 
Sbjct: 1404 KTKLEEKATFYDSTIKKLNEEIITLREEIEKQRRIQQQLQSEPANEQNDLSKIVESMKKT 1463

Query: 1483 FEEEKQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSK 1542
            FEE+K   I+EK +E+  K                         + P+   IDE  LK K
Sbjct: 1464 FEEDKINFIREKTKEVNEKILEAQERL-----------------NQPSNINIDE--LKIK 1504

Query: 1543 LEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFK 1602
             +AE+E++ + RIREAEEALKKRIRLP+EE+I+++IER++  L++EF+ +V  R ++L  
Sbjct: 1505 WKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEER-IKLLS 1563

Query: 1603 ENPE---SFVGDTAKLIKEHQEEMD------------------------------KLEAK 1629
            ++ +   +F       I+E Q+E++                              K+  +
Sbjct: 1564 QSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKE 1623

Query: 1630 FDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSK 1679
             D +L  ++KK+FEEGKQQ +MK  LLE K+AK+E Q ++       PSK
Sbjct: 1624 LDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESPSK 1673

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1776 (36%), Positives = 1030/1776 (57%), Gaps = 145/1776 (8%)

Query: 18   VAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFKE 77
            +A+F +    +V+ +D  ++T    K  +F+++K++N+++++S D LK N  +KI+  K 
Sbjct: 24   IASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSENLQITVSFDELKTNSLKKIDGLKT 83

Query: 78   QVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAKQD 137
            ++E +L      ++E+  T  +   L NEK QLS E+  ++ ++ +  +  + I S +Q 
Sbjct: 84   EMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNELESVKRKLNDLTEEKKEIQSNQQR 143

Query: 138  VTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLHQE 197
              K+L+E++ ++  +K E++R     + LR + ++LE   Q Y + +L  +SE++R  QE
Sbjct: 144  TLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQE 203

Query: 198  LNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAK 257
            LNL++SN DWL KEL SK+EQ  S+R++T++ +     ++N LK+  +  + NN  LK K
Sbjct: 204  LNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQK 263

Query: 258  TAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLENAYQS 317
              ELSN LQEK+++ K L+D LNTEK+EF+ E++LKQRLIDLLE+Q++++K +L++  +S
Sbjct: 264  NNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRKS 323

Query: 318  ANQNGMS------TPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVI 371
             + N  S        E + LL +L  TK+ L   ++E ++L +   E    +G       
Sbjct: 324  DSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRLSSITEETGEESG------- 376

Query: 372  NSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNS 431
                   +L S+ ST      D  +LKKQ ++E+R KE+LQNQ+ESF+VELEHK+P++NS
Sbjct: 377  -------TLTSRSST------DFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINS 423

Query: 432  FKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQ 491
            FKERTDMLE ELN+  LLLE T+ +++ K  ELN    KI   E+ +  L  QR DL  Q
Sbjct: 424  FKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQ 483

Query: 492  VQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEA-PKSDTQGIISERLVQFKSVIELQ 550
            VQYLL+  SV +D+ GPL ++E++F++ I+ +++    +SD+Q I++ RLV+F++VIELQ
Sbjct: 484  VQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQ 543

Query: 551  SKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIV 610
             KN ELL   R LADKLE  E KS+  L  +E +T+ EAKEAILSLQ     LE   K+ 
Sbjct: 544  EKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLES--KVE 601

Query: 611  SKERDAFKLANSANKQGDSAPSSTYQ-----SKKLDEHIMELEKRLKNLAEQSQDNIKLL 665
              ER+   L +S +KQ  S  +S  Q      ++L+  + +L+ R+  +  +S  N+ LL
Sbjct: 602  ELERERETLKSSISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSLL 661

Query: 666  NDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVL 725
            N EI+ +Y +KS++++ L +E+SS++LAEER KL+ +TL LTK EN +L KRSD LQ  +
Sbjct: 662  NKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSI 721

Query: 726  LKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSK 785
             KQD KT  T++E I+ KS+LS   + L+ L  E+      E  LK E + L+ E T+ +
Sbjct: 722  SKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLR 781

Query: 786  ILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQY 845
            I+V+QLQTLQ+ER+ LL+EA+ + +  I ++E   +E +     + +   +    +TS+ 
Sbjct: 782  IMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKI 841

Query: 846  KWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADD 905
            +W+Q K+++L +  D+    + EK   IE LQ   KSL  ++EE ++R  +Y+V+    D
Sbjct: 842  EWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVM----D 897

Query: 906  ITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIAL 965
             T   ++LRK LE + INL +AYSQI++YK + + + QS  E++  L+ES   +   I  
Sbjct: 898  ETINDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQS 957

Query: 966  LEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSE 1025
            L  E+ +L D+++LL +Q  +LN+ELD QK++ + +K E  K ++ILQ + + ++ +KSE
Sbjct: 958  LTDEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSE 1017

Query: 1026 YEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRS 1085
            YE K+SK+Q+DL QQ  YAN AQ NYEQELQKHADV+KTIS LRE+   Y+ +++    S
Sbjct: 1018 YESKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLS 1077

Query: 1086 ASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXXXXXX 1145
             SE ++ L+ NE+SW  Q   L  QL L+  R E+L++QN+LLY+Q+EL           
Sbjct: 1078 RSELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDA 1137

Query: 1146 XXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQAT 1205
                      L+ TLRRERDIL+TK+ V+ R+ K+LRQ++ L   EL++ R + + ++  
Sbjct: 1138 RNGPTLNNDILV-TLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVE 1196

Query: 1206 APDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXXXXXXX 1265
              +     +  + IMEKLNQLNLLRESN+TLRNE +   ++++  Q+E+           
Sbjct: 1197 NDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIE 1256

Query: 1266 XXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTXXXXXX 1325
                    ++ E++Q+I L KEE  RWK+RSQDIL K++++   +++KL  EV       
Sbjct: 1257 SELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQL 1316

Query: 1326 XXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKV 1385
                      +ERF +LR+QA E+L   K  +  +  +   +  AK  LE  L       
Sbjct: 1317 EDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSL------- 1369

Query: 1386 XXXXXXXXXXXXXXXGEADSLKEELE-ELRANFIEANEAVADIKAEAASSEKDLKNQIQE 1444
                            +A++  +ELE E  A     +E +   + +A  S ++L+ +++E
Sbjct: 1370 ---------------NDANTRIQELEGEKVAEDNNRSEMIKRSQEDAEKSSRELEEKLEE 1414

Query: 1445 -----------LTEKIKTLESEIE-----HSELEAKNSNDSPDFAPIVENMKKKFEEEKQ 1488
                       L E+I TL+ EIE       +L+    +   D + IVE+MKK FEE+K 
Sbjct: 1415 NAISYSSTVRKLNEEIATLKEEIEKQGQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKI 1474

Query: 1489 VLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSKLEAEYE 1548
              I+EK  E+  K                         + P++  IDE  +K + EAE+E
Sbjct: 1475 KFIEEKTREVNKKIQEAQERL-----------------NQPSSVNIDE--MKKQWEAEHE 1515

Query: 1549 KKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEF------------------- 1589
            ++  ER+REAEEALKKRIRLP+EE+I+++IER++  L++EF                   
Sbjct: 1516 EEVAERVREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKLEEKVKSISGSEQMEA 1575

Query: 1590 ------ELRVRARALELFKENPESF------VGDTAKL-IKEHQEEMDKLEAK----FDE 1632
                  E+RV+ +  EL  E  E        V  ++ + + E  E   ++EAK     ++
Sbjct: 1576 MLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELND 1635

Query: 1633 QLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSKIPIDNNNNSSPQG 1692
            +L  V+KK+FEEGKQQ  MK  LLE K+AK+E Q ++I  +   P   P   NN  +P  
Sbjct: 1636 ELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESP---PKHANNVPNPLL 1692

Query: 1693 AQPIAIKP---SPFQVAF-GKAM-----ENTSFGSF 1719
              P  I+    SPF     G+ +     +++S G+F
Sbjct: 1693 GLPRKIEENSNSPFNTLLSGEKLLKFNSKSSSSGAF 1728

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/1758 (33%), Positives = 983/1758 (55%), Gaps = 92/1758 (5%)

Query: 6    ASDSSISVDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLK 65
            A+D+    + + + +FL V   ++  ++ S+++    K  +F+++++ +++  +S++ L+
Sbjct: 4    AADTLTKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQ 63

Query: 66   CNFEQKINTFKEQVEKLLSDVASRQQEKQQTE----DEKLKLMNEKAQLSMEVLKLRSQV 121
               + +IN  + Q+E L+   AS  +EK++ E    DEK     E  QLS     LR+++
Sbjct: 64   KTSQGRINDLRTQLEDLIEQNASASEEKKKIEKELSDEK----KESFQLSSTRDNLRAEL 119

Query: 122  EEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYK 181
            +E ++  + +    QD  KLL+ KIS     KE + +L    +E      DLE  IQ  K
Sbjct: 120  KEIQEKFDNLQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLK 179

Query: 182  SQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLK 241
              +   ++ + +L Q+L  +    + L  ELE+K+++++ +     +E+Q   +++++L+
Sbjct: 180  YNDSLTETTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLE 239

Query: 242  SQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLE 301
            +     ++ N  LK +   +S+ L EK  + ++L ++ NTEKEE  +E+SLKQ +ID+L+
Sbjct: 240  NNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQ 299

Query: 302  SQVSSMKSDLE---NAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAEN--IKLEATV 356
            +QV  ++ D     N  Q   QN               D ++NLE  + +   I+ E  +
Sbjct: 300  TQVQKLQDDYTRILNTKQPIVQN---------------DEERNLEVEELKQKLIETETQL 344

Query: 357  NELLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVE 416
            N+ L       +   +S +S+   +           D+  +KK+L+QER QKE+LQNQVE
Sbjct: 345  NKELEERRNITMQTESSTLSNQQQE-----------DLDTIKKELIQERYQKEKLQNQVE 393

Query: 417  SFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYES 476
             F+VELE K+P +NSFK+RTDMLE+EL D TLLLE+  ++++Q T EL+  +    + + 
Sbjct: 394  IFIVELEKKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKW 453

Query: 477  QVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGII 536
            +  SL  QR+DLAHQ+QY+L+  SV++D++GPL+ +EV F++ I+ +E     SD+Q +I
Sbjct: 454  ETKSLTKQRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQVI 513

Query: 537  SERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSL 596
            SERLV F++++ELQ KN +LL ++R+LA KLE +E+  +   + VE Q + EAKEAI+SL
Sbjct: 514  SERLVTFQNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISL 573

Query: 597  QEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKL------DEHIMELEKR 650
            Q +  +LED++K ++ E D +K            P +  +++ L       + I ELE R
Sbjct: 574  QSYNTKLEDKIKTLNDELDCYK--------SLPKPDTKVETEHLRLNEENTDLIKELETR 625

Query: 651  LKNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEE 710
            L    E+S      LN+EI  + +  S+     + ER+S+ LAE+RLKLIQ++LSL+K E
Sbjct: 626  LATSREESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVE 685

Query: 711  NLELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAEL 770
            N +L KR + LQ + LKQD++TQ T+ E ++ K  LSN  ++L  + S+ +  +  E  L
Sbjct: 686  NEQLQKRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSL 745

Query: 771  KNENEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRR 830
            K++   ++KE    K LVSQLQ+LQ ER+ +    + + +  ++ +E +L++  E L  +
Sbjct: 746  KDDITIVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNK 805

Query: 831  TREYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEA 890
             RE +E   +  S+ +W+Q K+D++ E+ D  +  L EKTN I  L    K L   L+ +
Sbjct: 806  DREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQAS 865

Query: 891  ELRTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISK 950
            E R  +Y VL N+D++  K+ETL+  LEK+ INL++AY++++QYK  A   E+       
Sbjct: 866  ESRVTAYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQN 925

Query: 951  ALEESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLS 1010
             +EE++  + + I  L+++R  L D  ++L++QI DLN+ELDHQ   +  EKSE+ KKL+
Sbjct: 926  TVEETKKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLN 985

Query: 1011 ILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLRE 1070
             L     +++E+ ++YE K+S LQ DL QQASYAN AQ NYEQELQKHA++ KTIS LRE
Sbjct: 986  ELLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLRE 1045

Query: 1071 ESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYD 1130
            ++  Y+ +M+  + +A+  +  L +NE+ W +Q    E Q+   ++R E+L++QN+LL+D
Sbjct: 1046 DAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFD 1105

Query: 1131 QVELLXXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKT 1190
            QV+LL                    L+++LR +RDIL+T+L V+  E K LR +L    T
Sbjct: 1106 QVDLL--SKSENSYNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNT 1163

Query: 1191 ELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHF 1250
            EL N R + ++ +    ++  + E  + IM +LNQLNLLRESN+TLRNE+    E+++  
Sbjct: 1164 ELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQL 1223

Query: 1251 QNEIAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVE 1310
            Q ++                    I E +QQ++  KEE +RWKQRSQDIL K+++IDPVE
Sbjct: 1224 QEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVE 1283

Query: 1311 HQKLADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIA 1370
            H+KL  E+                  +RF +++KQA+ERL+  KA +  +  + + +   
Sbjct: 1284 HEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDE 1343

Query: 1371 KAQLEAELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEAVADIKAE 1430
             A +++ L +T                    +  +L+ +LEE     + + E      A 
Sbjct: 1344 NAHIQS-LLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEA---LLSSKEFENKFNAS 1399

Query: 1431 AASSEKDLKNQIQELTEKIKTLESEIEHSELEAKNS----NDSPDFAPIVENMKKKFEEE 1486
              SS++   +    L + I +L +E+ H + E+KN+       PD + +VE MKK FEEE
Sbjct: 1400 VKSSDEISSH----LNDVIDSLNNELTHLK-ESKNNEATVTGQPDLSNVVEEMKKSFEEE 1454

Query: 1487 KQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSKLEAE 1546
            K   +Q++  E + K                              PL D    + + E E
Sbjct: 1455 KIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKNV---------TPLQDISAQREQWEKE 1505

Query: 1547 YEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELF-KENP 1605
            YE+  L+RI +AEE LK+RIRLP+EE+IN VI++++  L++E++ +V  RA EL   E  
Sbjct: 1506 YEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEEN 1565

Query: 1606 ESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEG 1665
            ++F+ D    IK+      +LE   D++L   + KAFEEGKQQ +MK   LE KI+KLE 
Sbjct: 1566 KTFIEDLKNDIKK------ELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLES 1619

Query: 1666 Q---PNKINLNNS---VPSKIPIDNNNNSSPQGAQPIAIKPSPFQVAFGKAMENTSFGSF 1719
            Q    N  N N +   V  K P D NN   P   +    KP   ++     + +T   + 
Sbjct: 1620 QLQGSNAANENKNDVEVLLKTPSDENN--VPSKQEETLSKPQLSKIQIANPLLSTGGTTL 1677

Query: 1720 KGSLLDSKQFIANTADTS 1737
              +   +   + N +D+S
Sbjct: 1678 ALNQSRAPSSLQNGSDSS 1695

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/1781 (32%), Positives = 971/1781 (54%), Gaps = 123/1781 (6%)

Query: 16   SKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTF 75
            S++A FL V+ + V+ L + +      KA EF+++++DN+R ++ ++  K N   K    
Sbjct: 7    SEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKL 66

Query: 76   KEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAK 135
            KE+++ ++ D    + E +   ++   L         E+ +L++  E  +  ++      
Sbjct: 67   KEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERY 126

Query: 136  QDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLH 195
            +++    +EK+++L   ++E   L    K L    ++LE   Q Y+S EL  KSE++R  
Sbjct: 127  KELNGSYDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELERNA 186

Query: 196  QELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLK 255
            QE+ L++ N +WL +EL +KN+    +R+KT+  + +    V  LKS L+  +++   L 
Sbjct: 187  QEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSSKEILS 246

Query: 256  AKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLENAY 315
             K  E + QLQ  L+E K L DVL  EK+EF +E+S+K +LI L E+Q+ S++S L+  +
Sbjct: 247  KKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQKF 306

Query: 316  QSANQNGMSTPEK-DQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSN 374
            ++A  N  ++ E    L +EL   ++ L+  + + ++LE+ ++     +  N V++    
Sbjct: 307  KTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILD-----HDSNDVSLQTKG 361

Query: 375  VSDT--------------SLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVV 420
               T              S D    ++ ++ GDI ILK+QLVQE+RQKE+LQNQVESFV+
Sbjct: 362  RKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVI 421

Query: 421  ELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCS 480
            ELEHKIP++NSF+ERT +LE+EL D  LLLE   K+ + KT EL   K KI++  SQ+  
Sbjct: 422  ELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEI 481

Query: 481  LIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERL 540
            L+ QR+DLAHQ+QYLL+ +S+ +D    L E E++F+K ++S+++ A  +D+Q +ISE L
Sbjct: 482  LLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVISEHL 541

Query: 541  VQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKE-------AKEAI 593
            ++FK + +LQ KN EL+ T+R LA +LE+ E+K     KS    TV E       AKEAI
Sbjct: 542  IKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKK----KSTSNNTVDEDNEIFAEAKEAI 597

Query: 594  LSLQEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSST----YQSKKLDEHIM-ELE 648
            L+L++  + LE  L+IV+KERDAFKL  S +++ +   S++    ++ K  +E ++ +LE
Sbjct: 598  LTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLE 657

Query: 649  KRLKNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTK 708
             RL  L   S  + K L +E+  L+K  S++ V +E+ RS+K LAEERLK+ Q+++ L  
Sbjct: 658  NRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLS 717

Query: 709  EENLELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEA 768
            +EN +L  RS  L+  LL+QD++TQ T    +   S+ S+L + +  L +E   L+  E 
Sbjct: 718  KENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREI 777

Query: 769  ELKNENEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLV 828
             LK+E    T+E T  +I+V+QLQ+LQ ER+ LLE  Q++++K I ++     +  + L 
Sbjct: 778  SLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLS 837

Query: 829  RRTREYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLE 888
             R  E ++      +QY+W+Q K+D  ++Q    +  LQ K + +E L L  K+L  +LE
Sbjct: 838  ERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELE 897

Query: 889  EAELRTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEI 948
             A++R  +Y  +   +    +   + K LEK  I LADAYSQ+E++K++++ SE +  E+
Sbjct: 898  GAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKEL 957

Query: 949  SKALEESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKK 1008
            + +      +YR  I  L +E+  +  +  +L  Q++++ +EL  Q  + +SE+  L + 
Sbjct: 958  NASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLTQT 1017

