Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40155.706ON1257125762300.0
AFR290W5.706ON121795037550.0
SAKL0E15004g5.706ON119698029320.0
KLLA0A00528g5.706ON122995728960.0
Kwal_55.196785.706ON117896628010.0
KLTH0E00968g5.706ON114896427930.0
ZYRO0B16412g5.706ON137298827400.0
TDEL0B021405.706ON114797526270.0
KNAG0C066305.706ON1281102125060.0
Smik_11.3605.706ON118097724950.0
KAFR0H001805.706ON124198324820.0
Suva_11.3335.706ON118798124530.0
Skud_11.3365.706ON118898224400.0
Kpol_1043.735.706ON126097724340.0
NCAS0A031705.706ON1319104024160.0
YKR096W5.706ON119598623890.0
CAGL0H06611g5.706ON1282101323320.0
CAGL0G02541g5.706ON129597523180.0
TPHA0E001905.706ON1361100923180.0
YIL151C5.706ON111897422860.0
Suva_9.375.706ON111797222730.0
Smik_9.185.706ON111897922590.0
Skud_9.175.706ON111897822590.0
NDAI0E050705.706ON155638212441e-146
TBLA0E017105.706ON152641110861e-125
TPHA0D046405.706ON9628253456e-32
Smik_6.1504.214ON806191772.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4015
         (1257 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...  2404   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...  1451   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1134   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...  1120   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...  1083   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...  1080   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1060   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1016   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   969   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   965   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   960   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   949   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   944   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   942   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   935   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   924   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   902   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   897   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   897   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   885   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   880   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   874   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   874   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   483   e-146
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   422   e-125
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   137   6e-32
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    34   2.5  

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score = 2404 bits (6230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1175/1257 (93%), Positives = 1175/1257 (93%)

Query: 1    MEDPSTTSLQSQLHQKRQYSTNFDCYNHNIVKRRLAEHGIASPSLNEAEANDIDTPVDLI 60
            MEDPSTTSLQSQLHQKRQYSTNFDCYNHNIVKRRLAEHGIASPSLNEAEANDIDTPVDLI
Sbjct: 1    MEDPSTTSLQSQLHQKRQYSTNFDCYNHNIVKRRLAEHGIASPSLNEAEANDIDTPVDLI 60

Query: 61   SHSQDTVVIQPDHHQISSRLHNVVLPQSCFLGSGGEGAAALPRIKDQGQQVTLENPSKLA 120
            SHSQDTVVIQPDHHQISSRLHNVVLPQSCFLGSGGEGAAALPRIKDQGQQVTLENPSKLA
Sbjct: 61   SHSQDTVVIQPDHHQISSRLHNVVLPQSCFLGSGGEGAAALPRIKDQGQQVTLENPSKLA 120

Query: 121  QQPPYECTPRSPYYLPTTSSSNMEXXXXXXXXXXXXQVSGTTLHDSRLQVPSKFSQSPSC 180
            QQPPYECTPRSPYYLPTTSSSNME            QVSGTTLHDSRLQVPSKFSQSPSC
Sbjct: 121  QQPPYECTPRSPYYLPTTSSSNMEAAAKAIDSSSIKQVSGTTLHDSRLQVPSKFSQSPSC 180

Query: 181  VTRLHRALSSHNLFPVGNEQHSMIDKGVSCGYFQEAQIQRQSPMKNFVFTQQQCSFGESR 240
            VTRLHRALSSHNLFPVGNEQHSMIDKGVSCGYFQEAQIQRQSPMKNFVFTQQQCSFGESR
Sbjct: 181  VTRLHRALSSHNLFPVGNEQHSMIDKGVSCGYFQEAQIQRQSPMKNFVFTQQQCSFGESR 240

Query: 241  CXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREGNNNVGIXXXXXXXXXX 300
            C                                        REGNNNVGI          
Sbjct: 241  CNDANANDNIDNNDEGNNITSNNNNSNSSDTTNINTNSNTSREGNNNVGINSSSESNEDG 300

