Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40165.705ON1251256568e-90
TDEL0B021505.705ON91742442e-27
KLLA0A00539g5.705ON87732432e-27
TPHA0E002005.705ON85732415e-27
Kwal_YGOB_Anc_5.7055.705ON88742381e-26
KLTH0E00990g5.705ON89742372e-26
YKR095W-A (PCC1)5.705ON88952363e-26
SAKL0E14982g5.705ON89742363e-26
Kpol_YGOB_1043.725.705ON88742353e-26
Skud_11.3355.705ON94742363e-26
Suva_11.3325.705ON111762364e-26
KAFR0H001905.705ON82742292e-25
Smik_11.3595.705ON88742293e-25
TBLA0G010305.705ON89732268e-25
NCAS0A031805.705ON88732206e-24
ZYRO0B16368g5.705ON85762121e-22
NDAI0E050605.705ON86772093e-22
KNAG0C066205.705ON101882104e-22
AFR289W5.705ON81731702e-16
CAGL0G02535g5.705ON140551393e-11
ZYRO0G20680g1.319ON69281740.15
ZYRO0A01386g2.237ON102157710.34
KAFR0H016208.466ON33049661.3
TBLA0D028108.466ON30649661.5
TBLA0A018006.157ON20959632.9
NDAI0C03250na 1ON20864623.8
KLTH0B08316g2.16ON95096608.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4016
         (125 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...   257   8e-90
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...    99   2e-27
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...    98   2e-27
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...    97   5e-27
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...    96   1e-26
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...    96   2e-26
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...    96   3e-26
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...    96   3e-26
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...    95   3e-26
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...    96   3e-26
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...    96   4e-26
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...    93   2e-25
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...    93   3e-25
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...    92   8e-25
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...    89   6e-24
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...    86   1e-22
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...    85   3e-22
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...    86   4e-22
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    70   2e-16
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    58   3e-11
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...    33   0.15 
ZYRO0A01386g Chr1 (110661..113726) [3066 bp, 1021 aa] {ON} highl...    32   0.34 
KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON...    30   1.3  
TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON...    30   1.5  
TBLA0A01800 Chr1 (439946..440575) [630 bp, 209 aa] {ON} Anc_6.15...    29   2.9  
NDAI0C03250 Chr3 (739350..739976) [627 bp, 208 aa] {ON}                28   3.8  
KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some s...    28   8.8  

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score =  257 bits (656), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 125/125 (100%), Positives = 125/125 (100%)

Query: 1   MKQSREQSMDYKLYVSLAALESNKNLVCATSFLKKSLDHRSLTLPSPNRCLEVPFENGKQ 60
           MKQSREQSMDYKLYVSLAALESNKNLVCATSFLKKSLDHRSLTLPSPNRCLEVPFENGKQ
Sbjct: 1   MKQSREQSMDYKLYVSLAALESNKNLVCATSFLKKSLDHRSLTLPSPNRCLEVPFENGKQ 60

Query: 61  AEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVIESIKTVVETM 120
           AEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVIESIKTVVETM
Sbjct: 61  AEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVIESIKTVVETM 120

Query: 121 DEFSL 125
           DEFSL
Sbjct: 121 DEFSL 125

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 bp,
           91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score = 98.6 bits (244), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 57/74 (77%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           LE+PF+   QA IA++VL  DP+L+P+DF+VDYT     L+V F SID R LRVGVSSVI
Sbjct: 9   LEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRVGVSSVI 68

Query: 111 ESIKTVVETMDEFS 124
           +SIKT+VET+DE  
Sbjct: 69  DSIKTIVETIDELG 82

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp, 87
           aa] {ON} highly similar to uniprot|Q3E833 Saccharomyces
           cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score = 98.2 bits (243), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 45/73 (61%), Positives = 61/73 (83%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           LE+PFE+ KQA++AR+VL  DP+++PEDF+V Y+ Q  KL+ +F S+D R LRVGV+SVI
Sbjct: 14  LEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRVGVNSVI 73

Query: 111 ESIKTVVETMDEF 123
           ESIKT+VET+DE 
Sbjct: 74  ESIKTIVETIDEL 86

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, 85
           aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score = 97.4 bits (241), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 45/73 (61%), Positives = 57/73 (78%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           L +PFE  KQA IA +VL  DP LRPE+F+VDY+ Q   L+VNF S+D R LRVGVS+VI
Sbjct: 10  LNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNVI 69