Query: 1009 LSILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLL 1068
            ++ LQG+ + ++E+K  +EEK+ KL+ DL +Q  YAN AQKNYEQELQ+HADV+KTIS L
Sbjct: 1018 IAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISEL 1077

Query: 1069 REESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLL 1128
            RE++Q+ K++ +         +  + +NE+    +  +   Q+ LAQQR +++  QN+LL
Sbjct: 1078 REQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLL 1137

Query: 1129 YDQVELLXXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLA 1188
            Y+Q++LL                    L+++LRRERDIL+TK++V   E+  L+Q+L   
Sbjct: 1138 YNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDI 1197

Query: 1189 KTELENVRLEFSKTQATAPDSIFARESQ-----EQIMEKLNQLNLLRESNVTLRNESKKY 1243
            + ELEN     +K  A   +S ++  S      + I   L QLNLLRESNVTLRNE K+ 
Sbjct: 1198 QNELEN-----TKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQA 1252

Query: 1244 LEQSQHFQNEIAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKY 1303
            L++      ++                    I E+D +I+   +ES RWK R ++++ K+
Sbjct: 1253 LDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKH 1312

Query: 1304 ERIDPVEHQKLADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESE 1363
            ++++  ++ KL + +                  +RF +L+KQA+E+L+  K  ++ ++ +
Sbjct: 1313 QKVNVDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQ 1372

Query: 1364 FEAVSIAKAQLEAELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEA 1423
               +   K     ++ + LD                  + + L+   EEL     ++ E 
Sbjct: 1373 ISNLISEK----DDIRKQLDVKTEENSELLSELNNFREKQNDLETLREELNKEISKSEEL 1428

Query: 1424 VADIKAEAASS---EKDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSPDFAPI-VENM 1479
               ++ E  SS    ++   +I+EL + I  L++++      A NS D+ +     VE +
Sbjct: 1429 EVKLQNEIESSSLASRNTNKEIEELQKVIDDLKTQL------AANSTDADEQTNRNVEAI 1482

Query: 1480 KKKFEEEKQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPL-IDEET 1538
            K++FE +K   I EK EE   +                           P+  L +D E 
Sbjct: 1483 KREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEK----------PDTELNVDVEA 1532

Query: 1539 LKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARAL 1598
            L+ + E + E+   +RI EAE+ LKKRIRLPSEE+IN++IE+R+  L+ EF+ ++R +A 
Sbjct: 1533 LRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKAR 1592

Query: 1599 ELFKENPESFVGDTAKLIKEHQEEMDK-LEAKFDEQLALVRKKAFEEGKQQLVMKVKLLE 1657
            +L   +  +   +      E +E ++K L+ +F+++L   RKKAFEEGKQQ  MK  LLE
Sbjct: 1593 DLLMNDHSNEFNN------ELKEALEKELKERFEDELQAARKKAFEEGKQQATMKTTLLE 1646

Query: 1658 SKIAKLEGQ---------------PNKINLNNSVPS--KIP---------IDNNNN---- 1687
             KI KLE Q               P +    NS PS  KIP           N+NN    
Sbjct: 1647 RKIQKLESQIQEKEKDSEETQDVKPEE----NSTPSVKKIPETLNSSDTSFGNSNNVKVL 1702

Query: 1688 --SSPQGAQPI---------AIKPSPFQVAFGKAMENTSFG 1717
              SSP GA               P  F  AF    ++   G
Sbjct: 1703 KPSSPFGATSAFNNPFTFNNNGNPPAFASAFAPTFKDLMSG 1743

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/1759 (32%), Positives = 955/1759 (54%), Gaps = 97/1759 (5%)

Query: 12   SVDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQK 71
            S   +KVA+FL+     VQ LDE+++     + +EF+ ++ + +++S  ++  K      
Sbjct: 18   SATIAKVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVTKKTNNTT 77

Query: 72   INTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEII 131
            I   K ++ +L+    S  +EK+    +  +   +K     E+     Q+   ++ +  +
Sbjct: 78   IKKLKNELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQIHSLEENVSEL 137

Query: 132  ASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEI 191
             S KQ++ K L+++I++L   +   + L     + R   + LE   Q  K  +L +++++
Sbjct: 138  QSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQL 197

Query: 192  QRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANN 251
            +RL QEL  +     WL + L  K EQ +S+REK+ +E Q+   Q+N++K++L+  ++ N
Sbjct: 198  ERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTN 257

Query: 252  STLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDL 311
              L+ +T ELSN+L++     K +    N +K    +E++LKQ+LI +L+SQ++ ++ + 
Sbjct: 258  CVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQREN 317

Query: 312  ENAYQSANQNGMSTPEKDQ-LLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAV 370
             N       +  S+  KD     E+ D K  L   Q  N++LE  + +      ++  AV
Sbjct: 318  GNELSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRK-----SEDYTAV 372

Query: 371  INSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILN 430
             NS    TS D   +++ K   DI +LKK+L  E+ Q+E  +  +E F+ +LE ++P L 
Sbjct: 373  SNS----TSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLE 428

Query: 431  SFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAH 490
            +++ R    E EL + TLLLE   K++   + ELNQ +++I + E ++  +  QRSDLA+
Sbjct: 429  AYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLAN 488

Query: 491  QVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEA--PKSDTQGIISERLVQFKSVIE 548
            Q+Q+ L+  SV +D+ GPLT++EV+F++ II  +DE    ++DTQ +ISERL +FK +IE
Sbjct: 489  QLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIE 548

Query: 549  LQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLK 608
            LQ KN ELL T R+LA KLE+E+K  +     +E +T+ EAKEAIL+LQ +   L  ++ 
Sbjct: 549  LQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKIA 608

Query: 609  IVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEH---IMELEKRLKNLAEQSQDNIKLL 665
             ++KE + +K+ ++       A     + ++  EH   + ELE R+ ++ ++S++N  +L
Sbjct: 609  ALTKELETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANIL 668

Query: 666  NDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVL 725
            ND+I AL +  + +++ L +E+S+K LAEERLKL+Q ++ +T  EN  L KR + L+ V+
Sbjct: 669  NDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVV 728

Query: 726  LKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSK 785
            ++QD++T  TI+ +I T+S+L+ + +K  +  +E   L   E  LKNE   L +E  + K
Sbjct: 729  VEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMK 788

Query: 786  ILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVS---DT 842
            +LV++LQTLQ ER+ LL   Q  + K +  LE   ++ R+ L    +E EE   S   +T
Sbjct: 789  LLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKL----KEAEENYGSLMEET 844

Query: 843  SQYKW-FQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLA 901
            ++ K  F+ K  SL E++ N  K   E        +     LT +L+E     + Y   +
Sbjct: 845  TELKDDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYKAAS 904

Query: 902  NADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRK 961
            + +   ++I +L+K L+     L ++YSQ E Y+   ++  QS  +I+K +   +A +++
Sbjct: 905  DDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKE 964

Query: 962  NIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDE 1021
             I  +E  + ++ D   +L  QI DLN+EL+ QK   + EK    +  + L+   + L++
Sbjct: 965  RITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQ 1024

Query: 1022 LKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEG 1081
             K +YE+K+  L +DL +Q  YAN+AQ NYEQELQ HA+V+KTIS LRE++Q Y++E+  
Sbjct: 1025 SKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAE 1084

Query: 1082 FKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXX 1141
               SA++AK  L  N+ SW +Q  + E Q+   ++R EE + QN++L++Q +L       
Sbjct: 1085 LTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQANDE 1144

Query: 1142 XXXXXXXXXX--XXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEF 1199
                            L+++LR ERD+L+ +L+V+  EEK+LR+RL   + +     LE 
Sbjct: 1145 DNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLEL 1204

Query: 1200 SKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXX 1259
             K +    +     E  + +M +L QL+LLRESN+TLRNE+ +   ++QH Q E+     
Sbjct: 1205 QKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHD 1264

Query: 1260 XXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVT 1319
                        T  I E+D+Q+S+  EES RWKQRSQDIL KY+RIDPVEH+ LA+E  
Sbjct: 1265 KLLPLETELQTLTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERN 1324

Query: 1320 XXXXXXXXXXXXXXXXQERFRKLRKQANERL--------------DEFKAAKAKVESEFE 1365
                              RF KL+KQA+E+L              ++ +A K ++ S+ E
Sbjct: 1325 RLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLE 1384

Query: 1366 AVSIAKAQLEAELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEELEE-------LRANFI 1418
                 K  LE  L  T+                   +  S++ +LEE           FI
Sbjct: 1385 TEKEGKLSLEKRLEVTM---------------KNSHDIVSIQSQLEEALMKSKDFETKFI 1429

Query: 1419 EANEAVADIKAEAASSEKDLKNQIQELTEKIKTLESEIEHSELEAKNS------NDSPDF 1472
             + E+   I       E++L ++I++L E+   L+ E+ H +L    +       D+ D 
Sbjct: 1430 NSVESSKQI-------EENLNSEIKKLQEESSKLQEELAHEKLTTSTTEIGNVDQDTVDG 1482

Query: 1473 A---PIVENMKKKFEEEKQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTP 1529
                 IVE+MK+ FEEEK   I+E+  E + K                        E+  
Sbjct: 1483 GVSNDIVESMKQSFEEEKIKFIEEQTTEFKKK------------LQAEINKLKAEYETKQ 1530

Query: 1530 NAPL-IDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQE 1588
              P+ IDE  ++ ++E EYE+ T +RI+EAEE LK+RIRLP+EE+IN+VI++R+  L+ E
Sbjct: 1531 IEPVSIDENAIRKQIEEEYEQATSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENE 1590

Query: 1589 FELRVRARALELFKENPESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQ 1648
            F+ +V ARA EL   + ++   D  K  KE QEE+ +   K++E+L +V+KKAF+EG+QQ
Sbjct: 1591 FQNKVEARAKELLTGDEKNEFFDRMK--KEIQEELAR---KYEEELQVVKKKAFDEGRQQ 1645

Query: 1649 LVMKVKLLESKIAKLEGQPNKINLNNSVPSKIPIDNNNNSSPQGA--QPIAIKPSPFQVA 1706
            ++MK   LE KI KLE        N        +  +N +  +G+  +P+ I  +     
Sbjct: 1646 VLMKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTDNETKYEGSDKKPVTINTNVVSDV 1705

Query: 1707 FGKAMENTSFGSFKGSLLD 1725
                 E T    F  ++++
Sbjct: 1706 GENNAERTPMNKFPRAIMN 1724

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  440 bits (1132), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 518/1813 (28%), Positives = 874/1813 (48%), Gaps = 223/1813 (12%)

Query: 17   KVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFK 76
            K++ +L V    +Q ++ S++     + ++F + + +  RL++ ID +K  +  +I+   
Sbjct: 4    KISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKLN 63

Query: 77   EQVEKLLSDVASRQQEKQQTEDEKLK--LMNEKAQLSMEVLKLRSQVEEAKQGMEIIASA 134
            E    LL + +S ++   + E  +L   L NE+++ + ++  L  Q          + ++
Sbjct: 64   E----LLGE-SSEEKNVSKKELSRLHNLLKNERSKCARKIDALNKQ----------LNAS 108

Query: 135  KQDVTKLLEEKISDLAASKEESDRLLAA--------------NKELRKSSIDLEFIIQGY 180
            K  +TKL +E+       KEE++ L A               NK LR+  +++E I+Q  
Sbjct: 109  KNTITKLNDER-----GVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTC 163

Query: 181  KSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFR-EKT-------NSELQN 232
            KS  L  K +   + QE  L+  N  W+ ++L        SFR EKT        S +QN
Sbjct: 164  KSNTLSLKLKYDTVVQEKELILENKKWMEEQL--------SFRDEKTLVDDVTRTSHVQN 215

Query: 233  GYEQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSL 292
              EQ+N  ++  E    NN  L A+  +LS+ +++K++E K L D +N EK +F++EM+L
Sbjct: 216  LEEQLNRTQNDYESVSTNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTL 275

Query: 293  KQRLIDLLESQVSSMKSDLE-NAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIK 351
            ++ + DLL SQ++S + +   +A +  N +     +   ++D+LIDTK  LE ++ E  +
Sbjct: 276  QKNMNDLLRSQLTSFEKNYSLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQR 335

Query: 352  LEATVNELLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEEL 411
            L+  V + +    ++  A  N++  D S       V K+  DI  LK+QL++ER QK +L
Sbjct: 336  LQNIVADCIE---EDEAAFDNTHNVDPS-------VNKVFSDIKALKRQLIKERNQKFQL 385

Query: 412  QNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLE--STAKQRDQKTIELNQYKN 469
            QNQ+ESF+ ELE K P L SFKERT+ LE+EL + T LLE  S AK++D+K  EL   + 
Sbjct: 386  QNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEK--ELTSLRQ 443

Query: 470  KINNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPK 529
            KINN E+ + SL+ QR DLA QV+ LL+ +S       PL+  E+  +K+++ S D   +
Sbjct: 444  KINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNE 503

Query: 530  SDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEA 589
             D+Q II+ERLV+F +  ELQ KN ELLN +R LADKLE+ E K    L  +E QT+KEA
Sbjct: 504  KDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEA 563

Query: 590  KEAILSLQEHVQR-LEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELE 648
            K+AI+ L EHV   LE ++ I+S+ERD++KL  SAN     A ++        + I ELE
Sbjct: 564  KDAIIEL-EHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAANLKKIKELE 622

Query: 649  KRLKNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTK 708
              L     ++   ++ LN E+    K++S   + L++  + KVLA E+  L+Q+      
Sbjct: 623  SELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEKENLLQT------ 676

Query: 709  EENLELHKRSDDLQRVLLKQDEKTQSTIDEIIAT-KSQLSNLTSKLAILTSERDFLRKIE 767
                    R DDL+  L KQ     S+I   I + +++LS   +K   L  E   L K  
Sbjct: 677  --------RIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKN 728

Query: 768  AELKNENEALT-------KENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDL 820
             +L+   E+LT       KE    ++ +++ +T   E+ +  +  Q  Y   I+ LE + 
Sbjct: 729  TDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNC 788

Query: 821  HETREHLVRRTREYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHA 880
             E    L  + +E E  + S  SQ KW Q  +D   + + +    L EK  +I  L L  
Sbjct: 789  EELNNRLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEM 848

Query: 881  KSLTAKLEEAELRTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKV 940
            K L  +L++ +L+   Y +L N+ D       L+K LE++ I+L DA+SQIE Y+ +   
Sbjct: 849  KDLEIELQKTKLQ---YKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYEEIIST 905

Query: 941  SEQSAVEISKALEESQANYRKNIALLEQERKSLTDQIALLN---DQIKDLNSELDHQKSQ 997
             E +  E++  L +++   +     L++E  +  ++I+ L    D+I+ L  +L     +
Sbjct: 906  DENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLKEGALR 965

Query: 998  --NQSEKSELIKKLSILQGSQRSLDELKSEYEEKISKLQEDL-TQQASYANQAQKNYEQE 1054
               QSEK  L  +   +Q     +D++ +     I +L +++ T Q          Y+ +
Sbjct: 966  LVQQSEK--LGNQTQRIQAMNEKIDKMTT-----IVELHQEVETSQ----------YQAK 1008

Query: 1055 LQKHADVTKTISLLREESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLA 1114
            L+ + D++  +  L  E   Y++E++  K S    +  L+++E+ W ++ AD E +L   
Sbjct: 1009 LKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISN 1068

Query: 1115 QQRTEELNTQNRLLYDQVELLXXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVS 1174
             ++TE L  +N  L ++++                      L  +LR ER+ LETKL   
Sbjct: 1069 IEQTESLRVENSALVEKID-----DGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTC 1123

Query: 1175 IREEKILRQR---LGLAKTELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRE 1231
             R+  + +Q+   L  +  +++   L   K    + D I   +  E IM+++ Q+N+L+E
Sbjct: 1124 KRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDII---DEFEDIMKEIAQVNILKE 1180

Query: 1232 SNVTLRNESKKYLEQSQHFQNEIAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESSR 1291
            +N  L+   KK  E+++    E                     +S    ++ + + E  +
Sbjct: 1181 NNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQ 1240

Query: 1292 WKQRSQDILHKYERIDPVEHQKLADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLD 1351
            WKQR  ++  + +     E +KL +E++                 ++F +L+KQA+E+LD
Sbjct: 1241 WKQRYDNLSQQQKETHKDETEKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLD 1300

Query: 1352 EFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEELE 1411
              K  +  + +E + +   K +LE  L     KV                       ELE
Sbjct: 1301 ASKKQQTALTNEVDELKDMKNELEESLHSEESKVL----------------------ELE 1338

Query: 1412 -ELRANFIEANEAVADIKAEAASSEKDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSP 1470
             +L+ + ++A E V+  + E  S         + L E+I+ L+ E++      K ++DS 
Sbjct: 1339 AKLKKHLVQA-EGVSKDQEEDTS---------KPLMEEIELLKRELQV----FKETSDSS 1384

Query: 1471 DFAPIVENMKKKFEEEKQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPN 1530
            D    +E MK+  E EK  +I+EK  E   K                       +E+  N
Sbjct: 1385 D---TIEKMKEIMEAEKNKIIEEKTTEFERK-----------LEEATGKNTGATIENGEN 1430

Query: 1531 APLIDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFE 1590
                  E LK +   +YE++T+ RI+EAEE LKKRIRLPSEERI ++I +R+  L+QEF+
Sbjct: 1431 M-----EELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQ 1485

Query: 1591 LRVRARALELFKENPESFVGDTAKLIKEHQEEMDKLEA-------KFDEQLALVRKKAFE 1643
             +++A        N  SF   + K   E   E D   +       K      L+R+K   
Sbjct: 1486 RKLKA--------NSGSFTLSSDKKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQK--- 1534

Query: 1644 EGKQQLVMKVKLLESK--IAKLEGQPNKINLNNSVPSKIPIDNNNNSSPQGAQPIAIKPS 1701
                 L+++ +L   K  I   + +P   N  N +P     +N    +    +P+   PS
Sbjct: 1535 ----NLILQEQLKNPKKGIISNDSRPTSSNKENDIPGSTTAENKAPLAFNFGKPLF--PS 1588