Query: 301  XXXXXXHNVSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLW 360
                  HNVSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLW
Sbjct: 301  DNGDNNHNVSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLW 360

Query: 361  VIYKLNAELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKN 420
            VIYKLNAELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKN
Sbjct: 361  VIYKLNAELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKN 420

Query: 421  FSNFMDPEVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKL 480
            FSNFMDPEVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKL
Sbjct: 421  FSNFMDPEVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKL 480

Query: 481  SAEHWYQEALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDN 540
            SAEHWYQEALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDN
Sbjct: 481  SAEHWYQEALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDN 540

Query: 541  IYQRAFAERNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSANF 600
            IYQRAFAERNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSANF
Sbjct: 541  IYQRAFAERNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSANF 600

Query: 601  FDPSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXX 660
            FDPSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCI        
Sbjct: 601  FDPSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKE 660

Query: 661  XXXXXXTASNQSDMSIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMR 720
                  TASNQSDMSIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMR
Sbjct: 661  KRKSKSTASNQSDMSIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMR 720

Query: 721  CSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESI 780
            CSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESI
Sbjct: 721  CSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESI 780

Query: 781  TNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDV 840
            TNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDV
Sbjct: 781  TNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDV 840

Query: 841  INSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF 900
            INSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF
Sbjct: 841  INSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF 900

Query: 901  PFGFTEFNGSDDWKSLVFKFNEPPAEWKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGM 960
            PFGFTEFNGSDDWKSLVFKFNEPPAEWKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGM
Sbjct: 901  PFGFTEFNGSDDWKSLVFKFNEPPAEWKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGM 960

Query: 961  VLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLE 1020
            VLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLE
Sbjct: 961  VLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLE 1020

Query: 1021 NELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFV 1080
            NELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFV
Sbjct: 1021 NELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFV 1080

Query: 1081 LDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLY 1140
            LDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLY
Sbjct: 1081 LDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLY 1140

Query: 1141 YERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNKDAKASG 1200
            YERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNKDAKASG
Sbjct: 1141 YERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNKDAKASG 1200

Query: 1201 RESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCTD 1257
            RESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCTD
Sbjct: 1201 RESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCTD 1257

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score = 1451 bits (3755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/950 (73%), Positives = 801/950 (84%), Gaps = 4/950 (0%)

Query: 309  VSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAE 368
            V TVAV +K SSQ L+EKLQEIY+NIV+QETELQ+RCSQLTTSQTTDLKNLW+IYK+NAE
Sbjct: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330

Query: 369  LIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPE 428
            LIDNYF FITTALLPTQP+ADLLIG+EIIEVYRIERRLW+YGTITFLDVLKNFSNFMDPE
Sbjct: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390

Query: 429  VCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQE 488
            VCCQFI+YVFISISN+LG+IPP FS+IWLERLGDLSRMAIALYPSGFIDWKLSAEHWY E
Sbjct: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450

Query: 489  ALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 548
            ALKY FGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE
Sbjct: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510

Query: 549  RNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSANFFDPSLIFV 608
            RNSGHHR +H+VEYLKHTEVMLLPSFLE+ E Q VVLAFF+QKFG T + +FFDP L+FV
Sbjct: 511  RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSNVDFFDPRLVFV 570

Query: 609  QDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXTA 668
            QD ERLKHFFRHASLYAESH+LQLVGFGDPRNPFALLFELPK +              + 
Sbjct: 571  QDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSST 630

Query: 669  SNQSDMSI-DDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLR 727
            S Q D SI DD     P +FFET++STK  Y+F  D+NIWKESL+Y N T+M+CSM+VLR
Sbjct: 631  STQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLR 690

Query: 728  KFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVL 787
            KFL+  LLTALPHLLPW YFL A   R+  I  ++ +RFW+  +RQ+FP+ +I  FLNVL
Sbjct: 691  KFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVL 750