Query: 111 ESIKTVVETMDEF 123
           +SIKT++ET+DE 
Sbjct: 70  DSIKTIIETIDEL 82

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [267
           bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score = 96.3 bits (238), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 47/74 (63%), Positives = 56/74 (75%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           LEVPF+N KQA  A +VL  DP+L+P+DF V+YT     L V F  +D R LRVGVSSVI
Sbjct: 15  LEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLRVGVSSVI 74

Query: 111 ESIKTVVETMDEFS 124
           ESIKT+VET+DEFS
Sbjct: 75  ESIKTIVETIDEFS 88

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp, 89
           aa] {ON} similar to uniprot|Q3E833 Saccharomyces
           cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score = 95.9 bits (237), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 58/74 (78%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           LEVPF+  KQAE A +VL  DP+L+P+DF V+Y+ +   L V+F  +D R LRVGVSSVI
Sbjct: 15  LEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRVGVSSVI 74

Query: 111 ESIKTVVETMDEFS 124
           ESIKT++ET+DEFS
Sbjct: 75  ESIKTIIETIDEFS 88

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
           {ON}  PCC1Component of the EKC/KEOPS protein complex
           with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
           complex is required for t6A tRNA modification and may
           have roles in telomere maintenance and transcription
          Length = 88

 Score = 95.5 bits (236), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 52/95 (54%), Positives = 67/95 (70%), Gaps = 8/95 (8%)

Query: 30  TSFLKKSLDHRSLTLPSPNRCLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEK 89
           TS  +KSLDH   TL      L++PFE  +QA IA +VL  DP+L+P+DF+VDY+ +   
Sbjct: 2   TSKREKSLDH---TLE-----LKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNV 53

Query: 90  LLVNFNSIDARSLRVGVSSVIESIKTVVETMDEFS 124
           +LV F SID R LRVGVSS+I+SIKT+VE MD  S
Sbjct: 54  MLVQFRSIDDRVLRVGVSSIIDSIKTIVEAMDVLS 88

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
           aa] {ON} similar to uniprot|Q3E833 Saccharomyces
           cerevisiae YKR095W-A PCC1 Proposed transcription factor
           involved in the expression of genes regulated by
           alpha-factor and galactose
          Length = 89

 Score = 95.5 bits (236), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (75%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           LE+P E   QA IA + L  DPVL+PEDF+V+Y+    KL V+F SID R LRVGVSSVI
Sbjct: 15  LEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVLRVGVSSVI 74

Query: 111 ESIKTVVETMDEFS 124
           ES+KT++ETMDEF 
Sbjct: 75  ESVKTIIETMDEFG 88

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp, 88
           aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score = 95.1 bits (235), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 57/74 (77%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
            E+PFE  +QAEIA +VL  DP+L+P+DF+V Y+     L++ F SID R LRVGVSSVI
Sbjct: 15  FEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLRVGVSSVI 74

Query: 111 ESIKTVVETMDEFS 124
           +S+KT++ETMDE S
Sbjct: 75  DSVKTIIETMDELS 88

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
           [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score = 95.5 bits (236), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 58/74 (78%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           L++PFE   QA IA +VL  DP+L+P+DF+VDY+ +   +LV F SID R LRVGVSSVI
Sbjct: 21  LQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSIDDRVLRVGVSSVI 80

Query: 111 ESIKTVVETMDEFS 124
           +SIKT+VET+DE S
Sbjct: 81  DSIKTIVETIDELS 94

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score = 95.5 bits (236), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 58/76 (76%)

Query: 49  RCLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSS 108
           R L++PFE  KQA IA  VL  DP+L+P+DF+ DY+ ++  +L  F SID R LRVGVSS
Sbjct: 36  RELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSS 95

Query: 109 VIESIKTVVETMDEFS 124
           VI+SIKT++ETMDE S
Sbjct: 96  VIDSIKTIIETMDELS 111

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, 82
           aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score = 92.8 bits (229), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 56/74 (75%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           LE+PFE+ KQA IA +VL  DP+LRP+DF+V Y  +    +  F SID R LRVGVS+VI
Sbjct: 9   LEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRVGVSNVI 68

Query: 111 ESIKTVVETMDEFS 124
           +S+KT++ETMDE S
Sbjct: 69  DSLKTIIETMDELS 82

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
           {ON} YKR095W-A (REAL)
          Length = 88