Query: 1702 ------PFQVAFGKAMENTSFGSFKGSLLDSKQFIA--NTADTSTSTLTGNVGTNTNKRQ 1753
                   FQ  F  A   TSF +    + + K  +A   T DT  +    + GTN  K  
Sbjct: 1589 NTSSFQSFQNPFTPAA--TSFNTGVSPVFNIKPALAVDATVDTFKTPGLNDAGTNEAKII 1646

Query: 1754 SEDELAQSPEKRP 1766
               E+  +  KRP
Sbjct: 1647 ---EIGNNSLKRP 1656

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  431 bits (1107), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 365/1208 (30%), Positives = 657/1208 (54%), Gaps = 39/1208 (3%)

Query: 185  LREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQL 244
            +RE SEIQRL QE+  +  N   LS++   + E+ N  +      L N   ++    + L
Sbjct: 165  IRE-SEIQRLKQEVTFLNENKSSLSEQWLKEKEEFNKAKLLLEKNLNNSTIKLEEATTTL 223

Query: 245  EFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQV 304
            +   A  S L  K  +L+ + +  + E K L D L   K++  +E+++K +LIDLL+ Q+
Sbjct: 224  KSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQL 283

Query: 305  SSMKSDLENAYQSANQNGMSTPE----KDQLLDELIDTKKNLEATQAENIKLEATVNELL 360
            SS + +L    +  N      P+     + L  ++ D    +E  Q EN  L + +N++ 
Sbjct: 284  SSTQEELRQNVE-LNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNLNSMINQMS 342

Query: 361  SVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVV 420
            +    +  +            S  S +P L   I +LKKQ+ QE+ +K+ LQ Q+ESF++
Sbjct: 343  NEQNNSNNSS-----------SIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFII 391

Query: 421  ELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCS 480
            ELE+KIPI++SF+E+   LE EL ++TLLL  T+ +++    +LN Y +K+  Y+S +  
Sbjct: 392  ELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKE 451

Query: 481  LIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSD--TQGIISE 538
            LI QR DLA+QV++LL+ ++V++D+ GPLT +E+EF+ +I ++ ++   S+  +Q +ISE
Sbjct: 452  LIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISE 511

Query: 539  RLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQE 598
            RLV F ++ ELQ+KN ELLN+IR L++ LE+ E  +    K  + +T+ +AKEAIL+LQ 
Sbjct: 512  RLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSH--KEFQNKTIADAKEAILTLQY 569

Query: 599  HVQRLEDQLKIVSKERDAFKLANSANKQGDSAP-----SSTYQSKKLDEHIMELEKRLKN 653
            H   LE ++K++  ERD+FKL  + N   DS+      SS+   +  ++ I +L+  ++ 
Sbjct: 570  HNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEE 629

Query: 654  LAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLE 713
            L  + + N   L  +I +    KS +T+ LE+E+SS  L  E++ L +S   + K EN E
Sbjct: 630  LKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKE 689

Query: 714  LHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNE 773
            L+KR ++LQ +++KQ+ K    I++ I  ++++SNL ++L+I  SE+DFL K +  L +E
Sbjct: 690  LNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSE 749

Query: 774  NEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTRE 833
                ++E    +I++SQLQ+LQ ER  LL++ Q  +   I +LE++  +  ++L  +  E
Sbjct: 750  LIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTE 809

Query: 834  YEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELR 893
             ++  +S+ SQ  W+Q  +D L +++++A KT     NS+         L  K+E   L 
Sbjct: 810  IQKLSISNESQCTWYQNTIDDL-KKINSAIKTELTSKNSL------ISDLNTKIE--LLE 860

Query: 894  TQSYSVLAN--ADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKA 951
            +QSY++  N       +    + K+L+   ++L++AY+Q+E+YK +   +E+S   +   
Sbjct: 861  SQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLESN 920

Query: 952  LEESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSI 1011
             E  +      I+ L  E ++L       + +I +L+++L ++K++   E ++L  +++ 
Sbjct: 921  FESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITR 980

Query: 1012 LQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREE 1071
            L   ++   +  SEYEEKISKLQ  L  +A +A+ AQ+ YE  L K     ++I   +E+
Sbjct: 981  LNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQ 1040

Query: 1072 SQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQ 1131
             +K    +   +    +  S L  NE  W ++     S L  ++++ + L  QN+L  DQ
Sbjct: 1041 IEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQ 1100

Query: 1132 VELLXXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTE 1191
            +ELL                    +   LR +RD+LETKL ++ R+ K    +L   + E
Sbjct: 1101 LELL--NKDFSSMDSSQLSSETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDE 1158

Query: 1192 LENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQ 1251
            L NV+++   ++          E+ E+I+ +LNQ+ L +ESN TLRN+  +  E+++  Q
Sbjct: 1159 LANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQ 1218

Query: 1252 NEIAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEH 1311
             ++                   ++ +++  I L+KEES++W+ R++++  + +++D    
Sbjct: 1219 TKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSV 1278

Query: 1312 QKLADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAK 1371
             KL+ E+                 +ERF  L+KQA+ERL+  K  ++ +  +   +  + 
Sbjct: 1279 SKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASN 1338

Query: 1372 AQLEAELA 1379
              +E  L+
Sbjct: 1339 TNIELALS 1346

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  426 bits (1095), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 491/1794 (27%), Positives = 873/1794 (48%), Gaps = 163/1794 (9%)

Query: 17   KVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFK 76
            K++ FL V    ++ +  S +   + K  EF + + +  +L++ +D +K  +  +I+   
Sbjct: 4    KISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLT 63

Query: 77   EQV-----EKLL-SDVASRQQ----EKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQ 126
            + +     EK++ S V +R Q    E++     K+  +N++   S E +K     E AK+
Sbjct: 64   KLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEGAKE 123

Query: 127  GMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELR 186
                 AS+ QD        + +  ++K   D+    NK L++  +++E I+Q  KS  + 
Sbjct: 124  E----ASSWQD-------GLRNDDSTKHVLDK---ENKLLQRKLLEMENILQVCKSNAVS 169

Query: 187  EKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEF 246
             + +     QE  L   N  W  + L S N++         S LQN  E++N  +++ E 
Sbjct: 170  LQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENES 229

Query: 247  ARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSS 306
                N  L  +  +LS+ ++EKL+E K L D  NTEK EF++EM+L++++ DLL SQ++S
Sbjct: 230  VSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTS 289

Query: 307  M-KSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGK 365
              +       +  +      PE   + +ELID K  LE ++ E   L+  V++ +  NG 
Sbjct: 290  FERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENG- 348

Query: 366  NGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHK 425
                 +N+N +         TV KL  +I  LK+QLV+ER QK ++QNQ++ FV+ELEHK
Sbjct: 349  ---TTVNTNTA-------APTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHK 398

Query: 426  IPILNSFKERTDMLERELNDVTLLLE--STAKQRDQKTIELNQYKNKINNYESQVCSLIV 483
             P L SFKERT++LE EL   T LLE  S AK++D+K  +L   + KIN+YE+ + SL+ 
Sbjct: 399  TPALVSFKERTELLEHELKCSTELLETMSLAKRKDEK--KLTSLEQKINSYEANIHSLVR 456

Query: 484  QRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQF 543
            QR DLA QV+ LL  +S       PL+  E+  +++++ SE+   + D+Q II+E+LV+F
Sbjct: 457  QRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEF 516

Query: 544  KSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRL 603
            K++ ELQ KN ELL+ IR LADKLE  E ++   +  +E QT+KEAKEAI+ ++    +L
Sbjct: 517  KNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKL 576

Query: 604  EDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIK 663
              ++ I+++ERD++KL  SAN     A +        ++ I EL+ +L +   +S   I+
Sbjct: 577  ALRVNILTRERDSYKLLASANDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQ 636

Query: 664  LLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQR 723
             LN ++    K++++  + L++  + KVL  E+  ++Q  ++  K    +L K+   L  
Sbjct: 637  NLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLK---TQLEKQR--LSA 691

Query: 724  VLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTT 783
                QD K  S + ++  +++++ +L  +++ L  E   L  ++  L  + E   KE   
Sbjct: 692  APPVQDYKY-SNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQ 750

Query: 784  SKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTS 843
              + +S+ +T   E++++    +  Y   I+ LE +L E    L  + +E +  + S  S
Sbjct: 751  LHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNS 810

Query: 844  QYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANA 903
            Q KW Q  +D   + L +    L  K  +I  L L  ++L  +L   +L+   Y  L+N 
Sbjct: 811  QLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQ---YKFLSNT 867

Query: 904  DDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNI 963
             D      TLRK L++  I L DA+SQI+ Y+ +   +E    E++  L++++ +    I
Sbjct: 868  SDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKI 927

Query: 964  ALLEQERKSLTDQIALLN---DQIKDLNSELDHQKSQ--NQSEKSELIKKLSILQGSQRS 1018
             L  +E+ +  ++++ L    D+I+ L  +L    S    QSEK        +   +QR 
Sbjct: 928  QLENKEKGAKEEELSHLRKELDEIRCLQPKLREGASYLVLQSEK--------VGDQAQR- 978

Query: 1019 LDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSE 1078
            + E+K+    KI K+   +    +Y  +    Y+ EL+ + D+++ +  L +E+  Y++E
Sbjct: 979  IQEMKN----KIDKMAAII---EAYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTE 1031

Query: 1079 MEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXX 1138
            ++  K+S    +  L+R+E+ W ++ AD E +L    ++TE L  +N +L ++++     
Sbjct: 1032 LKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKID----- 1086

Query: 1139 XXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRL- 1197
                             L   LR ER  LETKL    R+  +LRQ+    +  + +++  
Sbjct: 1087 GATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRA 1146

Query: 1198 -EFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAX 1256
                + +   P  I   +  E+I++++ Q+N+LRE+N  L    K   E+++    E+  
Sbjct: 1147 NTVPRNKVQCPAVII--DEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELIN 1204

Query: 1257 XXXXXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLAD 1316
                              +S    ++   + E  + KQR QD+  + +     E +KL +
Sbjct: 1205 MQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHN 1264

Query: 1317 EVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEA 1376
             +                 + +F +L+KQA+E+LD  K  +  + +E   +   K +LE 
Sbjct: 1265 VIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEE 1324

Query: 1377 ELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEELE-ELRANFIEANEAVADIKAEAASSE 1435
             L     KV                       +LE +L+ + ++  E   D  + A    
Sbjct: 1325 NLHNEESKVV----------------------DLELKLKEHGLQVGEVSKDHDSIA---- 1358

Query: 1436 KDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSPD-FAPIVENMKKKFEEEKQVLIQEK 1494
                   +   E+I++L+ E++      +N+ND+ D F  I  NM    EEEK  +I EK
Sbjct: 1359 ------FKPFVEEIESLKKELQV----FRNANDASDAFEKIKNNM----EEEKNKIIDEK 1404

Query: 1495 DEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSKLEAEYEKKTLER 1554
             ++   K                       VE++ +   + +E LK     EYE++T++R
Sbjct: 1405 TKDFEKK---------LQDAVNKSKSNESEVENSEHIEALKKEWLK-----EYEEETVKR 1450

Query: 1555 IREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAK 1614
            I+EAEE LKKRIRLPSEERI ++I +R+  L+QEFE ++        KEN +S V   + 
Sbjct: 1451 IKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKL--------KENNKSLVFSGSN 1502

Query: 1615 LIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNN 1674
              +E ++E+    +K   +   V     ++   +L  ++K +++ +   + +P   N  N
Sbjct: 1503 E-EEAEDELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSENKEN 1561

Query: 1675 SVPSKIPIDNNNNSSPQGAQPI-AIKPSPFQVAFGKAMENTSFGSFKGSLLDSKQFIANT 1733
            ++P     DN   S+    +P+ +   S FQ        + +  S  GSL       A  
Sbjct: 1562 NIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNIKSAFA 1621

Query: 1734 ADTSTSTL----TGNVG---------TNTNKRQSEDELAQSPEKR-----PKDD 1769
            A T+ +TL      NVG          NT+KR  + + +  P+ +     P++D
Sbjct: 1622 AGTAGNTLKTSDPANVGINEAKVMEIGNTSKRPIQSDTSSDPDSKKFKESPEND 1675

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  411 bits (1057), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 491/1772 (27%), Positives = 870/1772 (49%), Gaps = 185/1772 (10%)

Query: 56   RLSISIDGLKCNFEQKINTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQ------ 109
            RL+ +ID  K     + +T K  +E L  +     Q+K+Q E + ++   + AQ      
Sbjct: 42   RLNATIDNFKSKMSSQFDTVKNDLELLQKEKELLIQDKKQLESKCIQWEQQYAQHQDISK 101

Query: 110  ---LSMEVLKLRSQVEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKEL 166
                S +V+K   + E  K+  +++ S   +++K    K+S   A+ E+      A  EL
Sbjct: 102  TDLASDDVIK---ENETFKRDHQLLTSDLMNLSK----KLSSCDAALEKKS---TAYLEL 151

Query: 167  RKSSIDLEFIIQGYKSQELREKSEIQR-------LHQELNLVKSNADWLSKELESKNEQL 219
            +  +ID+   +  +KS+    KS+ +R       L    + +K+  +   KEL   + + 
Sbjct: 152  QNDNIDIRTQLNNFKSETKGLKSKYERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKF 211

Query: 220  NSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVL 279
             + +  +++EL+N  + ++SL+ Q E     N   K +  EL+  + ++L + K L + L
Sbjct: 212  YTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLENDL 271

Query: 280  NTEKEEFTREMSLKQRLIDLLESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTK 339
            N  KE FTREM+L Q   DLL+  +  +K+  +         G ST EKD+LL EL+D K
Sbjct: 272  NELKESFTREMTLTQHENDLLKEHIEYLKNTTKETT-----GGTSTLEKDRLLHELVDIK 326

Query: 340  KNLEATQAENIKLEATVNELLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKK 399
            K+LE ++ EN+ L   + + L+ N ++         SD               ++ +LK+
Sbjct: 327  KSLEKSELENVHLNDFIEQYLTENEES--------TSD--------------NELVLLKE 364

Query: 400  QLVQERRQKEELQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQ 459
            QL++E+RQK+ LQ QVE FV+ELE+++P +NS K+R   LE+EL  +T LLE T ++ D 
Sbjct: 365  QLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDI 424

Query: 460  KTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKR 519
            +  EL     ++      +  L+ QR DLAHQVQ+LL+ L ++      LT  E+ F+++
Sbjct: 425  RIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRK 484

Query: 520  IISSEDEAPKSDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLK 579
            II S +    SD+Q IISERLV+F  +  LQ +N ELL T R LA++LE  +       K
Sbjct: 485  IIKSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSD------TK 538

Query: 580  SVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSK- 638
            SV+  T  E+KE I  LQE +  L  +L+ + KE+DA+KL +  N  G+  P+   +S+ 
Sbjct: 539  SVQKITRNESKEKIAKLQESINGLTSKLEKLQKEKDAYKLLSLQN-TGEQTPTEELRSQL 597

Query: 639  -KLDEHIMELEKRLKNL-AEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEER 696
             K +E + +LE R+ +L +  +++  K+LN  I  L K K ++   + +E S + +AE++
Sbjct: 598  QKKEEQLTKLE-RMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKK 656

Query: 697  LKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEIIA--TKSQLSNLTS--K 752
             K+++ +L L       LHK+ D    + +K+ E  ++ +++  A   K    N T+  K
Sbjct: 657  SKMLEDSLEL-------LHKKYD----LAVKKYEHYETLLNDHNAENIKHSRENETTQAK 705

Query: 753  LAILTSERDFLRKIEAELKNENEALTKENTTSKI---------LVSQLQTLQRE---RDI 800
            ++IL  E +  ++   +   +NE     NT SK+         L S+L T++ E   +  
Sbjct: 706  ISILQKEIESYKQNLLQYSKDNE-----NTLSKLAAATQEKETLGSRLSTVKNELEQKIN 760

Query: 801  LLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQYKWFQAKVDSLNEQLD 860
            L++E +T Y+++    E  L +++  L  + +E ++      SQ  W+Q ++DSL    D
Sbjct: 761  LMQERETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTND 820

Query: 861  NARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITDKIETLRKNLEKA 920
              +  L ++   I   +L    L   L +    T   S L   D          ++ EK 
Sbjct: 821  KLQVELNKELTKINIQRLKISDLEKTLSQ---NTNGSSSLPRVD----------QDFEKL 867

Query: 921  NINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQERK-SLTDQIAL 979
               L +   +I QY+ +  ++E++   + K L     N ++ I     E K  L  Q+A 
Sbjct: 868  KNELKEKQLEINQYRDLLNLAEETKNRLQKDL-----NKQRQIVDDAMEGKEQLDQQLAE 922

Query: 980  LNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEEKISKLQEDLTQ 1039
            L  +   +NS L  QK++ + ++  +  K +  +  + SL    S  E KI+ L+ ++ +
Sbjct: 923  LTQECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKNSL----SSLENKITTLENEMVE 978

Query: 1040 QASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASEAKSALERNEQS 1099
            +     + +  Y+++L K ++ +  I  +  E++ YK+ ++G K + +  + A+    Q 
Sbjct: 979  KTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQK 1038

Query: 1100 WCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXXXXXXXXXX----XXXXXX 1155
               +  + E Q+   ++  + LN Q  +   +   +                        
Sbjct: 1039 LLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNE 1098

Query: 1156 LIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQATAPDSIFARES 1215
            LI+ LRRERD L+ KLD+S RE   LR+++   K  L+  R  F   ++     +   E 
Sbjct: 1099 LILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQ 1158

Query: 1216 QEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXXXXXXXXXXXXXTITI 1275
             ++ +++LN+LN L+E+N  L+ + ++  +++     ++                   +I
Sbjct: 1159 HKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSI 1218

Query: 1276 SERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTXXXXXXXXXXXXXXXX 1335
             E+DQQ++LL EE+ RWK RS++IL K +++D  EH KL +E++                
Sbjct: 1219 MEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNEDL 1278

Query: 1336 QERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVXXXXXXXXXX 1395
             +RF +L+KQA+E+LD  KA  A + +E   +  AK++LE +L +   ++          
Sbjct: 1279 NDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQK 1338

Query: 1396 XXXXXGEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKNQIQELTEKIKTLESE 1455
                  +   +   LE+  ++ +E ++ + +   E  +S  +L    ++LTE++ +L+S+
Sbjct: 1339 -----PDNPDVITALEKELSDSVENSKKIEENLQETVNSSLELN---KKLTEEVNSLKSQ 1390