Query: 788  LLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVS 847
            LLY+N+Q    FP DEY   +I+M L +L+ YFCENE+LPEVW CWGTLWFD +N+KH++
Sbjct: 751  LLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHIT 810

Query: 848  NLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFTEF 907
            NL DI+STGVKDHMF+D+P+DGISFDH+DESGEKFWKRC RVILLFR +A + P G  E 
Sbjct: 811  NLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGLREI 870

Query: 908  NGSDDWKSLVFKFNEPPAEWKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGMVLGTDIR 967
            +G  +W+SLVFKF EPP+EW + YL  F+  +  FE IS VN D ++ P+ GM    DIR
Sbjct: 871  SGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDTFEQISPVNLDQRATPYCGMTPDIDIR 930

Query: 968  TLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLENELLVTS 1027
            TLQGY+ L+PDY CFN+NGD+ITGSLYT G  E  SG+ +  +DF   KRLLEN  LV++
Sbjct: 931  TLQGYRILLPDYYCFNRNGDMITGSLYTIGTLE-SSGI-HGGDDFNG-KRLLENGELVST 987

Query: 1028 ERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWL 1087
            ERRDYN+L+D+EE PI+DEFL+  +   + RWEQ LPRGDL  F DTHVTYFVLDATTWL
Sbjct: 988  ERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADTHVTYFVLDATTWL 1047

Query: 1088 RHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLP 1147
            RHFGHVYKLA +N+LKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLP
Sbjct: 1048 RHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLP 1107

Query: 1148 LRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNKDAKASGRESITTI 1207
            LRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAI KAQ KFN LN DAKA+ R+ I T 
Sbjct: 1108 LRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRDCIPTG 1167

Query: 1208 DDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCTD 1257
             D +FNFIALVTDD+NMRNKA AQ+I+AFST+FMF++C+E+G +K VCT+
Sbjct: 1168 ADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHAKNVCTN 1217

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 47/87 (54%), Gaps = 7/87 (8%)

Query: 129 PRSPYYLPTTSSSNMEXXXXXXXXXXXXQVSGTTLHDSRLQVPSKFSQSPSCVTRLHRAL 188
           P SP YLPTTSSSN++            QVS TTLHD+RL++PS+ S SP  V     AL
Sbjct: 59  PGSPSYLPTTSSSNLDAAARAIDNSSLRQVSSTTLHDTRLELPSRLSSSPVQV-----AL 113

Query: 189 SSHNLFPVGNEQHSMIDKGVSCGYFQE 215
             +      + Q  ++D+    GY QE
Sbjct: 114 DPY--LTCADGQSCIVDRVEHFGYPQE 138

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1134 bits (2932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/980 (59%), Positives = 719/980 (73%), Gaps = 46/980 (4%)

Query: 309  VSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAE 368
            +  V VP K +SQ LV+KLQ+IY++IVKQE ELQERCSQLT SQTTD+KNLWVIYK+NAE
Sbjct: 232  IPIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAE 291

Query: 369  LIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPE 428
            LI+NY +FITTALLP+QP+ DLLIGQEI+E+YR+ERRLW+YGTITFLDVLKNFSNFMDPE
Sbjct: 292  LINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPE 351

Query: 429  VCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQE 488
            VCCQFI +VF+SISN+LG++PP +S+ WLERLGDLSRMAIALYPSGFIDWKLSAEHWY +
Sbjct: 352  VCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQ 411

Query: 489  ALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 548
            AL Y +GHGKLYYHMSTVQQNTL AFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAFAE
Sbjct: 412  ALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAE 471

Query: 549  RNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGA-TGSANFFDPSLIF 607
            R+ G  R   IVEYLKH+EVMLLPSFLE+ E Q VVL FF Q+FG    + +FFD   IF
Sbjct: 472  RSGGSSRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIF 531