 Score = 92.8 bits (229), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 57/74 (77%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           L+VPF+  +QA IA  VL  DP+L+P+DF++DY+ +   +LV F SID R LRVGVSSVI
Sbjct: 15  LKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRVGVSSVI 74

Query: 111 ESIKTVVETMDEFS 124
           +SIKTVVE MDE S
Sbjct: 75  DSIKTVVEAMDELS 88

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
           {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score = 91.7 bits (226), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 42/73 (57%), Positives = 56/73 (76%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           L +PF   KQA+IA +VL  DP+LRP+DF+V YT +  +L++ F SID R LRVGVSSVI
Sbjct: 16  LNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVLRVGVSSVI 75

Query: 111 ESIKTVVETMDEF 123
           +S+KT++ET DE 
Sbjct: 76  DSVKTIIETFDEL 88

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 bp,
           88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score = 89.4 bits (220), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 42/73 (57%), Positives = 56/73 (76%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           LE+PF   +QA+IA +VL  DP+L+P+DF+V+Y  Q   L V+F  ID R LRVGVSSVI
Sbjct: 15  LEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVLRVGVSSVI 74

Query: 111 ESIKTVVETMDEF 123
           +SIKT++ET+DE 
Sbjct: 75  DSIKTIIETIDEL 87

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
           aa] {ON} similar to uniprot|Q3E833 Saccharomyces
           cerevisiae YKR095W-A
          Length = 85

 Score = 86.3 bits (212), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 41/76 (53%), Positives = 57/76 (75%)

Query: 48  NRCLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVS 107
           N  L +PF N + +E+A +VL  DP+LRPEDF+V+Y  +   L ++F S+D R LRVGVS
Sbjct: 7   NLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRVGVS 66

Query: 108 SVIESIKTVVETMDEF 123
           SVI+S+KT+VET+DE 
Sbjct: 67  SVIDSVKTIVETIDEL 82

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.705
           YKR095W-A
          Length = 86

 Score = 85.1 bits (209), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 43/77 (55%), Positives = 56/77 (72%), Gaps = 4/77 (5%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDY---TIQHEK-LLVNFNSIDARSLRVGV 106
           + +PF   + A IA++VL  DP+L+PEDF+V+Y     QH   LLV F SID R LRVGV
Sbjct: 10  IRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDERVLRVGV 69

Query: 107 SSVIESIKTVVETMDEF 123
           SSV++SIKT++ETMDE 
Sbjct: 70  SSVLDSIKTILETMDEL 86

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
           aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score = 85.5 bits (210), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 58/88 (65%), Gaps = 8/88 (9%)

Query: 36  SLDHRSLTLPSPNRCLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFN 95
           +LDH +LTL        VPFE  +QA IA +VL  DP+L+P+DF V Y  Q   L   F 
Sbjct: 10  ALDH-TLTL-------NVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFC 61

Query: 96  SIDARSLRVGVSSVIESIKTVVETMDEF 123
             DAR LRVGVSSVI+S+KT++E++DE 
Sbjct: 62  GRDARVLRVGVSSVIDSLKTIIESLDEL 89

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
           Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
           (PCC1); 1-intron
          Length = 81

 Score = 70.1 bits (170), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 46/73 (63%)

Query: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110
           L VPFE+ + A+IA   L  DP+LRPE+  V +      L +   +IDAR LRV  +S+ 
Sbjct: 7   LHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRVATNSIF 66

Query: 111 ESIKTVVETMDEF 123
           E++KTVVET DE 
Sbjct: 67  EALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
           [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
           Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
           unknown function
          Length = 140

 Score = 58.2 bits (139), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 37/55 (67%)

Query: 49  RCLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLR 103
           R L VPFE  + A IA+ VL  DP+LRPEDF+V+Y  +   L ++F +ID R LR
Sbjct: 29  RDLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score = 33.1 bits (74), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 32  FLKKSLDHRSLTLPSPNRCLEVPFENGKQAEIAREVLHHDPVLR----PEDFRVDYTIQ- 86
           FL+K +  ++L     NRCLE  +E  +Q + + E+L     LR     +    +  IQ 
Sbjct: 515 FLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQR 574