Query: 1456 IEHSELEAKNSNDSPDFAP-------IVENMKKKFEEEKQVLIQEKDEELRMKXXXXXXX 1508
            +E      KN N     A         + ++K+ FE EK  LI      L+ +       
Sbjct: 1391 LET----LKNQNGVISVADGSAINSETIAHLKESFEVEKTELITT----LKEEFKKQLEE 1442

Query: 1509 XXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSKLEAEYEKKTLERIREAEEALKKRIRL 1568
                              +  + P ID E +KS+ E + E+  ++RI +AEE LKKRIRL
Sbjct: 1443 EKKKLLEEKEKEYYDSKPTGGSEP-IDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRL 1501

Query: 1569 PSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLIKEHQEEMDK-LE 1627
            PSEE+IN+VIE+R++ L++E+E +++ + L            +TA + +E ++E+++ L 
Sbjct: 1502 PSEEKINRVIEKRRKELEEEYEKKLKRQGL----------TTETA-IEEELRKEVERELR 1550

Query: 1628 AKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSKIP-IDNNN 1686
             KFD +LA V+KKAF EGKQQ  MK  LLE K++KLE Q +        PS+ P ++++ 
Sbjct: 1551 VKFDNELAEVKKKAFLEGKQQSQMKTTLLERKLSKLESQAS--------PSRTPDLESSQ 1602

Query: 1687 NSSPQGAQPIAIKPS-----PF-----------QVAFGKAMENTSFGSFKGSLLDSKQFI 1730
              + +GA    + PS     PF           QV  G+ +   +  S + S   S  F 
Sbjct: 1603 KENTEGATKTTLGPSKINLLPFSMSNTDDSIEKQVPQGEKVLQINRRSLEPSFGSSNPFT 1662

Query: 1731 ANTADTSTSTLTGNVGTNTNKRQSEDELAQSP 1762
              T +        N  + T K+Q    + +SP
Sbjct: 1663 LPTQNKPAFLFASNNHSQT-KKQDGLPINKSP 1693

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  390 bits (1002), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 439/1611 (27%), Positives = 790/1611 (49%), Gaps = 148/1611 (9%)

Query: 17   KVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFK 76
            K++ FL V    +Q +   ++   + K  +F + + +  +L++ +D +K  +  +I+  K
Sbjct: 4    KISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLK 63

Query: 77   EQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAKQ 136
            +     L D +S   E++ T  E+L  +  K QL+ E  + R +++  K+ + +   A +
Sbjct: 64   Q-----LLDESS---EQKNTAKEELNGL--KDQLNEERSRYRREIDALKKQLHVSHEAMR 113

Query: 137  DVT--KLLEEKISDLAASKEES-----DRLLAANKELRKSSIDLEFIIQGYKSQELREKS 189
            +V   K ++E+  D+  S+++      D L   NK LR+  +++E I+Q  KS  +  + 
Sbjct: 114  EVNDEKRVKEEY-DIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQL 172

Query: 190  EIQRLHQELNLVKSNADWLSKELESKN---EQLNSFREKT-------NSELQNGYEQVNS 239
            +     QE  L+          L+SK    E+L+SF +KT       +S ++N  E++  
Sbjct: 173  KYDTSVQEKELM----------LQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQ 222

Query: 240  LKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDL 299
            ++S  E     N  L  +  +LS  ++EK++E K L D  + EK EF++EM+L++ + DL
Sbjct: 223  MQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDL 282

Query: 300  LESQVSSMKSDLE-NAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNE 358
            L SQ++S++ D    A +  + N    PE   ++DELIDTK  LE ++ E  +L+  V  
Sbjct: 283  LRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIV-- 340

Query: 359  LLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESF 418
             +    +    +  S VS         TV KL  DI +LK+QL++ER QK +LQNQ+E F
Sbjct: 341  -MDCTKEEEATMTTSAVS--------PTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDF 391

Query: 419  VVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQV 478
            ++ELEHK P L SFKERT  LE EL   T LLE+ +  + ++  E+   + KIN  E+ +
Sbjct: 392  ILELEHKTPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANI 451

Query: 479  CSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISE 538
             SL+ QR DLA QV+ LL+  S   +   PL++ E+  +++I+ S +   ++D+Q II+E
Sbjct: 452  HSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITE 511

Query: 539  RLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQE 598
            RLV+F +V ELQ KN ELLN IR LADKLE+ E K    L+ VE QT+KEAK+AI+ L+ 
Sbjct: 512  RLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELEN 571

Query: 599  HVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQS 658
               ++E ++ I+ +ERD++KL  S  +   +  S T      ++ I ELE  L +   ++
Sbjct: 572  INAKMETRINILLRERDSYKLLASTEENKANTNSVTSMEAAREKKIRELEAELSSTKVEN 631

Query: 659  QDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRS 718
               I+ L  E+    K++ +    LE   + K LA+E+ ++++  +   K    EL K+ 
Sbjct: 632  SAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLK---AELEKQK 688

Query: 719  DDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALT 778
              +   +  + E+  +   E+  ++ ++ +L  +++ L  E       +  L  + E   
Sbjct: 689  SWVPSYIHVEKERAST---ELSQSRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCC 745

Query: 779  KENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQR 838
            KE    ++ + + +    E  +     +  Y+  I++LE++L   R  L  + +E E  R
Sbjct: 746  KEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIR 805

Query: 839  VSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYS 898
                SQ KW Q  +D    ++ +    L  K  +IE L    ++L  +L + + +   Y 
Sbjct: 806  SCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YK 862

Query: 899  VLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQAN 958
             L    D +    TLRK LE+  + L DA SQI+ Y+ +   +E + +E+   L +++ N
Sbjct: 863  FLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKEN 922

Query: 959  YRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRS 1018
            Y   I L ++E+ +  + ++ L  ++ ++ +     K             L  +Q S++ 
Sbjct: 923  YDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKE----------GALHFVQQSEKL 972

Query: 1019 LDELKSEYEEKISKLQEDLTQQASYANQAQKN----YEQELQKHADVTKTISLLREESQK 1074
             +E+     E+I K+ E + + ++     +K     Y+  ++++ D+++ +  L +++  
Sbjct: 973  RNEV-----ERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAAD 1027

Query: 1075 YKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVEL 1134
             ++E+   K S   A+  L+++E+ W ++ AD E +L    ++TE L  +N +L ++V+ 
Sbjct: 1028 CQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD- 1086

Query: 1135 LXXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELEN 1194
                                 L   LR ER+ LETKL    RE   ++Q+       LE 
Sbjct: 1087 -----DTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQK----NDSLEK 1137

Query: 1195 VRLEFSKTQATA-----PDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQH 1249
               +  +TQ  +       ++   E ++ I +++ Q+N+L+E+N  L+   K   E+++ 
Sbjct: 1138 TINDLQRTQTLSEKEYQCSAVIIDEFKD-ITKEVTQVNILKENNAILQKSLKNVTEKNRE 1196

Query: 1250 FQNEIAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPV 1309
               ++                    +S    +I + + E  + KQR QD+  + +     
Sbjct: 1197 IYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKK 1256

Query: 1310 EHQKLADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSI 1369
            + +KL +E++                + +F +L+KQA+E+LD  K  +A + +E   +  
Sbjct: 1257 DIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKA 1316

Query: 1370 AKAQLEAELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEAVADIKA 1429
             K +LE +L     KV                + D+      +L+A+ +++ +   D   
Sbjct: 1317 IKDKLEQDLHFENAKVI---------------DLDT------KLKAHELQSEDVSRD--- 1352

Query: 1430 EAASSEKDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSPDFAPIVENMKKKFEEEKQV 1489
                 EKD     + L E+I++L+ E++      K +N S D     E +K   E+EK  
Sbjct: 1353 ----HEKDT---YRTLMEEIESLKKELQI----FKTANSSSD---AFEKLKVNMEKEKDR 1398

Query: 1490 LIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSKLEAEYEK 1549
            +I E+ +E   K                                 D ETLK +   EYE 
Sbjct: 1399 IIDERTKEFEKKLQETLNKSTSSEAEYSK----------------DIETLKKEWLKEYED 1442

Query: 1550 KTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALEL 1600
            +TL RI+EAEE LKKRIRLPSEERI ++I +R+  L++EF  +++  A  L
Sbjct: 1443 ETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSL 1493

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  382 bits (980), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 470/1795 (26%), Positives = 855/1795 (47%), Gaps = 204/1795 (11%)

Query: 17   KVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFK 76
            K++ FL V    +Q ++ S++   F K + F   + +  RL++ +D +K  +  +I+   
Sbjct: 4    KISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIS--- 60

Query: 77   EQVEKLLS------DVASRQ---------QEKQQTEDEKLKLMNEKAQLSMEVLKLRSQV 121
             ++ KLL+      ++AS++         Q++++    K+  +N++   S + +K  +  
Sbjct: 61   -KLSKLLNESSEQKNIASKELSHLQDQLMQDRERCR-RKIDALNKQLDSSRDAIKRLNDE 118

Query: 122  EEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYK 181
            ++AK+   I  S  Q+V  +               + L   NK LR+  +++E I+Q  K
Sbjct: 119  KDAKEESMIRQSKHQNVNSV--------------QNVLDKENKLLRRKLMEMENILQICK 164

Query: 182  SQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLK 241
            S  +  + +   + QE  L+  N  W  ++L S N +  +      S ++N  E++   +
Sbjct: 165  SNSVSLQLKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQ 224

Query: 242  SQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLE 301
            +  E A + +  L  +  +LS+ ++EK++E K L D    EK EF++EM+L++ + DLL 
Sbjct: 225  ADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLS 284

Query: 302  SQVSSMKSDLENAYQSANQNGMST-PEKDQLLDELIDTKKNLEATQAENIKLEATVNELL 360
            SQ++S + D  +     + + +   P+ + + DEL++TK   + +Q E  +L+  +++ +
Sbjct: 285  SQLASFERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFV 344

Query: 361  SVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVV 420
              +     A +++N +         TV KL  DI +L+KQL++ER QK +LQNQ+E F++
Sbjct: 345  QEDK----ATVDTNGAS-------HTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFIL 393

Query: 421  ELEHKIPILNSFKERTDMLERELNDVTLLLE--STAKQRDQKTIELNQYKNKINNYESQV 478
            ELEHK P L SFKERT  LE EL   T LLE  S AK++D++  EL   + KIN+ E+ +
Sbjct: 394  ELEHKTPELVSFKERTKSLEHELKRSTELLETISMAKRKDER--ELTSLRQKINSCEANI 451

Query: 479  CSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISE 538
              L+ QR DLA QV+ LL+  S       PL++ ++  +++I+ S  +  ++D Q IISE
Sbjct: 452  HLLVKQRLDLARQVKVLLLNTSAIQKTTLPLSKDDLISLRKILESGSDVNENDAQAIISE 511

Query: 539  RLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQE 598
            RLV+F ++ ELQ KN ELL  IR LADKLE  E K    L  VE QT+KEAK+AI+ L+ 
Sbjct: 512  RLVEFNNINELQEKNVELLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELEN 571

Query: 599  HVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQS 658
               ++E ++ I+ +ERD++KL  S+ +   +  +  +     ++ I ELE  L +   +S
Sbjct: 572  TNMKMESRINILLRERDSYKLLASSKENNVNVNAKNFTEISHEKKIKELEAELSSTKVES 631

Query: 659  QDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRS 718
               I+ L  E+    K   +  +  +   + K+LA+E+  ++++              R 
Sbjct: 632  SAVIQNLRKELTTYKKLLCDKKIASQDFENFKMLAKEKESILET--------------RV 677

Query: 719  DDLQRVLLKQDEKTQSTI-DEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEAL 777
            ++L+  L KQ     S + D  +   ++L    +K  IL  E   L+K  A      E+L
Sbjct: 678  NNLKTDLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHEISSLKKETANSMVLKESL 737

Query: 778  TKE---NTTSKILVSQLQTLQRERDILLEEAQTN-------YRKNIEKLESDLHETREHL 827
            T++       KI   QLQ   +E +I L E + N       Y   I++LE  L   R  L
Sbjct: 738  TRDLERCCKEKI---QLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIEL 794

Query: 828  VRRTREYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKL 887
              + +E +  + S  SQ KW Q  +D   E+L +    L  K  ++ TL    ++L  +L
Sbjct: 795  KSKAQEIKSLQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNEL 854

Query: 888  EEAELRTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVE 947
             E +L+   Y  L N  D +     LRK LE+  + L DA+SQ+  Y+ +   +E++  E
Sbjct: 855  RENKLK---YEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEEIISTNEKALKE 911

Query: 948  ISKALEESQANYRKNIALLEQERKSLTDQIALLN---DQIKDLNSELDHQKSQNQSEKSE 1004
            ++  L   + +Y   I L  +E+ +  ++++LL    D+I+ L  +L             
Sbjct: 912  LNSQLASMKEDYDARIELECKEKLANEEELSLLRRELDEIRSLQPKLKEGTVC------- 964

Query: 1005 LIKKLSILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKT 1064
            L+K+   L+     + E+K+    KI K+  ++     Y  +    ++  ++ + ++++ 
Sbjct: 965  LVKQSEKLRNQAEKIQEMKA----KIDKMNWNV---QVYKKEKTSQFQSIMKANKELSEL 1017

Query: 1065 ISLLREESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQ 1124
            ++ L +E+   + E++  K S  + +  L+ +E+ W ++ AD E +L    ++TE L  +
Sbjct: 1018 VTRLEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVE 1077

Query: 1125 NRLLYDQVELLXXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQR 1184
            N +L +++                           LR ER+ LETKL    R+  +++Q+
Sbjct: 1078 NSVLIEKI-----GSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQK 1132

Query: 1185 LGLAKTELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYL 1244
                +  + +++++   +Q     S    +    I +++ Q+NLL+E+N  L+   K   
Sbjct: 1133 NASLEKNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVT 1192

Query: 1245 EQSQHFQNEIAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYE 1304
            E+++    E+                    +S    +I + + E  + KQR  D+  +  
Sbjct: 1193 EKNREIYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQR 1252

Query: 1305 RIDPVEHQKLADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEF 1364
             +     +KL  E++                + +F +L+KQA+E+LD  K  +  + +E 
Sbjct: 1253 EVQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNEL 1312

Query: 1365 EAVSIAKAQLEAEL----AQTLDKVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEA 1420
            + +   + +LE +L     +T+D                    D+  +E      + +  
Sbjct: 1313 KELKAVRDKLEQDLNSKNFKTVD-------------------LDTEPKEHTVQSGDLLRD 1353

Query: 1421 NEAVADIKAEAASSEKDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSPD-FAPIVENM 1479
             E VA +                 L E+I++L+ E++      KN+N+S D F  + +NM
Sbjct: 1354 QEKVASLP----------------LIEEIESLKRELQV----FKNANNSSDAFEKLRDNM 1393

Query: 1480 KKKFEEEKQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETL 1539
                EEEK  +I E+ +E   K                        +++ N      ETL
Sbjct: 1394 ----EEEKNKIINERTKEFEKK---------LEEIVSKSKSTGKVADNSENI-----ETL 1435

Query: 1540 KSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALE 1599
            K +   EYE++T+ RIREAEE LKKRIRLPSEERI ++I +R+  L++EF+ +++  A  
Sbjct: 1436 KKEWLKEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASS 1495

Query: 1600 LFKENPESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKV--KLLE 1657
            L      +F  D  +   +  E++    +K + +    R     +  +Q  +KV  +L +
Sbjct: 1496 L------TFSCDRKETNDDPDEDLWNSPSKGNSE----RPSVITDFMKQKNIKVQEQLKK 1545

Query: 1658 SKIAKLEGQPNKINLNNSVPSKIPIDNNNNSSPQGAQPIAIKPSPFQVAFGKAM---ENT 1714
            +K     G     ++N    + + ++++  +S                +FGK +     T
Sbjct: 1546 AKNGVFFGDSRSSSMNKENSALVKVNDDKAAST--------------FSFGKPLFPSTTT 1591

Query: 1715 SFGSFKG----SLLDSKQFIA-NTADTSTSTLTGNVGTNTNKRQSEDELA-QSPE 1763
            SF SF+     S +DS   ++  T +  T  L G V T+T+K    D LA  SP+
Sbjct: 1592 SFQSFQNPFTQSTIDSNTGVSLPTFNIRTDLLAG-VATDTSKT---DGLANNSPD 1642

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  345 bits (884), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 444/1664 (26%), Positives = 788/1664 (47%), Gaps = 208/1664 (12%)

Query: 113  EVLKLRSQVEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLL-------AANKE 165
            E L L+S +EE +       S  ++  K LE++I+ LA +++ S  +        A N  
Sbjct: 41   EKLNLKSTIEETE-------STYKNKIKNLEDEINILAKTRDISGPIRITGVEAQAPNNA 93

Query: 166  LRKSSIDLEFI-----IQGYKSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLN 220
               S+I+ E +     ++  KS+ L  +SE +R  ++  LV+ +  WL + L    E+L 
Sbjct: 94   TSISNINDEILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELM 153

Query: 221  SFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLN 280
            + ++++  +++   +++++L+ ++   + NN  L  K  ELS  +QEKL+E K+ +D  +
Sbjct: 154  T-QKQSILKMEEKDQEIDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYS 212

Query: 281  TEKEEFTREMSLKQRLIDLLESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKK 340
            T+++EF  E+ LK R+   LE+Q+  ++   E + Q  N++  S  E  +++++LIDT+K
Sbjct: 213  TKQQEFLHEIGLKDRINSSLETQLKEIQQ--EKSIQ--NEDNTSRAESQKIMEQLIDTRK 268

Query: 341  NLEATQAENIKLEATVNELLS-VNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKK 399
             L+ ++ E  +L++ VNE ++ VNG+   +                              
Sbjct: 269  QLKDSRNECTRLKSYVNEFINDVNGEYSSSSSLLKKELLK-------------------- 308

Query: 400  QLVQERRQKEELQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQ 459
                 + QK+ L+ QVE+F+ ELE K+P+++S +++   LE+EL+DVT L++  + +R+ 
Sbjct: 309  ----VKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERES 364

Query: 460  KTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKR 519
               E   +K K  + +  + +L  QRSDLAHQ+Q+LL+ L  +   +  L++ E +F++R
Sbjct: 365  LEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRR 424

Query: 520  IISSEDEAPKSDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLK 579
            +  ++  A  +D+Q IISERL++F  + ELQ +N ++L T+R LA +LE++EK  +    
Sbjct: 425  LTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHH 484