Query: 608  VQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXT 667
            +QD E+L++FF HA  +AESHILQLVGFGDPRNPFA+LFELPK +              +
Sbjct: 532  IQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSS 591

Query: 668  ---------ASNQSDMSIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTS 718
                      +  S +S+D         +FE ++S +  Y F QD+ IW++SL+Y+N TS
Sbjct: 592  PPLPTNLDDGNGSSSISVD--------HYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTS 643

Query: 719  MRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWE 778
            M CSM VL+KFL++ LLTALPHLLPWA+FLV+V +R+ ++ ++  K+FW+VF+R+IFPW 
Sbjct: 644  MECSMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWN 703

Query: 779  SITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWF 838
            S+ +FLN L+ ++ D       +++    Y  M L  L+E+F  +E+LPEVW CWGTLWF
Sbjct: 704  SLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWF 763

Query: 839  DVINSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAY 898
            D I++K       + STG++DH+FLDAP+DGI FD  DESG KFWKR  RVI +F+G+A 
Sbjct: 764  DTISNKSELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAK 823

Query: 899  QFPFGF----TEFNGSDD------WKSLVFKFNEPPAEWKEQYLGSFSKEYGEFESISFV 948
            +F +G     T  +   D       K   FKF E P EW  +           FE IS +
Sbjct: 824  EFHYGIRVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPI 883

Query: 949  NTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPND 1008
            N++ ++ P   M+ G  I   QGY+++ PDY CFNKNGDLITGSLYTSG+ E  +    D
Sbjct: 884  NSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGD 943

Query: 1009 SEDFGSTKRLLENELLVTSERRDYNNLLD-KEETP-IIDEFL--KWRYSSTNSRWEQCL- 1063
              DF + KR +EN +L+ +    +N+ +D  E TP  + E+   KW     +  + + L 
Sbjct: 944  --DF-NVKRHVENGVLLAA----HNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLR 996

Query: 1064 ----PRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRK 1119
                P GDL    D++VTYFVLDAT+WLRHF HVYKLAT+N+LKFAICLTTFQELRFLRK
Sbjct: 997  DSRFPHGDLACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRK 1056

Query: 1120 SKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVI 1179
            SKDESV+EAATRAVIT RQLYYERKLLPLRFTGN+A HLEEHLE EEQ+TWRSHVDEFVI
Sbjct: 1057 SKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVI 1116

Query: 1180 EAIDKAQSKFNQLNKDAKASGRESITT--IDDGKFNFIALVTDDINMRNKARAQSIRAFS 1237
            EA+ K+Q KF  LN  A+  G+E I T   DD KFNF+ LVTDD+NMR KA A  I  FS
Sbjct: 1117 EAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFS 1176

Query: 1238 TKFMFAICHEIGLSKKVCTD 1257
            ++FMFA C+++G ++KVC +
Sbjct: 1177 SRFMFAFCNQLGYNQKVCIN 1196

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 55/133 (41%), Gaps = 41/133 (30%)

Query: 13  LHQKRQYSTNFDCYNHNIVKRRLAEHGIASPSLNEAEANDIDTPVDLISHSQDTVVIQPD 72
           LHQKR  S ++D Y+    KRR                     P  L   SQ+  V Q D
Sbjct: 30  LHQKRHNSNSYDYYDSGYAKRR---------------------PNTL---SQN--VSQND 63

Query: 73  HHQISSRLHNVVLPQSCFLGSGGEGAAALPRIKDQGQQVTLENPSKLAQQPPYEC-TPRS 131
               S+         +CFL S    +          Q+ T E P     QP Y   TP+S
Sbjct: 64  ELAASA---------ACFLDSNLTPSKHQECTPSSFQRATDETP-----QPFYPADTPQS 109

Query: 132 PYYLPTTSSSNME 144
           P+YLPTTSSSN+E
Sbjct: 110 PFYLPTTSSSNLE 122

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score = 1120 bits (2896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/957 (59%), Positives = 703/957 (73%), Gaps = 33/957 (3%)