Query: 87  HEKLLVNFNSIDARSLRVGVS 107
            +KLL  FNS+  +  R+  S
Sbjct: 575 QDKLLQRFNSLSEKLGRINES 595

>ZYRO0A01386g Chr1 (110661..113726) [3066 bp, 1021 aa] {ON} highly
           similar to uniprot|P20967 Saccharomyces cerevisiae
           YIL125W KGD1 Component of the mitochondrial
           alpha-ketoglutarate dehydrogenase complex which
           catalyzes a key step in the tricarboxylic acid (TCA)
           cycle the oxidative decarboxylation of
           alpha-ketoglutarate to form succinyl-CoA
          Length = 1021

 Score = 32.0 bits (71), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 18  AALESNKNLVCATSFLKKSLDHRSLTLPSPNRCLEVPFENGKQA-EIAREVLHHDPV 73
           A +E ++  V   S  ++S +     +P+P   L  P+EN K   E+A E+L H+P 
Sbjct: 554 ADIEKHRQWVW--SLFEESFEKAKGYVPNPREWLTAPWENLKSPKEMATEILPHEPT 608

>KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON}
           Anc_8.466 YDL209C
          Length = 330

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%)

Query: 50  CLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSID 98
           C  V F N + AE A+E + +  +L P D   +   +   LLV + + D
Sbjct: 173 CAFVKFRNARNAEFAKEAMTNQTMLLPNDDEWENRTESTGLLVKWANDD 221

>TBLA0D02810 Chr4 complement(688830..689750) [921 bp, 306 aa] {ON}
           Anc_8.466 YDL209C
          Length = 306

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 50  CLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSID 98
           C  + F+N   AE A+EV+ +  +L P D   D   +   LLV + + D
Sbjct: 185 CAFIKFKNQCNAEFAKEVMSNQTLLIPSDKEWDERNEGTGLLVKWANDD 233

>TBLA0A01800 Chr1 (439946..440575) [630 bp, 209 aa] {ON} Anc_6.157
           YBR242W
          Length = 209

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 48  NRCLEVPFENGKQAEIAREVLHHDPVLRPEDFRVDY-TIQH--EKLLVNFNSIDARSLR 103
           NRC+ +   +     +  ++  HDP+ + E  R ++ TIQ+  ++L+  +N + A  ++
Sbjct: 78  NRCVRIALVHDIAESLVGDITPHDPIGKDEKHRREWETIQYLCDQLISKYNKVAAEEIK 136

>NDAI0C03250 Chr3 (739350..739976) [627 bp, 208 aa] {ON} 
          Length = 208

 Score = 28.5 bits (62), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 18 AALESNKNLVCATSF-LKKSLDHRSLTLPSPNRCLEVPFENGKQAEIAREVLHHDPVLRP 76
          +  + NK +V  T F ++ S+  +   L   N+C+E    NG Q+    +V+ H    + 
Sbjct: 5  STTDQNKEIVSITDFCIRYSIPRKIQNLWGFNKCIENQTNNGHQSSKDSKVIEHITNDQF 64

Query: 77 EDFR 80
          E+F+
Sbjct: 65 EEFK 68

>KLTH0B08316g Chr2 (673602..676454) [2853 bp, 950 aa] {ON} some
           similarities with uniprot|P25386 Saccharomyces
           cerevisiae YDL058W USO1 involved intracellular protein
           transport coiled-coil protein necessary for protein
           transport from ER to Golgi Integrin analogue gene
          Length = 950

 Score = 27.7 bits (60), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 9/96 (9%)

Query: 36  SLDHRSLTLPSPNRCLE--VPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVN 93
           S + R  +L S N  LE  +  E  K ++ A  VL  D V+       D   ++EK+LV 
Sbjct: 425 SYEARISSLKSANEDLEKGIELERTKSSKEAH-VLG-DTVVTLRQQLADAEKENEKILVR 482

Query: 94  FN-----SIDARSLRVGVSSVIESIKTVVETMDEFS 124
           FN      ++A +LR G+    + +K+VV  +++ S
Sbjct: 483 FNMLEKQHLEAENLRDGLEETNQELKSVVTRLEKIS 518

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,552,687
Number of extensions: 476479
Number of successful extensions: 1244
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1243
Number of HSP's successfully gapped: 35
Length of query: 125
Length of database: 53,481,399
Length adjustment: 94
Effective length of query: 31
Effective length of database: 42,702,795
Effective search space: 1323786645
Effective search space used: 1323786645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)