Query: 580  SVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKK 639
            ++E +T++EAK+A+L LQE+   LE +L+   KERD +KL +       + PS   +   
Sbjct: 485  TIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPS---ECND 541

Query: 640  LDEHIM-ELEKRLKNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLK 698
            +D+H   +L+  L+   E     I+ L    K +   K E+   +++  S+K  AE + +
Sbjct: 542  IDKHTTGKLQNELQQTREYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAE 601

Query: 699  LIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTS 758
            LI++ L + +E    + +++D LQ++L +++ K              L+ LT  L  LTS
Sbjct: 602  LIENNLLMLQENRKSVLEQNDHLQQLLSQKEAK--------------LAELTQDLHELTS 647

Query: 759  ERDFLRKIEAELKNENEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLES 818
            + + L+             T   + S  L +Q QT Q+E   ++EE           L+ 
Sbjct: 648  QYNLLQI----------RFTDTQSQSNSLRTQHQTTQKELFEVVEEKNA--------LKV 689

Query: 819  DLHETREHLVRRTREYEEQRVSDTSQYKWFQAKVD-SLNEQLDNARKTLQEKTNSIETLQ 877
             +HE     + R            ++ K  QA V+  LNE+L   +   Q+    IE  +
Sbjct: 690  KIHELE---ISR------------NECKGIQATVELKLNERLTEYQLHEQDLLKIIEKQE 734

Query: 878  LHAKSLTAKLEE------AELRTQSYSVLANADDITDKIETLR---KNLEKANINLADAY 928
               + +  K  E          TQ+ + +    D+  + ET R   ++  ++  + +  +
Sbjct: 735  DQIRDMEVKRAEELNWYQKNFPTQTETEIGLPVDMKKEGETGRQSNRDTLESQKSGSPGF 794

Query: 929  SQIEQYKSMAKVSEQSAVEISKALEESQ--------ANYRKNIALLEQERKSLTDQIALL 980
            + +    S+ K +    +++ +  EES+         +  + + L E   K   D IA  
Sbjct: 795  TDLGTDSSVRKSTSLPVMQVGRTEEESKEAKKCDALTDSSQVVGLPENVTKKEKDLIA-- 852

Query: 981  NDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEEKISKLQED--LT 1038
              QI+ L S+    K+  Q+ ++E       LQ  + S D  K+    ++ K+ E+  LT
Sbjct: 853  --QIEQLASDKKELKTSLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLT 910

Query: 1039 QQASYA-----NQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASEAKSAL 1093
            + A  +     +  +   E+E QKH +   T+S      +K   E+ G++   S++    
Sbjct: 911  EVAKKSLEDDLHDVEMKLEEERQKHEETNATLSEKELLCEKMIEEISGYREELSKSAEM- 969

Query: 1094 ERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLXXXXXXXXXXXXXXXXXX 1153
                Q   Q   +LE  L LA +R ++L TQN LL++Q+                     
Sbjct: 970  ----QVDIQHTRELEDLLDLANKRIDDLCTQNNLLHEQL------NATLDLEDTQNKDDI 1019

Query: 1154 XXLIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQ--ATAPDSIF 1211
              +I+ ++RERD L+ KL +  RE ++LR+R    K+EL+ V    SK Q     P S  
Sbjct: 1020 KDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAV----SKGQQWHNLPLSNL 1075

Query: 1212 ARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAXXXXXXXXXXXXXXXX 1271
                 E+I+++L +++LLRE+NV+L  E  +    +    +E++                
Sbjct: 1076 LT-GHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNT 1134

Query: 1272 TITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTXXXXXXXXXXXX 1331
                 E+DQ+ISL K+E  RWK+R Q ++H+ +    +E     +E+             
Sbjct: 1135 ERYFKEKDQEISLYKDEIERWKKRWQQMVHRQDDTLGLE-ANFKNEIDSLKGLIEERTKE 1193

Query: 1332 XXXXQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVXXXXXX 1391
                 E+F+ L+KQA+E+LD  K     + ++   +  +  QLE  + +   K+      
Sbjct: 1194 KEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIEL- 1252

Query: 1392 XXXXXXXXXGEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKNQIQELTEKI-- 1449
                         +LKE LE+               K E   SEK  K    +L + I  
Sbjct: 1253 -------------TLKENLEKFD-------------KDEKLVSEKTFKENEAKLNKTITM 1286

Query: 1450 -----KTLESEIE--HSELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEELRMKX 1502
                 +TL  E+     E+      D  +   ++  MK  FE EK  LI+EK  EL  K 
Sbjct: 1287 LQKLNETLNQEVVSLREEINVLRKKDD-ETNQLISTMKLDFEREKDRLIEEKVRELNEKF 1345

Query: 1503 XXXXXXXXXXXXXXXXXXXXXXVESTPNAPLIDEETLKSKLEAEYEKKTLERIREAEEAL 1562
                                  V +      +D+  LK +L  ++E++TL+RI EA+E L
Sbjct: 1346 ESGRNEVLSKQSEN--------VTNDNTGSNVDK--LKQELRKDWEEQTLQRIEEAKENL 1395

Query: 1563 KKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLIKEHQEE 1622
            K+ IRLPSEE+I ++IE+R+  L+ +F+ RV  +A  +   +      D  K  K  +E 
Sbjct: 1396 KRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKANLIALADKADMSPDELKQ-KVRREL 1454

Query: 1623 MDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKIN-----LNNSVP 1677
               +E     +L  +R KAFEEGK+Q  MK  LLE K++KLE Q  K N     +  S+ 
Sbjct: 1455 EHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDNESGSKVRKSIS 1514

Query: 1678 SKIPIDNN------NNSSPQGAQPIAIKPSPFQVAFGKAMENTS 1715
                ID N      +N+  +    + ++P+  +V  GK + N S
Sbjct: 1515 GLTKIDVNSPQLYKDNTGTRTEAVLKLRPTA-KVDSGKDVSNDS 1557

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  293 bits (749), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 416/1595 (26%), Positives = 745/1595 (46%), Gaps = 202/1595 (12%)

Query: 243  QLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLES 302
            +L  A++  ++L ++T  LS +L ++  + ++L D     ++E+T E++L++    LL+ 
Sbjct: 172  ELRLAKSERASLISQTERLSQELLQRDADIRQLVDADKLRQDEYTDEINLQKHRARLLQE 231

Query: 303  QVSSMKSDLE-NAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLS 361
            QV+S++ + +   +++  +  +  P ++  L +           ++ +I +++    LL+
Sbjct: 232  QVASLEKEAKLVGHETEPEYEIPPPGEEVALQQ-----------RSHSISMDS----LLT 276

Query: 362  VNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVE 421
             N                 D    ++ +L  +I IL  +L +E   K++L+ QV  FV E
Sbjct: 277  GN-----------------DETSHSMSELNNNISILSNRLKRETLSKQKLEKQVHKFVTE 319

Query: 422  LEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTI--ELNQYKNKINNYESQVC 479
            LE   PI+ SFK++++  + +++ + L LE   K  D++TI  E+ QYK ++     Q  
Sbjct: 320  LEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTK--DKETIFQEVEQYKKQLEQISGQDK 377

Query: 480  SLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDE---APKSDTQGII 536
             L  +R DLA Q+QYLL+   V+D +  PLT  E  ++K I++++ E      +D+Q II
Sbjct: 378  ILRRERFDLARQLQYLLLNGFVKD-SDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQLII 436

Query: 537  SERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVET-QTVKEAKEAILS 595
            S+R+++FKS++ELQ +N  LL+ +R L+D+ E  E+K    L+S ++ + + EAK+ +L 
Sbjct: 437  SKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERK----LESGDSIEAINEAKQTLLD 492

Query: 596  LQEHVQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDE--HIMELEKRLKN 653
            LQ++   LE +++ ++      KL   AN+   S     + +  L +  +I  L+ +  +
Sbjct: 493  LQQYNSSLEAKVESLTN-----KL--KANEHFTSIGDGEFGNSDLSDGNNIQALKNKYDS 545

Query: 654  LAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLE 713
            L  +S + I  L  +I  L ++KS++    E   +SK L E+RLK+ Q  L L+K EN  
Sbjct: 546  LMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENST 605

Query: 714  LHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNE 773
            L  R  +  + L +++ +T  TI + +   ++L  +  +L     E+D L+  ++ ++N+
Sbjct: 606  LRNRIKNTSQALKEREVETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENK 665

Query: 774  -NEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTR 832
             N+AL KE    + L+ QL+ LQ+ +D  L++ Q + +  I+ LE +  E R  +  +  
Sbjct: 666  LNQAL-KERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKET 724

Query: 833  EYEEQRVSDTSQYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAEL 892
                   +  ++ +W+Q K DSL+   D   + + E  ++IETL +  ++L   L+EA  
Sbjct: 725  SPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANS 784

Query: 893  RTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIE-------QYKSMAKVSEQSA 945
            + +        DD+      L   L  +   L D   ++E       QY+S  KV     
Sbjct: 785  KNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELEISSNTIRQYQSEIKV----- 839

Query: 946  VEISKALEESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSEL 1005
                  L E Q+        LE E K L D+IA+L D       EL H   + + EK  L
Sbjct: 840  ------LNERQSE-------LENENKHLRDEIAILRD-------ELTHNGGEFEREKEAL 879

Query: 1006 IKKLSILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTI 1065
            +KKLS L+  Q  L +L+ +Y  +I KL+ DL +QA    + +  +++E+++        
Sbjct: 880  MKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVRE-------- 931

Query: 1066 SLLREESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQN 1125
             +    ++ Y++E+E  +    + K  +E+ E+    ++  L  Q+ L ++R ++ + + 
Sbjct: 932  -VQNRNTETYRNELELVE--IRQTKVFVEK-EKELESRIKILNEQIELDKERMKQFSDEE 987

Query: 1126 RLLYDQVELLXXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRL 1185
             LL +QV+LL                    L+  L  E+  LE+KL  S  E+  LR++ 
Sbjct: 988  SLLREQVKLL-ADEKASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQ- 1045

Query: 1186 GLAKTELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLE 1245
             L KTE E   L  +  QA    +        +  E + QL  L+ESN++L NE K    
Sbjct: 1046 -LTKTESEIAVLNMNYEQAKKEVAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQM 1104

Query: 1246 QSQHFQNEIAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYER 1305
            ++     E+                    +S +D ++  L+ E SR K  S D+     +
Sbjct: 1105 RNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNK 1164

Query: 1306 IDPVE-HQKLADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEF 1364
                E    L   V                 ++RF +L++QA ERLD  K     +    
Sbjct: 1165 DSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDNV 1224

Query: 1365 EAVSIAKAQLEAELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEELEELRANF---IEAN 1421
            E ++  K  L+  + ++                         K+EL ELRA     IE +
Sbjct: 1225 ETLTKDKTALQDVIERS-------------------------KDELNELRAKIQEHIETS 1259

Query: 1422 EAVADIKAEAA---SSEKDLKNQIQE-----------LTEKIKTLESEIEH-SELEAKNS 1466
              + ++K E A   S  KD++ ++ E           L E+I++L+ E+++  E  +   
Sbjct: 1260 AVMKELKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEIESLKHEVQYLKEASSAEP 1319

Query: 1467 NDSPDFAPIVENMKKKFEEEKQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVE 1526
              + + + +VE+M+K FE+EK   ++   E+   +                       +E
Sbjct: 1320 QGNEEMSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKREMEALEKEKDSLVME 1379

Query: 1527 STPNAPLIDEETLKSKLEAEY-EKKTLERIREAEEALKKRIRLPSEERINQVIERRQRAL 1585
             T    L +E T   K  ++  + +TL++  EA    K+R+ L  +E+ +Q++  +   L
Sbjct: 1380 KT---RLGEENTALMKARSDVPDIETLQKQWEASN--KERLVLLYKEKSDQMMRAKMDEL 1434

Query: 1586 DQEFELRVRARALELFKENPESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEG 1645
            +++F+ RVR +  EL               +K+  EE  K +   ++ L  V+K+AFEEG
Sbjct: 1435 EEQFQNRVRNKEKEL-------------NALKDEIEE--KCKTGHEDTLIAVKKRAFEEG 1479

Query: 1646 KQQLVMKVKLLESKIAKLEGQ--PNKINLNNSVPSKIP--IDNNNNSSPQGAQP-IAIKP 1700
            KQQ  MK+ +LE KIAKLE +    K   + SV    P  +  NNN   Q  QP +A   
Sbjct: 1480 KQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDAPRFVTPNNNKVQQANQPFLATAG 1539

Query: 1701 SPFQ------------VAFGKAMENTSFGS-FKGSLLDSKQ---FIANTADTSTSTLTG- 1743
            S F             V+ G A  N S  S F  + L + Q    ++ ++D    T+ G 
Sbjct: 1540 SGFSVQSSESNPFTTPVSRGAAHTNASSQSKFAPTFLLNSQPPVLVSGSSDEDNDTMRGT 1599

Query: 1744 ----NVGTNT------NKRQSEDEL-AQSPEKRPK 1767
                + GT        NKR  E E   +SP K+ +
Sbjct: 1600 SVDEDAGTAVPSLNENNKRPGEGESNLKSPSKKTR 1634

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  271 bits (692), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 271/1003 (27%), Positives = 516/1003 (51%), Gaps = 79/1003 (7%)

Query: 134  AKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQR 193
             K ++ KLLEE+I+ +   K + ++++  NK L ++S  L   I+  K ++L  ++++ +
Sbjct: 73   TKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDK 132

Query: 194  LHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNST 253
            +   L+L          E  SK +   S++++   E QN  E + ++ ++L      N+ 
Sbjct: 133  VTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNGKNAE 192

Query: 254  LKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLEN 313
            L  +  ELS  L+ K+ E K L + L T   +F  E  L+ +LI+ L++Q+ +++  LE+
Sbjct: 193  LFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLES 252

Query: 314  -AYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVIN 372
             + +  +  G    +K +LL ++ +  + LE ++ E + L  ++ E         +    
Sbjct: 253  LSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEF------QNIPEEE 306

Query: 373  SNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSF 432
            S+   +    + ++   L GD+ IL+K  ++ER+QK +L+ Q+   + ELE  +P L+S+
Sbjct: 307  SSSVSSHASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSY 366

Query: 433  KERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQV 492
            KER+  LE+ELN   +LLE   K+   K+ EL + +++ +N  S + SL  QR+ LA QV
Sbjct: 367  KERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQV 426

Query: 493  QYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQSK 552
            +YLL+ +   +     L  +++E + + +++      SD++ I+ ERL QFK+V ELQ++
Sbjct: 427  KYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKELQNR 486

Query: 553  NAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSK 612
            N +LL   R+LA K E  EK +  ++ S E +T+ +AKEAIL LQE+ Q+LE Q+K +S 
Sbjct: 487  NMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIKELSD 546

Query: 613  ERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIKLLNDEIKAL 672
            E  A +      K+  SA S          H ++L K+L    + S+D I  LN EI+ L
Sbjct: 547  EL-AVQKKEKTEKESISAMSKIEDDA--SSHTIDLGKQLSANLKHSKDIIDALNSEIENL 603

Query: 673  YKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKT 732
            ++A ++V + L++E+S++ LAE+R  L++  +SL K E  EL +  + LQ+ +L ++++ 
Sbjct: 604  HQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNILDKEKQF 663

Query: 733  QSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKILVSQLQ 792
              +  + I+ KS+LS   +++  L +E +   + +  L+ + EAL  E    ++ V+Q+ 
Sbjct: 664  SYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMN 723

Query: 793  TLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTSQYKWFQAKV 852
            +L  E   LL+E ++ Y   ++       +T   L    +   E +  + S+ KW++A +
Sbjct: 724  SLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDSEIKWYKATI 783

Query: 853  DSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITDKIET 912
            D L   +    + L++K   IE     +K+L           Q+   LAN+ D++++   
Sbjct: 784  DDLKANVFELNEELKQKEEKIEEF---SKTLE--------NVQNELTLANSKDVSEEKRA 832

Query: 913  LRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQERKS 972
            L K L +    L  +  ++++Y+++   S++S                        E KS
Sbjct: 833  LEKELSEVKSQLEKSNLEVKEYENVISTSKRSF-----------------------ENKS 869

Query: 973  LTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQG-----------SQRSLDE 1021
            +        D+IK L S+LD +      E++ L + LS LQ            +  +L E
Sbjct: 870  IQ-----YEDRIKALASKLDSE----LRERTTLQENLSTLQARMVVQQDELTSNNNTLSE 920

Query: 1022 LKSEYE----------EKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREE 1071
            L+  Y+          +K ++L+  +  +    +   K+YE+ +Q++++++K + LLREE
Sbjct: 921  LRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREE 980

Query: 1072 SQKYKS--EMEGFKRSASEAKSALERNEQSWCQQVADLESQLS 1112
             +   S  E EG      + +S +++ +  W ++    E Q++
Sbjct: 981  VKNRTSNGEKEG---DLEDTESIIKKGQDVWDEEKKVFEVQIT 1020

 Score =  100 bits (250), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 83/125 (66%), Gaps = 2/125 (1%)

Query: 1542 KLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELF 1601
            KL   YE++  +++ +AEE LKKRIRLP+EE+IN +IE+R+  L+  FE +++  A  L 
Sbjct: 1219 KLREFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLL 1278

Query: 1602 KENPESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIA 1661
              + +  +    K I+E   E   L+ +FDEQL +VRKKAFEEGKQ ++MK   LE KI+
Sbjct: 1279 LHSDDDKIKKIYKEIEESGRET--LQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKIS 1336

Query: 1662 KLEGQ 1666
             LEGQ
Sbjct: 1337 MLEGQ 1341

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  253 bits (647), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 472/1728 (27%), Positives = 777/1728 (44%), Gaps = 346/1728 (20%)

Query: 121  VEEAKQGMEIIASAKQ--DVTKLLEEKISDLAASKEESDRLL--------AANKELRKSS 170
            V    QG E+    +Q  D  +LL E+   L+ S EE   +L         AN ELR + 
Sbjct: 34   VHSPLQGNELREKLRQAEDSNRLLRERNELLSRSLEEKTGILDTVQSSVSTANAELRSAR 93

Query: 171  IDLEFIIQGYKSQELREK---SEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTN 227
               E ++      ELR++   SE QR   EL       D LS++L+     +N+    TN
Sbjct: 94   ---EQVV------ELRQRLGESETQRFQSELQ-----RDRLSEQLKQGERYINA----TN 135