Query: 323  LVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFITTALL 382
            LVEKLQEIYK+IVKQETELQERCS LTT QTTDLKNLW+ YK+NAELIDNY  FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 383  PTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVFISIS 442
            P+Q ++ L IGQEI++VYRIERRLW+YGTITFLDVLKNFSNFMDPEVCCQFI YVFI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 443  NILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGKLYYH 502
            N+L ++PP +S+ WLERLGDLSRMAIALYPSGF+DWKLSAEHWY+E+LK+ FGHGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 503  MSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSHIVEY 562
            MSTVQQNTL AFVNLGKSVFC D F+PS QYMQLVIDNIYQRAFAER+S  +R +HIV+Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 563  LKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSANFFDPSLIFVQDCERLKHFFRHAS 622
            LKHTEVMLLPSFLE+ E Q VV+ +F  KFG + S NFFDP+LIF+QD ERLKHFFRH+S
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSS 583

Query: 623  LYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXTASNQSDMSIDDTFLG 682
            L+++SHILQL GFGDP+NPFA+LFEL K +              +  + S+ S+D     
Sbjct: 584  LFSQSHILQLCGFGDPKNPFAMLFELSKHL---KSRKERKERKKSTKSTSEGSLDPVEFS 640

Query: 683  DPVQ-----FFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSLLTA 737
               Q     FF T++S K  Y F  DL +WK SL+Y+N TSM+C M+VLR+FL   ++TA
Sbjct: 641  SQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTA 700

Query: 738  LPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYINDQKPT 797
            LPH+LPW  F++++ +RLD + +   K+FWIVFIR+IFPW+S+  F+N L+ Y       
Sbjct: 701  LPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTK 760

Query: 798  KFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIHSTGV 857
             F ID +M+ Y+ M   ELL   CENE+LPE W+CWG+LWF+ I+ K   ++  + STG+
Sbjct: 761  NFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGL 820

Query: 858  KDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAY-----QFPFGFTEFNG-SD 911
             D +FLD+P +GI FD  DE G K+W+R  R +LLF  I        +  G  + N  + 
Sbjct: 821  SDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEAT 880

Query: 912  DWKSLVFKFNEPPAEWKEQYLGSFSKE---YGEFESISFVN-TDLQSPPHKGMVLGTDIR 967
             WK+LVF+FN+   +     L     E   + +FE IS +N +D      K M+ G  I 
Sbjct: 881  SWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIE 940

Query: 968  TLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLENELLVTS 1027
             LQG+K + PDY CFNKNGDLIT SLYT G  E  +    D  DF + K +L+N  LV  
Sbjct: 941  NLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGD--DFNANK-ILDNGRLVVQ 997

Query: 1028 ERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPR---GDLQYFTDTHVTYFVLDAT 1084
            +R +Y++ +DK E P ++ F+   +     R  + L R   G+L    DT+VT+FVLDAT
Sbjct: 998  DRLEYSSAIDKLEQPWLEAFMNPDF-----RQRELLNRSFLGNLNCQADTNVTFFVLDAT 1052

Query: 1085 TWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERK 1144
            TWLRHF H+YKLATS++LKFAICLTTFQELRFLRKSKDESVLEAATRAVI VRQLYYERK
Sbjct: 1053 TWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERK 1112

Query: 1145 LLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNKDAKASGRESI 1204
            LL LRFTGNVAGHLEEHLEIEEQMTW+SHVDEFVI+AI KAQ KFN LN DA   G++ I
Sbjct: 1113 LLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCI 1172

Query: 1205 TTIDDG----KFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCTD 1257
               +DG    +FNF++LVTDD NMRNKA+   IR FST+F+FAIC E+G    VCT+
Sbjct: 1173 PLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN 1229

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 61/144 (42%), Gaps = 29/144 (20%)

Query: 3   DPSTTSL--QSQLHQKRQYSTNFDCYNHNIVKRRLAEHGIASPSLNEAEANDIDTPVDLI 60
           DP + S+   S LHQKR  S + D Y+ NI+KRR  +    +  ++ AE      P +  
Sbjct: 2   DPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAE-----IPQEPC 56

Query: 61  SHSQDTVVIQPDHHQISSRLHNVVLPQSCFLGSGGEGAAALPRIKDQGQQVTLENPSKLA 120
            +   +++  P   +   +  ++  P +  +    +     PR  D   +          
Sbjct: 57  QYLDTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQ-----PRGVDTSGEF--------- 102

Query: 121 QQPPYECTPRSPYYLPTTSSSNME 144
                   P+SP+YLPTTS +N E
Sbjct: 103 --------PQSPFYLPTTSQTNFE 118

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 1083 bits (2801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/966 (58%), Positives = 695/966 (71%), Gaps = 38/966 (3%)

Query: 311  TVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELI 370
             V+  S P+SQ LV+KLQ+IY+NIVKQE ELQERC+QLTTSQTTDLKNLW+IYK+N ELI
Sbjct: 232  AVSPSSSPTSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELI 291

Query: 371  DNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVC 430
            +NY  FITTALLP+QP+ DLLIGQEI+ +YRIERRLW++GTITFLDVLKNFSNFMDPEVC
Sbjct: 292  NNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVC 351

Query: 431  CQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEAL 490
            CQFI +VFISIS +LG++P  FS  W ERLGDLSRMAIALYPSGFIDWKLSAEHWY +AL
Sbjct: 352  CQFITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQAL 411

Query: 491  KYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN 550
             + FGHGKLYYHMSTVQQNTL AFVNLGKSVFCRDTFIPS QYMQLVIDNIYQRAFAERN
Sbjct: 412  SHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERN 471

Query: 551  SGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFG-ATGSANFFDPSLIFVQ 609
             G+HR S +VEYLKH+EVMLL SFLE+ E Q VVL+FF  KFG +T + +FF+P  +F+Q
Sbjct: 472  GGNHRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQ 531

Query: 610  DCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXTAS 669
            D ER+K+FFRHA  +AESHILQ VGFGDP+NPFALLFELPK +              + S
Sbjct: 532  DGERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFL---KERKERKERRKSKS 588

Query: 670  NQSDMSIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKF 729
            + S  SI+ T    P ++ E ++S + AY F +DL IW+ESL+++N TS RCS +V +KF
Sbjct: 589  SHSFTSIETTSHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKF 648

Query: 730  LNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLL 789
            L   L+ A+ H+LPW+YFL+++ L++D++ + + K FWI  +RQIFPW SI +FLN+L+ 
Sbjct: 649  LRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMA 708

Query: 790  YINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNL 849
            ++ D      PID       ++    L+E+F E+EDLPE+W CWG LWFDVI  K     
Sbjct: 709  FVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGED 768

Query: 850  VDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFT---- 905
             D+ ++G KDH F D P DGI FD  DE GEKFWKR  R+I +F+GIA +F  G T    
Sbjct: 769  GDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAF 828

Query: 906  ------EFNGSDDWKSLVFKFNEPPAEWKEQYLGSFSK-EYGEFESISFVNTDLQSPPHK 958
                          ++  F F E PA+ + Q   SF + +   FE I+  N D    P +
Sbjct: 829  APQSRRPMTAGHPLQNFSFNFEEIPAQSQIQ---SFVRNQIPLFEEIATGNLDPNIRPGQ 885

Query: 959  GMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGG---SGVPNDSEDFGST 1015
             M+ G  I    GY+Q+  DY CFNK+G LI+ SLYTSG  E G    G   ++E +G +
Sbjct: 886  SMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRS 945

Query: 1016 K--RLLENELLVTSER--RDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYF 1071
            +     EN  +   ER  RD+   LD    P   EF++  Y       E   P GDL   
Sbjct: 946  EDSNKPENAQITELERLERDW---LDNCMNP---EFIEQAY-------EMKFPFGDLSCN 992