Query: 228  SEL----------QNGYEQVNSLKSQLEFA-------RANNSTLKAKTAELSNQLQEKLV 270
              L          Q    QV  ++ +L+ +       R +NS L      ++ +L +K  
Sbjct: 136  GRLLESTKKLLDFQRDDRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAA 195

Query: 271  ETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLENAYQSANQNGMSTPEKDQ 330
              K L+D L++++ +F RE++ + +L  +L+ QV+S+ S+L         NG  TP   +
Sbjct: 196  LNKTLSDQLSSQRHDFERELATRDKLNAVLKKQVNSLHSEL--------GNGGETPAHAE 247

Query: 331  LLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSNVSDTSLDSKISTVPKL 390
              D+        E  +  N K +  V ELL + G+   +                     
Sbjct: 248  PNDQFAKQSSQHEE-EISNYKEQ--VEELLGILGQGAPS--------------------- 283

Query: 391  CGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSFKERTDMLERELNDVT--L 448
               I  L+K L++ER++   L+ Q+ESFV+ELEH++P L   +++   ++++L+  T  +
Sbjct: 284  ---IAHLRKLLLKERKENVSLKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKM 340

Query: 449  LLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGP 508
            + ES AK R Q+  EL+  + K+++       L VQRSDLAHQ+Q+LL  ++  D    P
Sbjct: 341  IEESKAKIRTQR--ELSSSRQKVDHLNQIFHKLRVQRSDLAHQIQFLLT-VNSSDTVLPP 397

Query: 509  LTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLE 568
                E+ F+K II +E+     D+Q I+S+RL++F ++ ELQ +N +L++T+R L DK+E
Sbjct: 398  ---SELSFIKTIIENENWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVE 454

Query: 569  DEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKERDAFKLANSANKQGD 628
              E  +   L      T++ AK  I  L++   +LE ++K      +  K  +S     D
Sbjct: 455  SWEADNDSGL------TLEAAKLQISKLEQSNAQLESEVKNWEALMETLKDGDSL----D 504

Query: 629  SAPSSTY--QSKKLDEHIMELEKRLKNLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQE 686
            S  + T   Q KK++    ELE +L ++ E     I +LN   K + + +S + ++ EQ 
Sbjct: 505  SKINVTMVEQQKKIE----ELESKLTDVGESHVQKINVLN---KTIDRNQSTINMLNEQI 557

Query: 687  RSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQL 746
            +++ V ++   K   S L   K ENL L       Q++  KQ+E     +DE+ +  +Q 
Sbjct: 558  KNT-VKSDMNAK---SELIACKRENLSL------TQQISTKQNE-----LDELNSKSAQ- 601

Query: 747  SNLTSKLAILTSERDFLRKIEAEL----------KNENEALTKENTT------------- 783
                        ERD+  KI AEL          +N    LT+E T              
Sbjct: 602  -----------KERDYQLKI-AELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQ 649

Query: 784  --SKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETRE-----HLVRRTREYEE 836
              SK L+ QL+T  +E ++ +   + + +++ E L S +    E     H     +E E 
Sbjct: 650  QESKKLL-QLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEV 708

Query: 837  QRVSDTS--QYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRT 894
            ++  + S  Q KW+Q  +D L+EQ  N       K+N I  ++L+ K     L E  L  
Sbjct: 709  KQFIEKSEKQIKWYQQNIDELSEQNKN-------KSNKI--IELNDK--LRLLSEKSLSN 757

Query: 895  QSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSE----QSAVEISK 950
            + Y V     ++ +++  ++  LE +        SQ   YK   + ++     S +    
Sbjct: 758  KPYPVGTELKELQNELNGMKAALEVSE-------SQATLYKDTLERNQNFYNNSTLSFQN 810

Query: 951  ALEESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQ--SEKSELIKK 1008
             + E Q+   KN AL +Q  ++L +QI    +Q K +  +L+HQ   ++  SEK+ L +K
Sbjct: 811  TISELQS---KNEALSKQ-HETLQNQITETENQSKGI--QLEHQTIIDRLTSEKTALEEK 864

Query: 1009 LSILQGSQRSLDELKSEYEEKISKLQEDLTQQASYA---NQAQKNYEQELQKHADVTKTI 1065
            L+ L  S+  + E+K EY+ +I K++ +L  Q+        A  + E+EL  +A     I
Sbjct: 865  LNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSYA---VQI 921

Query: 1066 SLLREESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQN 1125
              L  E  K  S++      A EA+  L +   S  Q       +L LA QR E L  QN
Sbjct: 922  EQLNTEIAKLNSDIAALTEPA-EARKTLIKERDSLGQ-------ELKLANQRIESLAAQN 973

Query: 1126 RLLYDQVELLXXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKILRQRL 1185
             +LYD    +                    L++ LR ERD+ +++   + R+ K+L++ L
Sbjct: 974  SILYDTFSGM-----RHVDADAEPNEDLRNLVINLRIERDMHQSQETTAQRDVKLLKKNL 1028

Query: 1186 GLAKTELENVRLEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLE 1245
                 +L     E  +   T  D      + E+IM +L  L   +E N+ L    K   E
Sbjct: 1029 KEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLDESIKSLNE 1088

Query: 1246 QSQHFQNEIAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQDILHKYER 1305
              +  Q E++                 I+  E  Q+I   ++ES +WK   Q +      
Sbjct: 1089 DKRTLQEEVS--RLRESEELAKKNSSAISEQEWQQKIETYQQESEKWKLMCQQMSENT-- 1144

Query: 1306 IDPVEHQKLADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKAKVESEFE 1365
                E Q L  ++                  +RF +L+KQA+E+L+   A+KA  +S   
Sbjct: 1145 --ATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLN---ASKATSDS--- 1196

Query: 1366 AVSIAKAQLEAELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEELEELRANFIEANEAVA 1425
                    L  EL++ L  V                  D+L+E+L     N +++    A
Sbjct: 1197 --------LAIELSE-LKTVN-----------------DALQEKLNNQETNSVDSESNAA 1230

Query: 1426 DI------KAEAASSEKDLKNQ-------IQELTEKIKTLESEIEHSELEAKNSNDSPDF 1472
             I        +A S E +L++        I ++T+++ TL+      E   + S +  D+
Sbjct: 1231 LILQLKEENKQAKSLELELRHSVDSSEKLIADMTKELTTLK------ENPIQGSVNVEDY 1284

Query: 1473 APIVENMKKKFEEEKQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAP 1532
               +E +K +FE+EK+VLI++   EL  +                            NA 
Sbjct: 1285 THRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKELMNN-----------------NAN 1327

Query: 1533 LIDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELR 1592
            L   E L+  LE E+E+KTL+RI EA+E LKK IRLP+EE+I +VI +R+  L+++F+ +
Sbjct: 1328 L---EELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTK 1384

Query: 1593 V--RARALELFKENPESFVGDTA-KLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQL 1649
            V  +A  L+L           TA +L KE +EE   ++ + +E   L++KKAFEEG+QQ 
Sbjct: 1385 VAEQANLLKL-----SELSNKTADELEKEVREE---IKTRLEEDFELLKKKAFEEGRQQA 1436

Query: 1650 VMKVKLLESKIAKLEGQ------P-------NKINLNNSVPSKIPIDNNN--NSSPQ--- 1691
             MK  LLE KIAKLE +      P       NKIN+++ +    P+ N    +  P    
Sbjct: 1437 SMKTTLLERKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAGPLTNEPVLDEKPNAFA 1496

Query: 1692 GAQPIAI-KPS------------------PFQVAF-GKAMENTSFGSF 1719
            GA    I +P+                  P Q AF  +A    SFGSF
Sbjct: 1497 GATTTTISQPTSTTAKDSANAFSFNAQKVPAQPAFSSRAQPAFSFGSF 1544

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  243 bits (619), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 212/633 (33%), Positives = 347/633 (54%), Gaps = 58/633 (9%)

Query: 1   MSQRGASDSSISVDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSIS 60
           MS    ++ + S+   K+++F ++     + +DE  +   + KA +  K   +N  +S +
Sbjct: 1   MSTDSRNEPTPSI-IDKISSFFDLPGNTWESMDEHALEKIYTKAYDLMK---ENSFVSAA 56

Query: 61  IDGLKCNFEQKINT-----FKEQVE--KLLSDVASRQQEKQQTEDEKLKLMNEKAQLSME 113
           ID +K  +E KINT     F  Q+E  KL    +     +++   EK K  +    L+ E
Sbjct: 57  IDDIKHVYEGKINTISQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSE 116

Query: 114 VLKLRSQVEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDL 173
           +  ++  +E  ++    + + ++    +LE+   +L  S       L  N  L++     
Sbjct: 117 ITLIKYDLEAMQRDHTTLEARERKTENVLEQSKLELQDS-------LTENSALKEQIGVF 169

Query: 174 EFIIQGYKSQELREKSEIQRLHQELNLVKSNADWL---SKELESKNEQLNSFRE---KTN 227
           E  +     +     +E ++L   + L++ N  +L    KE + KN++L S  E   +  
Sbjct: 170 EGKLDSMTQELWLANTENKKLQTGMKLLRENNLYLEIKCKETD-KNKKLYSSAEDASRLQ 228

Query: 228 SELQNGYEQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFT 287
            +LQ    ++ SLKS++       +TLK     LS  LQ KL   K L D LN+ K+EF 
Sbjct: 229 DQLQIVSSEILSLKSEI-------ATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFA 281

Query: 288 REMSLKQRLIDLLESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQA 347
           +E++LKQR+ +LL ++++S K  +E          + TPEK +++ EL+D K+ L  ++ 
Sbjct: 282 KEITLKQRVNELLHNEIASYKKQIE----RLTSKNLETPEK-KIIQELVDLKEKLVNSEK 336

Query: 348 ENIKLEATVNELLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQ 407
           E  +L++TV++ +             N+ +  L SK     KL   I IL++QLV+E+R 
Sbjct: 337 ECNELKSTVDKYI-------------NIDEKKLISKFGNPKKL---IEILRRQLVKEKRH 380

Query: 408 KEELQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQY 467
           K+ LQ QVESF+VELE K+P+++SFKER   LEREL  +T  LE TAK+RD K  EL   
Sbjct: 381 KDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNL 440

Query: 468 KNKINNYESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEA 527
           + KI+N E     L+ QRSDLAHQVQYLL+ +    D   P TE+E   VK+I+S+E+  
Sbjct: 441 QKKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DNKSPFTEKEATLVKKIVSNENTE 496

Query: 528 PKSDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVE-TQTV 586
             +D+  IIS+RL+ F++V ELQ KN ELL T RQL   LE +E++ +  L+  +  + V
Sbjct: 497 NDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIV 556

Query: 587 KEAKEAILSLQEHVQRLEDQLKIVSKERDAFKL 619
           + AK   + L++H++ LE ++ I+S+ERD++KL
Sbjct: 557 ESAKSTSVDLEKHIKTLESKINIISQERDSYKL 589

 Score =  153 bits (386), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 212/787 (26%), Positives = 351/787 (44%), Gaps = 124/787 (15%)

Query: 1003 SELIKKLSILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVT 1062
            S L   +S LQG ++ L+ELKS+  EK  KLQ    + +   N A               
Sbjct: 872  SFLANSVSQLQGKEKELNELKSKLVEKTEKLQMAENENSEKINNA--------------- 916

Query: 1063 KTISLLR---EESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTE 1119
              I LL+   EE+  +K   + FK S S  + A+   +Q      ++  +++  A +R E
Sbjct: 917  --IVLLQTMVEENTTFKDAFKHFKNSLSRLRQAINSIQQQSLVIESNYNTEIDHANERLE 974

Query: 1120 ELNTQNRLLYDQV-ELLXXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREE 1178
            E   +      +V E+L                    L+ +L              I E+
Sbjct: 975  EAEVKMASFDGKVTEILESYDGKILNTAAIGH-----LVRSL--------------IHEK 1015

Query: 1179 KILRQRLGLAKTELENVRLEFSKTQATAPDSIFAR--------ESQEQIMEKLNQLNLLR 1230
            K+L   L  A   L   R      +   P   F +        E +E++ME   +L  L 
Sbjct: 1016 KMLALNLNSANYSLRRARYRNKNPREKFPS--FVKIDQQSKKEEDKEEVMENTTKLLALE 1073

Query: 1231 ESNVTLRNESKKYLEQSQHFQNEIAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESS 1290
            ESN  L  E +   + ++   +++A                 + ++E++Q +++ +EE  
Sbjct: 1074 ESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEELE 1133

Query: 1291 RWKQRSQDILHKYERIDPVEHQKLADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERL 1350
            RWK RSQ IL + + ++   H K  +++                  +RF +L+KQA+E+L
Sbjct: 1134 RWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEKL 1193

Query: 1351 DEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEEL 1410
            D  K  +  + ++   ++  K  LE  L Q ++K                G AD   EE+
Sbjct: 1194 DAAKTMQINLTTQINELNETKVNLEKSLQQEIEK----------NNQSGNGAADE-SEEI 1242

Query: 1411 EELRANFIEANEAVADIKAEAASSEKDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSP 1470
              LRA   ++N    +++ +   ++K  KN+I+ L  +++++++  E+S + +K      
Sbjct: 1243 IRLRAELEKSNNFSNELEKKVEDAKK-FKNEIESLKSELQSVKA-YENSTVNSK------ 1294

Query: 1471 DFAPIVENMKKKFEEEKQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPN 1530
                I++++K+ F+ EK  LI++      MK                            +
Sbjct: 1295 ----IIKDLKESFKREKDELIEQ------MKKEFKTKLEKEKETILAQRKNNILANGQES 1344

Query: 1531 APLIDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFE 1590
            A + + +    + +       L+RI EAEE LKKR+RLPSEE+IN VIE+R++ L+QEFE
Sbjct: 1345 ANIEELKKKWEEEQEAL---ILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFE 1401

Query: 1591 LRVRARALELFKENPESFVGDT-AKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQL 1649
             ++R   L     +    V DT A++ KE       L  KF+ +LA ++KKAFEEGKQQ 
Sbjct: 1402 TKLRELGL---NADGNGVVTDTRAQIEKE-------LREKFNLELAEIKKKAFEEGKQQS 1451

Query: 1650 VMKVKLLESKIAKLEGQ---PNKINLNN--SVPSKIPIDNNNNSSPQGAQPIAIKPSPFQ 1704
            +MK  LLE K++KLE Q   P K N +N   VPSKI + N N+SSP    P+  K    Q
Sbjct: 1452 MMKSTLLERKLSKLESQTLSPTKNNDSNETQVPSKINLSNINSSSP----PLGEK--VLQ 1505

Query: 1705 VAFGKAMENTSFGSFKGSLLDSKQFIANT-ADTSTSTL-TGNVGTNTNKRQSEDELAQSP 1762
            + +G  +                  +A T  D +  TL +G   T   KR +++E+ Q  
Sbjct: 1506 LNYGANV------------------VAETDNDDNPFTLQSGKDETLLTKRSADNEIIQDI 1547

Query: 1763 EKRPKDD 1769
             KRPK++
Sbjct: 1548 IKRPKEE 1554

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  188 bits (478), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 148/499 (29%), Positives = 276/499 (55%), Gaps = 33/499 (6%)

Query: 365 KNGVAVINSN--VSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVEL 422
           KN V +IN +  ++D   +SK +  P     +           +Q   L++ +++++ EL
Sbjct: 176 KNEVEIINDSKTINDDIENSKATIPPSPAKALS----------KQNNGLKSDIQNYLNEL 225

Query: 423 EHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLI 482
           E ++P++ +FK   + L+  LN   L++ES    + +    ++  K  IN   S + +L 
Sbjct: 226 EQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKTINEKSSSIEALD 285

Query: 483 VQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQ 542
           +QR+DLAHQ+QYLL+  S+++D +GPL++ E+ F++ +I+ + +   SD Q +IS+RL++
Sbjct: 286 IQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSSDVQSVISDRLIK 345

Query: 543 FKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQR 602
           FK ++ LQ KN EL  +IR LA  LE +E + +   ++ +  T+ EAKE ILSLQE+   
Sbjct: 346 FKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAKETILSLQEYNNV 405

Query: 603 LEDQLKIVSKERDAFKLANS-ANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDN 661
           L  +L+I + +    +L +S  N +        Y S      + +LE +L  L+  SQ  
Sbjct: 406 L--KLEIGTLQSKISELQSSIPNSKESEKQHFNYHSN----LVKDLESKLSKLSAYSQST 459

Query: 662 IKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDL 721
           I+ LN +I+ LY  ++++ + LE+E+SS +LA E+L L+Q++  L   EN EL  ++  L
Sbjct: 460 IENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLLTLENEELSSKNSML 519

Query: 722 QRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKEN 781
           ++ L ++++   S +++ I  K+ L + T++L +L + +         L+ EN +L +E 
Sbjct: 520 EQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNNNK-------LGLEEENNSLKQEI 572

Query: 782 TTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLE---SDLHETREHLVRRTR----EY 834
            ++   +  L +  +  +  LE   + Y   +++LE   S L+E +  L R+ +    E 
Sbjct: 573 KSNYEQIKDLDSKSKHLEQSLENEISKYTDKVKELELNISKLNEQKLILERKLQNKNIEI 632

Query: 835 EEQRVSDTSQYKWFQAKVD 853
           ++   S+  Q  W+Q K+D
Sbjct: 633 DDLNSSNYDQISWYQKKLD 651

 Score =  116 bits (291), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 199/795 (25%), Positives = 342/795 (43%), Gaps = 135/795 (16%)

Query: 966  LEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSE 1025
            LE+E  SL  +I    +QIKDL+S+  H +   ++E S+   K+  L+ +   L+E K  
Sbjct: 561  LEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVKELELNISKLNEQKLI 620

Query: 1026 YEEKI--SKLQEDLTQQASYANQAQKNYEQELQKHADVTKTI-SLLREESQKYKSEMEG- 1081
             E K+    ++ D    ++Y   +   Y+++L ++    KT+ S L  ++Q  K+ +E  
Sbjct: 621  LERKLQNKNIEIDDLNSSNYDQISW--YQKKLDQYEKTIKTLESRLPADTQNSKALVEDK 678

Query: 1082 ---FKRSASEAKSALERNE--------QSWCQQVADLESQLSL---------AQQRTEEL 1121
                 R AS   S+   NE         +  +++  +E + +L          + R + L
Sbjct: 679  ALEDSRDASPVSSSASCNEITIRIFGDSNKTKKIYPIEEEKNLELITKELEDTKVRVQNL 738