Query: 1072 TDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATR 1131
             D+ V+YFVLDAT+WLRHF HV+KLAT+N+L+F ICLTTFQELRFLRKSKDESV+EAATR
Sbjct: 993  CDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATR 1052

Query: 1132 AVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQ 1191
            AVITVRQLY ++KLLPLRFTGNVA HLEEHLE EEQ+TWRSHVDEFVIEA+ KAQ KF  
Sbjct: 1053 AVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEA 1112

Query: 1192 LNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLS 1251
            +N  AK +G + I T D+  F+F+ALV+DD NMR KA  Q I+ FST+FMFA+C++IGL+
Sbjct: 1113 INAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLA 1172

Query: 1252 KKVCTD 1257
             + CT+
Sbjct: 1173 HQACTN 1178

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score = 1080 bits (2793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/964 (57%), Positives = 693/964 (71%), Gaps = 44/964 (4%)

Query: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375
            S  +SQ LV+KLQ+IY+NIVKQE ELQERCSQLT SQTTDLKNLW+IYK+N ELI+NY  
Sbjct: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266

Query: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435
            FITTALLP+QP+ DLLIGQEI+ +YRIERRLW++GTITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326

Query: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495
            +VFISISN+LG++P  F+  WLERLGDLSRMAIALYPSGFIDWKLSAEHWY +AL + FG
Sbjct: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386

Query: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHR 555
            HGKLYYHMSTVQQNTL AFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN G+ R
Sbjct: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQR 446

Query: 556  YSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFG-ATGSANFFDPSLIFVQDCERL 614
             S +VEYLKH+EVMLL SFLE+ E Q VVL+FF  KFG ++ + ++F    IF+QD ER 
Sbjct: 447  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERT 506

Query: 615  KHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXTASNQSDM 674
            K+FFRHA  +AESHILQ+VGFG+P+NPFALLFELPK +              + S  S  
Sbjct: 507  KYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSME 566

Query: 675  SIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSL 734
            +   T    P+++ E+++S +  Y F  DL IW++SL+++N TS++CS VVL+KFL+  L
Sbjct: 567  APSPT---SPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPL 623

Query: 735  LTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYINDQ 794
            ++A  HLLPWAYFL+++ +R+D + + + K FWI   RQ+FPW SI NFLN+++ +  D 
Sbjct: 624  VSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDN 683

Query: 795  KPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIHS 854
                  ID     + ++ +  L+++F +NEDLPEVW CWG LWFDVI+ K  S++VD  +
Sbjct: 684  AWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDK--SDVVDEGA 741

Query: 855  T--GVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFT------- 905
            T   V+DHMF D PVDGI FD  DE+G +FWKR  R++ +F+GIA +F  G T       
Sbjct: 742  TYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASVPLQ 801

Query: 906  ---EFNGSDDWKSLVFKFNEPPAEWKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGMVL 962
                       ++  FKF +PP + +   L   S +   FE+IS  N D  +PP + M+ 
Sbjct: 802  SRRSLAAGHPLQNFCFKFEDPPVDSESYAL--ISTQMPAFENISERNLDPNAPPGQSMLE 859

Query: 963  GTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLENE 1022
            G  +  L GY+QL  D+ CFNK G LIT SLYTSG  E G    +  +DF          
Sbjct: 860  GKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGP--IHGGDDF---------- 907

Query: 1023 LLVTSERRDYNNLLDKEETPIIDEFLK----WRYSSTNSR-----WEQCLPRGDLQYFTD 1073
                +ER   ++ L+K + P I E  K    W  +  N       ++   P GDL    D
Sbjct: 908  ---NTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCD 964

Query: 1074 THVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAV 1133
            + V+YFV DAT+WLRHF HVYKLAT+ +L+FAICLTTFQELRFLRKSKDESV+EAATRAV
Sbjct: 965  SGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAV 1024