Query: 1122 NTQNRLLYDQVELLXXXXXXXXXXXXXXXXXXXXLIMTLRRERDILETKLDVSIREEKIL 1181
             TQNRLL +++E                      + ++LR ERD L  ++    ++ +++
Sbjct: 739  ATQNRLLLEKLE-------------RSANLEVDDIFVSLRYERDTLSDQVVNYEKDMQVI 785

Query: 1182 RQRLGLAKTELENVR---LEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRN 1238
               L   ++EL       L F   +A   D      ++E ++EKL +L+ L+E N+ L  
Sbjct: 786  LADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDELKERNMELTQ 845

Query: 1239 ESKKYLEQSQHFQNEIAXXXXXXXXXXXXXXXXTITISERDQQISLLKEESSRWKQRSQD 1298
            E     E +   + ++                  I I ++D  I++  E++  WK R  +
Sbjct: 846  EIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTRFNE 905

Query: 1299 ILHKYERIDPVEHQKLADEVTXXXXXXXXXXXXXXXXQERFRKLRKQANERLDEFKAAKA 1358
            +    +  D  +   L  +V                  +RF +L+KQANERL   K A+ 
Sbjct: 906  LTLSAKNNDNEDLINLQKQV-------EEKSKENEELSDRFNRLKKQANERLHASKVAQN 958

Query: 1359 KVESEFEAVSIAKAQLEAELAQTLDKVXXXXXXXXXXXXXXXGEADSLKEELEELRANFI 1418
             +  +   +      LE  L++ +++                G    LKE+L    AN +
Sbjct: 959  NLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQEL-GSIGDLKEQL----ANAL 1013

Query: 1419 EAN----EAVADIKAEAASSEKDLKNQIQELTEKIKTLESEIEHSELEAKNSNDSPDFAP 1474
            + +    E +    +E+ S   DLKN+I+ L EK+K+ ES +   E E +N+        
Sbjct: 1014 DKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKSKESSVGLQESEIENA-------- 1065

Query: 1475 IVENMKKKFEEEKQVLIQEKDEELRMKXXXXXXXXXXXXXXXXXXXXXXXVESTPNAPLI 1534
                        K++LI E +E+L                           ++     L 
Sbjct: 1066 ------------KKILIAELEEKLN--------------------------KTKSELDLK 1087

Query: 1535 DEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVR 1594
             +E LK  L+ EYE    +R+ EAEEALK++IRLPSEE+IN +IE +   L+++++ ++ 
Sbjct: 1088 HKEELKV-LKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLE 1146

Query: 1595 ARALELFKENPESFVGDTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVK 1654
              + E                      +++K++ +F++ L   +KKAFEEGKQQ  MK K
Sbjct: 1147 TVSAE--------------------STDIEKIKQEFEDNLVNAKKKAFEEGKQQASMKTK 1186

Query: 1655 LLESKIAKLEGQPNKINLNNSVPSK---IPIDNNNNSSP----QGAQP-IAIKPSPFQVA 1706
             LE+KIAKLE Q    N  + V  K   +   +N  S+P    Q A+P     P P    
Sbjct: 1187 FLENKIAKLESQLQ--NNESDVTDKEAEVKTTDNEKSNPELDKQEAKPSFTFSPPPNSNP 1244

Query: 1707 FGKAMENTSFGSFKG 1721
            F    +  S  S  G
Sbjct: 1245 FTTTQDTDSPVSVFG 1259

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  124 bits (311), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 201/785 (25%), Positives = 375/785 (47%), Gaps = 101/785 (12%)

Query: 116 KLRSQVEEAKQGMEIIASAKQDVTKL--LEEKISDLAASKEESDRLLAANKELRKSSIDL 173
           +L+S+V+  K  +    +A  D T L  L E+++++     + +R+     +L     +L
Sbjct: 31  QLKSKVDGDKIVLRHDENADNDSTDLQTLHEQLNNITL---KYNRVTNEKTQLADKISEL 87

Query: 174 EFIIQGYKSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNG 233
           E  ++  K   L  K E++++    N ++S    L  +L + N+  N+  ++   + Q  
Sbjct: 88  EVKLEQEKCNNLHTKLELEKMSITYNSLESKNRELESDLSAMNDNENTLHDEEQYKNQCL 147

Query: 234 YEQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTE---KEEFTREM 290
             +V +LK+ +         L     +  + L+EK+ E   L     +E   K+E   E 
Sbjct: 148 NREVINLKNDILILETKYDKLLKGYNDTKDNLKEKISELLALDTSFKSETKLKDEIIEE- 206

Query: 291 SLKQRLIDLLESQVSSMK--------SDLENAYQSANQNGMSTPEKDQLLDELIDTKKNL 342
             K  LI  L +++ S+K        SD+   Y   +   +   E  +LL+E +   + +
Sbjct: 207 --KDYLIANLTNEIESLKNREINEHSSDINIEYGKNSSIIVDKQEYQRLLNEALINNEKI 264

Query: 343 EATQAENIKLEATVNELLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLV 402
           +    +  +L ATVNE  S  G N V+                     C D  ILKK++ 
Sbjct: 265 DEYDLKVARLTATVNEFQSKTGINFVST-----------------DDFC-DFIILKKEIQ 306

Query: 403 QERRQKEELQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLL--ESTAKQRDQK 460
           +   Q++ LQ ++E  + ELE+  P LN+  ++       +N++ LLL  E    +  + 
Sbjct: 307 KLEGQRDLLQEKLEYLIHELENHAPELNNQYDK-------INELELLLSKEKNTSEHFKT 359

Query: 461 TIEL--NQYKNKINNY---ESQVCSLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVE 515
           TI+   N+ KN I+     + ++ +L  + +DL +Q+Q++L+  S+++D +G LTE E++
Sbjct: 360 TIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGELTENEIK 419

Query: 516 FVKRIISSEDEAPKS---DTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLEDEEK 572
           F+K +     E   +   ++Q IIS+RL++F+SVI LQ KN EL+ T+R +  KL+++E 
Sbjct: 420 FIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKKLDNQEH 479

Query: 573 KSRFRLKSVETQTVKEAKEAILS-------LQEHVQRLEDQL---KIVSKERDAFKLANS 622
           + R + ++     + EAKE IL        L+E +  L+ QL   + VS E++  +   +
Sbjct: 480 ELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQLNANRPVSHEKNGHESVLA 539

Query: 623 ANK---QGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIKLLNDEIKALYKAKSEV 679
            NK   +GD           LDE    L+  +    +Q+ + I +  D++ +LY    E+
Sbjct: 540 ENKLYTEGDRLI--------LDE----LKNNIPEFTKQASNIISMNFDQLTSLYNKNLEL 587

Query: 680 TVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEI 739
           T    +   S+ + +++L L+Q         N +L +  + ++  + ++DE   STI   
Sbjct: 588 TADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLNSTIANH 647

Query: 740 IATKSQLSNLTSKLAILTSERDFLR-------KIEAELKNENEALTKENTTSKILVSQLQ 792
           +  K+ L ++T+ +  L ++ D L+       +I  ELK E E L       K+ +  ++
Sbjct: 648 VDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELKMEREQL-------KMELLNIK 700

Query: 793 TLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVR--RTREYEEQRVSDTS--QYKWF 848
           T+Q + D  LE A+  Y+ ++    +DL  T  +L +  RT+E E Q    T   +  W+
Sbjct: 701 TVQIQSD--LESAE--YKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWY 756

Query: 849 QAKVD 853
           Q K D
Sbjct: 757 QKKFD 761

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score =  106 bits (264), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 128/212 (60%), Gaps = 9/212 (4%)

Query: 391 CGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSFKERTDMLERELNDVTLLL 450
             +I  +K +L++E+ +K  L+ +   F+ ++E K+P L     + + +E E N+   + 
Sbjct: 280 INNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYL-----QNNSVENETNNGNKIE 334

Query: 451 E-STAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYLLM-QLSVRDDAHGP 508
           E     + D   +E    K K+N++ES V +L+ QRSDL HQ+ YLL+ Q  + +D +  
Sbjct: 335 EQKIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKI 394

Query: 509 LTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVIELQSKNAELLNTIRQLADKLE 568
           LTE E+ F++ +++       ++TQ IISERL++F +V +L +KN +L++ +R+L +K+E
Sbjct: 395 LTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKME 454

Query: 569 DEEKKSRFRLKSVET--QTVKEAKEAILSLQE 598
             EK++  +   +E   +++ EAK+ ++ L+E
Sbjct: 455 SIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKE 486

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 80/314 (25%), Positives = 153/314 (48%), Gaps = 44/314 (14%)

Query: 188 KSEIQRLHQELNLVKSNADWLSKEL--ESKNEQLNS----FREKTNSELQNGYEQVNSLK 241
           K EI+RL  + NL+++N  WL++ L  + KN  +++    +  K +++L N + ++  L+
Sbjct: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKL--LE 78

Query: 242 SQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEE--FTREMSL-KQRLID 298
            Q EF  ++N  L  +  E S +  +K      + D LN EK    F ++++L  +R   
Sbjct: 79  LQKEFLISHNEKLSDRLNENSIEFNDKFNSV--VIDNLNNEKNLILFEKKLNLLNERYSI 136

Query: 299 LLESQVSSMKSDLENA----YQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEA 354
           +++ Q   + +D+ N+    ++S N+             ++I    N+++ +++  KL A
Sbjct: 137 IIKDQKDVIDNDINNSKYLEFKSLNE-------------KIIKQNSNMKSMESKIEKLNA 183

Query: 355 TVNELLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQ 414
            ++  + +N        N N +  SLD           D  +LKK LV E+    +LQ +
Sbjct: 184 IIHNFIDIN-----EFDNENTNKYSLD---------LNDNKVLKKLLVHEKNSNLKLQEE 229

Query: 415 VESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNY 474
           + S ++EL  K+P L S KE+   L+    ++    E   +Q    T ++    NKI +Y
Sbjct: 230 LNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDY 289

Query: 475 ESQVCSLIVQRSDL 488
           E  +  L+ QR++L
Sbjct: 290 EQSLKQLLSQRTNL 303

 Score = 33.1 bits (74), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 1626 LEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSKIP--ID 1683
            +E + D+++ +V  K FE GK      + LLE K++ LE Q      NN   +KI   I+
Sbjct: 858  MEREMDDKMKVVEMKGFESGKASSEKTLNLLEHKLSLLEKQ------NNEKSNKINTLIE 911

Query: 1684 NNNNSSPQGAQPIAI 1698
            + NN+  Q   P   
Sbjct: 912  SENNNKTQKINPFTF 926

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score = 41.2 bits (95), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 116/244 (47%), Gaps = 35/244 (14%)

Query: 904  DDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKA--LEESQANYRK 961
            D++ +KIE L K+  ++  N    + +++ YK     +E+   ++ K   L++ QA ++ 
Sbjct: 222  DELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQVDKKNELQKFQALWK- 280

Query: 962  NIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDE 1021
             +  LEQ+++ LTD+++  N +I  L   ++++    Q  KS  +K+ +++   +  LD 
Sbjct: 281  -LYHLEQKKEELTDKLSASNSEIMSLKERINNETKSLQRSKSSFVKESTVISKQKSKLDY 339

Query: 1022 LK------------------------SEYEEKISKLQEDLTQQASYANQAQKNYEQELQK 1057
            +                         S  E++I  LQ DL +Q SY  +    +E +L+ 
Sbjct: 340  IVKDKEKLMSDLRLIKVPQQAAGRRISHIEKRIGSLQRDLERQESYVER----FETQLKV 395

Query: 1058 HADVTKTISLLREESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQR 1117
               +TK+     EE ++     + FK + S+ K+    +E+   Q  + LE ++SL+   
Sbjct: 396  ---ITKSKKTFEEEIKESARNYDKFKLNESDLKTYDSLHEKYLTQGGSILEEKISLSNND 452

Query: 1118 TEEL 1121
             +E+
Sbjct: 453  KQEI 456

>SAKL0C11374g Chr3 complement(1025308..1025784) [477 bp, 158 aa]
           {ON} highly similar to uniprot|Q12165 Saccharomyces
           cerevisiae YDL004W ATP16 Delta subunit of the central
           stalk of mitochondrial F1F0 ATP synthase which is a
           large evolutionarily conserved enzyme complex required
           for ATP synthesis
          Length = 158

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 653 NLAEQSQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQ--STLSLTKEE 710
           NL  QS   I +L + +  + +    V  + EQ  S K         +Q  STLS+T  E
Sbjct: 51  NLPAQS-GQIGVLANHVPTVEQLAPGVVEVFEQGSSKKYFVSGGFATVQPDSTLSITSVE 109

Query: 711 NLELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQL 746
              L K S +  R LL +  K  S+ DE +A ++ +
Sbjct: 110 AFPLEKFSQENVRSLLAEANKNTSSADEKVAAEAAI 145

>ZYRO0G20262g Chr7 complement(1674553..1675179) [627 bp, 208 aa] {ON}
            similar to uniprot|Q04477 Saccharomyces cerevisiae
            YMR117C SPC24 Component of the evolutionarily conserved
            kinetochore-associated Ndc80 complex
            (Ndc80p-Nuf2p-Spc24p- Spc25p) involved in chromosome
            segregation spindle checkpoint activity and kinetochore
            clustering
          Length = 208

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 55/97 (56%), Gaps = 2/97 (2%)

Query: 948  ISKALEESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDH--QKSQNQSEKSEL 1005
            I + L++ QA  R+ +A  E E  +L  Q+   NDQ+ +L + LD   Q+SQ  + + ++
Sbjct: 33   IDEKLDQIQAQSRQKLASKEGEISTLESQLKTENDQVNELTTSLDRVRQESQELASQRQI 92

Query: 1006 IKKLSILQGSQRSLDELKSEYEEKISKLQEDLTQQAS 1042
            +  +  L   ++S+  ++SE +EKI KL +D   Q S
Sbjct: 93   VDYVKELDELEQSIVSMRSELDEKIVKLVKDTRDQDS 129

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 37.4 bits (85), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 96/190 (50%), Gaps = 14/190 (7%)

Query: 75  FKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASA 134
           FK     LLS+V + Q++KQ  E E +++ + +  L  E+ K R++VE+ K+ +    + 
Sbjct: 310 FKIASNALLSEVENSQRQKQGKESEYIQVKSTQRSLIEELGKQRTEVEDLKKKVTYYRTR 369

Query: 135 KQDVTKLLEEKISDLAASKEESDRLLAANKE----LRKSSIDLEFIIQGYKSQELREKSE 190
           ++++ + +E+   D+A+ ++    L+   +E      +  +DL      ++ +     S+
Sbjct: 370 RENIRRKVEKAEQDIASRQQLLGSLVLPTQEEMDNYEQQRVDLYEQESAFEQKVEEMDSK 429

Query: 191 IQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARAN 250
           ++ L++EL  +KS  +   KEL S N+ LN+ R +T         ++  +K   EF R  
Sbjct: 430 VRALNRELTTIKSKLERRKKELAS-NDSLNALRGQTG--------RLEEVKKACEFVRI- 479

Query: 251 NSTLKAKTAE 260
           +  +K K  E
Sbjct: 480 HPEMKGKVLE 489

>AAL085C Chr1 complement(192432..193783,193783..194932) [2502 bp,
           833 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR285W (ZIP1); artificial frameshift
          Length = 833

 Score = 37.0 bits (84), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 71/144 (49%), Gaps = 10/144 (6%)

Query: 227 NSELQNGYEQVNSLKSQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEF 286
           N++L    E VNSL       R +NS L  +  +L  +L  K+ E  ++ + L +EK  F
Sbjct: 533 NAQLLQSGESVNSL-------RESNSALDKQVIQLGLELTRKVEENTRICEELTSEKATF 585

Query: 287 TREMSLKQRLIDLLESQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQ 346
            ++   ++ ++ LL  +  S+KS LE   Q   +   +  +K + LD+    +++L    
Sbjct: 586 EQKFEAQKEVVKLLTHEAESLKSRLE---QCEGEATAAKKDKQEALDKFQQLQEHLHKLN 642

Query: 347 AENIKLEATVNELLSVNGKNGVAV 370
            + ++L+A   EL+  N K  V V
Sbjct: 643 VDAVQLKAHELELVEENRKLKVTV 666

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 115/244 (47%), Gaps = 35/244 (14%)

Query: 904  DDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKA--LEESQANYRK 961
            D++ +KIE L K+  ++  N    + +++ YK     +E+   ++ K   L+  QA ++ 
Sbjct: 188  DELKEKIEKLGKSATESIKNRRRIHGELKTYKEGINKNEEYIKQVDKKNELQRFQALWQ- 246

Query: 962  NIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDE 1021
             +  LEQ+++ L D+++  N ++  L  +++++    Q  KS  +K+ +I+   +  L+ 
Sbjct: 247  -LYHLEQQKEELMDKLSASNSEVSSLKEKINNEMKSLQRSKSSFVKEGTIISKQKSKLEY 305

Query: 1022 LK------------------------SEYEEKISKLQEDLTQQASYANQAQKNYEQELQK 1057
            +                         S  E++I  LQ DL +Q +Y  +    +E +L+ 
Sbjct: 306  IVKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQRDLGRQEAYVER----FETQLKV 361

Query: 1058 HADVTKTISLLREESQKYKSEMEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQR 1117
               VTK+     EE ++     E FK + ++ K+    +E+   Q  + LE ++SL+   
Sbjct: 362  ---VTKSKKTFEEEIKESARNYEKFKLNENDLKTYDLLHEKYLTQGGSVLEEKISLSNNH 418

Query: 1118 TEEL 1121
             +E+
Sbjct: 419  KQEI 422

>ADL037W Chr4 (628992..631655) [2664 bp, 887 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YLR309C (IMH1)
          Length = 887

 Score = 35.4 bits (80), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 75/140 (53%), Gaps = 19/140 (13%)

Query: 972  SLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEEKIS 1031
            +L +Q+ LLNDQ K L ++++  K + +  +SEL+K       SQ ++ + +++  +   
Sbjct: 417  TLKEQLQLLNDQKKALETDVEQHKRKMEDLESELLK-------SQENVSKFRNQNNDLSE 469

Query: 1032 KLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASEAKS 1091
            KL++ +  + S A       ++E        KTI  L E+ ++Y S+    K++ +++K+
Sbjct: 470  KLRDYIVLKKSEATTRMSLSQKE--------KTIEYLEEQVRQYNSKEIEDKKAFADSKT 521

Query: 1092 ALERNEQSWCQQVADLESQL 1111
             LER    W +  A+LE QL
Sbjct: 522  ELER----WQRTAANLEKQL 537

>CAGL0D00638g Chr4 complement(80947..83028) [2082 bp, 693 aa] {ON}
            similar to uniprot|Q07457 Saccharomyces cerevisiae
            YDL074c BRE1
          Length = 693

 Score = 35.0 bits (79), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 106/383 (27%), Positives = 175/383 (45%), Gaps = 71/383 (18%)

Query: 687  RSSKVLAEERLKL-IQSTLSLTKEENLELHKRSDDLQRVLLKQDEKTQSTIDEIIATKSQ 745
            +SS +  EE+ KL +Q    +T   +LE H  S  L R++ + +   Q    E+  T+ +
Sbjct: 236  QSSGITEEEKKKLFLQYENKIT---DLESHNSS--LNRIIEELENYKQLNEKELAQTRLE 290

Query: 746  LSNLTSKLAILTSER-DFLRKIEAELKNENEALTKENTTSKILVSQLQTLQRERDILLEE 804
            +SNL S+      ER D L +IE +LK  N  LT    T++  +S+ Q L +E+D   E+
Sbjct: 291  ISNLLSEKHSNEEEREDLLHQIE-KLKASNTDLT---LTNESFLSKFQELAKEKDTFQEK 346

Query: 805  AQTNYRKNIEKL-------ESDL---HETREHLVRRTREYEEQR-----VSDTSQY---- 845
              +++ K +E L       E DL     TR+ L+ +    E +      +SD  Q     
Sbjct: 347  ISSDFEKTLESLKAQNLALEKDLVRVRTTRDELISKVAILEAETSKSVLISDLKQALDIL 406

Query: 846  --KWFQAKVDSLNEQ-------------LDNARKTLQEKTNSIETLQLHAKSLTAKL--E 888
              +W   K++  N Q             L++A K L   T+   +  L+ +S+ +KL  E
Sbjct: 407  RDQW--EKIEFRNNQSPSSDALLKEIQDLESAFKELSSLTHKKYSEYLNHESVISKLTIE 464

Query: 889  EAELRTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEI 948
            + +   + ++ + + D I  + + L K+L KAN         I Q K   K+ +Q    +
Sbjct: 465  KTKADQKYFASMRSKDSILVENKNLSKSLNKAN-------ELILQLKDTDKLYKQKIESL 517

Query: 949  SKALEESQANYRKNIALLEQERKSLTDQIALLNDQIKDLNSELDHQK---SQNQSEKSEL 1005
             K L  SQ N            K L D     N ++ +LNSE+  QK       S+K+EL
Sbjct: 518  HKQLALSQNN-----------EKRLVDSNKAANLKVMNLNSEIQKQKKLLDFTSSQKNEL 566

Query: 1006 IKKLSILQGSQRSLDELKSEYEE 1028
            I +L+   G  +S  EL+ E++E
Sbjct: 567  INELTEANGMLKS-KELEIEFKE 588

>KAFR0E00440 Chr5 complement(97048..98451) [1404 bp, 467 aa] {ON}
           Anc_1.490 YEL047C
          Length = 467

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 53/118 (44%), Gaps = 12/118 (10%)

Query: 627 GDSAPSSTYQSKKLD---EHIMELEKRLKNLAEQSQDNIKLLNDE--IKALYKAKSEVTV 681
           G S P +   S KL    E +  L KRLK+LAE + D +K+  D   +     A++EVT 
Sbjct: 116 GHSVPRTHRSSGKLPPGFEIVSVLSKRLKDLAESNPDLVKIFLDSKVVDVKVNAQNEVTG 175

Query: 682 ILEQERSS--KVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEKTQSTID 737
           I  + +    K L   ++       S +KE    L K + DL  V L      Q+T D
Sbjct: 176 IEYENKDGENKTLDSNKVVFCSGGFSFSKE---MLSKYAPDL--VKLPTTNGAQTTGD 228

>Ecym_5345 Chr5 complement(699527..703627) [4101 bp, 1366 aa] {ON}
            similar to Ashbya gossypii AER045C
          Length = 1366

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 117/421 (27%), Positives = 183/421 (43%), Gaps = 87/421 (20%)

Query: 733  QSTIDEIIATKSQL----SNLTSKLAILTSERDFLRKIEAE-----LKNENEALTKENTT 783
            +S I+ ++A KS L    +NL  +L  +  E + L K+E E     L +EN  L  EN  
Sbjct: 955  KSEIETLVAEKSILDQKSNNLEVQLGKIQRELE-LAKVEVEDSKTKLSDENSRL-HENL- 1011

Query: 784  SKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTS 843
             K L  QL ++  ERD      Q   +   E L  DL +    + +   +YE    S   
Sbjct: 1012 -KNLKDQLSSITSERD------QQKLKS--ESLAGDLTKVSAEIKKLQNDYE----SLIK 1058

Query: 844  QYKWFQAKVDSLNEQLDNA---RKTLQ-----------EKTNSIETLQLHAKSLTAKLEE 889
            + K   + +DS NE+L  +   R TL+           E    IE L L  KS TA L E
Sbjct: 1059 KLKVTNSDLDSCNERLKQSQIERDTLELEFKTISTQNSELQKKIEDLTLENKSNTASLSE 1118

Query: 890  -----------------AELRTQSYSVLANADDITDKIETLRKNL----EKA-------N 921
                              ELRT   +V AN D    K++ L +NL    EK+       N
Sbjct: 1119 DIFQNDSTVDKSDEFELEELRTALKNVTANYDAAKAKVDELERNLRVLSEKSKNNDYNDN 1178

Query: 922  INLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQERKSLTDQIALLN 981
              L    SQI  YK     +E +  ++ KA EE +  +R  + L E E+ S   +  +  
Sbjct: 1179 SELKKLQSQIADYKGKLSNTETNYTDLKKAYEELEKTHR--LTLKEAEKSSTNSKSQV-- 1234

Query: 982  DQIKDLNSELDHQKS-------QNQSEKSELIKKLSILQGS-QRSLDELKSEYEEKISKL 1033
             Q+ DL+S++++ K        ++ SEK++L  +L  L+   Q   DE+ ++     +KL
Sbjct: 1235 GQVSDLSSDVENSKGGKDDYIVESNSEKAQLETELENLKNQLQIQRDEMAAKNNLLDTKL 1294

Query: 1034 QEDLTQQASYANQAQKNYEQELQKHA-------DVTKTISLLREESQKYKSEMEGFKRSA 1086
             E L      +N  +   EQ  +K A       D+   +S L E++QKY+++++      
Sbjct: 1295 AE-LAVIHEESNDLRSKLEQFQKKAANSESERDDLILLVSELDEKNQKYRAKLQTLGHPV 1353

Query: 1087 S 1087
            S
Sbjct: 1354 S 1354

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score = 34.7 bits (78), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 74/133 (55%), Gaps = 4/133 (3%)

Query: 904  DDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKA--LEESQANYRK 961
            D++ +KIE L K+  ++  N    + +++ YK     +E+   ++ K   L++ QA ++ 
Sbjct: 186  DELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQVEKKSELQKFQALWQ- 244

Query: 962  NIALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDE 1021
             +  LEQ+++ LTD+++  N +I  L  +++H+    Q  KS  +K+ +++   +  L+ 
Sbjct: 245  -LYHLEQQKEELTDKLSASNSEISSLKEKINHEMKSLQRSKSSFVKESAVISKQKSKLNY 303

Query: 1022 LKSEYEEKISKLQ 1034
            +  + E+ +S L+
Sbjct: 304  IIKDKEKLVSDLR 316

>TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa] {ON}
            Anc_1.81 YNL272C
          Length = 795

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 5/66 (7%)

Query: 1401 GEADSLKEELEELRAN-FIEANEAVADIKAEAASSEKDLKNQIQELTEKIKTLESEIEHS 1459
            GE  +L +E+E+L A+ F EAN  VAD + E A+ E  L+N   +L E++K  ++ +E  
Sbjct: 95   GECTALNKEVEDLTASLFDEANHMVADARKEKAAVE--LRN--TKLMEQLKEKDTVLETL 150

Query: 1460 ELEAKN 1465
            EL+ KN
Sbjct: 151  ELQLKN 156

>KLTH0D09504g Chr4 (783223..785379) [2157 bp, 718 aa] {ON} weakly
           similar to uniprot|Q08581 Saccharomyces cerevisiae
           YOR195W SLK19 Kinetochore-associated protein required
           for normal segregation of chromosomes in meiosis and
           mitosis component of the FEAR regulatory network which
           promotes Cdc14p release from the nucleolus during
           anaphase potential Cdc28p substrate
          Length = 718

 Score = 33.5 bits (75), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 108/226 (47%), Gaps = 20/226 (8%)

Query: 64  LKCNFEQKINTFK---EQVEKLLSDVA--SRQQEKQQTEDEKLKLMNEKAQ-LSMEVLKL 117
           L+ + E   N+ K   E++E+  +++A  +  + K Q+E+E LKL   KAQ L  E  K 
Sbjct: 329 LRVHIENTTNSKKRVEEEIERTRAELALLTEGKFKTQSENEDLKLSVSKAQTLLAEKTKF 388

Query: 118 RSQVEEAKQGMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFII 177
              +EE +  +      KQ  T  LE++I+DL   K E  R L     LR    + E  I
Sbjct: 389 ---IEELQANLRASHDTKQKSTIELEQRINDLTLEKNELVRELEDMSTLRSKIEESENEI 445

Query: 178 QGYKSQELREKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQV 237
           Q  K++  R +  +Q L +E + ++ +   L  EL++ +++L    E  N +L     +V
Sbjct: 446 QSVKTELDRTQVALQHLKEEHSELREHCRSLEAELKTSHQKL----ETANDQLAIKSAEV 501

Query: 238 NSLKSQLEFARANNSTLK-------AKTAELSNQLQEKLVETKKLA 276
             L   ++  R   S L+       A  +E +++ +EK  E  KL+
Sbjct: 502 VELGHDVKELRQGKSHLEDSLKLRDASISEWNSKYEEKCAENNKLS 547

>Smik_6.84 Chr6 (157421..159940) [2520 bp, 839 aa] {ON} YFR002W (REAL)
          Length = 839

 Score = 33.9 bits (76), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 11/108 (10%)

Query: 979  LLNDQIKDLNSELDHQKSQNQSE-KSELIKKLSILQGSQRSLDELKSEYEEKISKLQEDL 1037
            LLN   KD ++ ++H  S + S+ K+E++K   IL   +++LD  KS     IS L   L
Sbjct: 128  LLNGATKDFDNFINHNLSLDWSQHKNEVMKNFGILIHDKKTLDHKKS-----ISSLDPKL 182

Query: 1038 TQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRS 1085
                S  N    + E  L  + +     ++LRE+ + Y   +  F  S
Sbjct: 183  PSWGSKGNNILNSNESRLNVNEN-----NILREKFENYARVVFQFNNS 225

>ZYRO0G04312g Chr7 (344316..345917) [1602 bp, 533 aa] {ON} weakly
            similar to uniprot|Q08157 Saccharomyces cerevisiae
            YOL019W Protein of unknown function green fluorescent
            protein (GFP)-fusion protein localizes to the cell
            periphery and vacuole
          Length = 533

 Score = 33.5 bits (75), Expect = 6.0,   Method: Composition-based stats.
 Identities = 33/137 (24%), Positives = 58/137 (42%), Gaps = 9/137 (6%)

Query: 992  DHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEEKISKLQEDLTQQASYANQAQKNY 1051
            D+ K QN     E + K+     S +S  E K   EE+  +L  + + + SY N  +  Y
Sbjct: 227  DYAKRQN----PEPVFKVDT-ASSDKSWKE-KHAAEERTRELSREHSYENSYENSYENLY 280

Query: 1052 EQELQKHADVTKTISLLREESQKYKSEMEG---FKRSASEAKSALERNEQSWCQQVADLE 1108
            ++ L    +  +  S++R +SQ    E +        +SE    ++RN  S       ++
Sbjct: 281  DEPLAVSNNPQQAASVIRSDSQLGSPEKQAHSMLSMGSSEYSEPVQRNTDSRAVLEDIIK 340

Query: 1109 SQLSLAQQRTEELNTQN 1125
              L    Q TE  + Q+
Sbjct: 341  DTLGTGDQHTEVSDHQD 357

>SAKL0H21208g Chr8 (1848202..1849437) [1236 bp, 411 aa] {ON} similar
           to uniprot|P48236 Saccharomyces cerevisiae YGR149W
           Hypothetical ORF
          Length = 411

 Score = 33.1 bits (74), Expect = 6.9,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 8/113 (7%)

Query: 208 LSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLK----AKTAELSN 263
           +S ++E   E+ +  +E  N  L N  E ++ + S ++         K    A+    S+
Sbjct: 1   MSDQIE---EEFDGMKETLNVTLSNILELLDPISSTVQSYSIAEQPKKYLSNARRKFKSS 57

Query: 264 QLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDL-LESQVSSMKSDLENAY 315
           +  +KL + K  A   + + EEF R+  LK + ID  LES      S+LE ++
Sbjct: 58  RTHQKLTKLKSSAQDFSPQLEEFKRKTLLKLQSIDKPLESIFFQNSSNLEKSF 110

>SAKL0C10450g Chr3 (950474..952876) [2403 bp, 800 aa] {ON} similar to
            uniprot|Q12387 Saccharomyces cerevisiae YOL076W MDM20
            Subunit of the NatB N-terminal acetyltransferase which
            catalyzes acetylation of the amino- terminal methionine
            residues of all proteins beginning with Met-Asp or
            Met-Glu and of some proteins beginning with Met-Asn or
            Met-Met involved in mitochondrial inheritance and actin
            assembly
          Length = 800

 Score = 33.1 bits (74), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 75/160 (46%), Gaps = 18/160 (11%)

Query: 912  TLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQERK 971
            T+ + L+KA+ +  D        K+M+ V E  + ++ + L E+ A++++ I +L +  +
Sbjct: 650  TVDEYLQKADASFVD--------KNMSAV-ESWSFQVFRYLYENGADHKELIGILREMPE 700

Query: 972  SLTDQIALLNDQIKDLNSE---LDHQKSQNQSEKSELIK-KLSILQGSQRSLDELKSEYE 1027
            +      LLN     L +    LD+ K     E   LIK KL  L+GS    DE+  EY 
Sbjct: 701  ARGTDTWLLNHSYLGLLTTFKTLDNLKKIKDKEVRALIKNKLRDLRGS---CDEMFQEYA 757

Query: 1028 EKISKLQE--DLTQQASYANQAQKNYEQELQKHADVTKTI 1065
            EK+ K +   DL   A      +   ++ +    D +KT+
Sbjct: 758  EKVLKCKNSIDLALLAGLGYTHEATVDRIVAAIKDTSKTV 797

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1223

 Score = 33.1 bits (74), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 118/276 (42%), Gaps = 91/276 (32%)

Query: 720 DLQRVLLKQDE------KTQSTIDEII-ATKSQLSNLTSKLAILTSERDFLRKIEAELKN 772
           DLQR ++  DE      K  + I+E I A ++QL+ ++ +                    
Sbjct: 318 DLQRQVVSYDEQSDLNRKNLAIINEAIEAKQAQLAKISPRF------------------- 358

Query: 773 ENEALTKENTTSKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTR 832
             E+L+KE  + K+ ++ LQ  +++RD+LL + + ++ + +E+                 
Sbjct: 359 --ESLSKEEVSYKLELAGLQ--EKQRDLLLMKGKYSHFQTVEE----------------- 397

Query: 833 EYEEQRVSDTSQYKWFQAKVDSLNE----------QLDNARKTLQEKTNSIETLQLHAKS 882
                      + +W + ++ SLNE          Q+DN R  L EK N+ E        
Sbjct: 398 -----------RNEWIEGELRSLNETLANTTHLKSQIDNERNELHEKLNATE-------- 438

Query: 883 LTAKLEEAELRTQSYSVLANADDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSE 942
              +++E E   +   V+A  +DI  K+  L+          A+   +I + K + + SE
Sbjct: 439 --EQIQELEDSVRGPGVVAEIEDIEKKVNDLK----------AEYVEKINERKELWR-SE 485

Query: 943 QSAVEISKALEESQANYRKNIALLEQERKSLTDQIA 978
           Q    IS+ L ++  N  ++++  E   KSL + IA
Sbjct: 486 QKLQTISETLLDTVKNSERSVS--ETMAKSLANGIA 519

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score = 33.1 bits (74), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 42/69 (60%)

Query: 966  LEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSE 1025
            LEQ+++ LTD+++ LN +I  L  +++++    Q  KS  +K+ +++   +  LD +  +
Sbjct: 245  LEQQKEELTDKLSALNSEISSLKGKINNEMKSLQRSKSSFVKESAVISKQKSKLDYIFKD 304

Query: 1026 YEEKISKLQ 1034
             E+ +S L+
Sbjct: 305  KEKLVSDLR 313

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score = 33.1 bits (74), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 73/141 (51%), Gaps = 15/141 (10%)

Query: 932  EQYKSMAKVSEQSAVEISKALEESQAN------YRKNIALLEQERKSLTDQIALLNDQIK 985
            E+Y+S+  + ++  V+I +    S+A          NI+L+  E  S+  QI+ L   ++
Sbjct: 677  EEYQSLMTLKDKILVQIEEVGSHSRACSIRARELEGNISLIYSEASSIRTQISQLKRALE 736

Query: 986  DLNSELDHQ----KSQNQSEKSELIKKLSILQGSQRSLDELKSE-----YEEKISKLQED 1036
            D N+++++     K +   +  EL +KL+I+  S++ L+E K       ++E   KL   
Sbjct: 737  DTNTDIEYHQNLIKQEYDPKIQELEQKLAIINDSRKQLEEEKDSLQTQTFKEFTDKLGFS 796

Query: 1037 LTQQASYANQAQKNYEQELQK 1057
            + +  +++  A++   +ELQ+
Sbjct: 797  MKEYETHSGDAKRQQSKELQQ 817

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.123    0.308 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 161,885,823
Number of extensions: 7148560
Number of successful extensions: 79818
Number of sequences better than 10.0: 3480
Number of HSP's gapped: 68787
Number of HSP's successfully gapped: 8396
Length of query: 1769
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1645
Effective length of database: 39,262,815
Effective search space: 64587330675
Effective search space used: 64587330675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)