Query: 1134 ITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLN 1193
            ITVRQLY E++LLPLRFTGNVA HLEEHLE EEQ+TWRSHVDEFVIEA+ KAQ+KF  LN
Sbjct: 1025 ITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALN 1084

Query: 1194 KDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKK 1253
              AK  G + I T ++  F+FIALV+DD NMR KA AQ IR FS++FMFA+C++IGL+  
Sbjct: 1085 AQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHH 1144

Query: 1254 VCTD 1257
             CT+
Sbjct: 1145 ACTN 1148

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1060 bits (2740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/988 (53%), Positives = 676/988 (68%), Gaps = 57/988 (5%)

Query: 309  VSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAE 368
            V +V VPSK SSQ LV+KLQ+IYK IVKQE ELQERCSQLTTSQTT+LKNLW IYK+N++
Sbjct: 403  VPSVVVPSKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSD 462

Query: 369  LIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPE 428
            LI+NY TF+TTALLP+Q + D+LIG+EI+E+YRIERRLW+YGTITFLD+ KNFSNFMDPE
Sbjct: 463  LINNYVTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPE 522

Query: 429  VCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQE 488
            VCCQFI +VFISISN+LG+IPP + + WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY E
Sbjct: 523  VCCQFITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYME 582

Query: 489  ALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 548
            A+K+ + HGKLYYHMSTVQQNTL AFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAF E
Sbjct: 583  AMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVE 642

Query: 549  RNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGA-TGSANFFDPSLIF 607
            RN+G+HR + ++EYLKH+EVMLLPSFLE+ + Q VVL +F  KFG  + + N FD   +F
Sbjct: 643  RNNGNHRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMF 702

Query: 608  VQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXT 667
             Q+ + L++FFRHA  +AESHILQLVGFGDP+NPFALLFELP+ +              T
Sbjct: 703  CQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKST 762

Query: 668  ASNQSD--MSIDD------TFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSM 719
               ++   M+IDD        +  P  FF  + + +  Y    +L IW ESLNY+N TS+
Sbjct: 763  TVTETSSTMAIDDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSL 822

Query: 720  RCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWES 779
            +CSMVVL+KFL   L+ ALPH +PW YF++++  ++  + +E S++FW+ F+ +IFPW +
Sbjct: 823  KCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNT 882

Query: 780  ITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFD 839
            I +FLNVL+ Y+ D       +D     Y +M L +LL+YF  NE LPEVW CWGTLWFD
Sbjct: 883  IVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFD 942

Query: 840  VINSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQ 899
             I +K  S++ D+ S G+K+HMFLDAP+DGI+FD +DESGE FWKR  R+I LF+G+A  
Sbjct: 943  TICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAEN 1002

Query: 900  FPFGFT------------EFNGSDDWKSLVFKF-----------NEPPAEWKEQYLGSFS 936
            FP G T            + +     KS  FK            N P        L    
Sbjct: 1003 FPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLK 1062

Query: 937  KEYGEFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTS 996
                 FE  S+ N  + + P   ++ G  I    GY++L PDY  ++KNG+ ++ SLYTS
Sbjct: 1063 NTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTS 1122

Query: 997  GMSEGGSG----VPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRY 1052
              +   +     +P    D  S +  +++                 +E  I ++ ++  Y
Sbjct: 1123 WYANNNTNNTGVIPAHGSDVDSQRDAVQS----------------VQEMHIFNQIMEPGY 1166

Query: 1053 SSTNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQ 1112
                +  +    R  L     +  TYFVLD TTWLRHFGH+YKLA+S +LKFAICLTTF 
Sbjct: 1167 CGGFA--DDLFLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFH 1224

Query: 1113 ELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRS 1172
            ELRFLRK KDE+V+EAATRA+ITVRQLY E KLLPLRFTGNVA H+EEHLE EE++TWRS
Sbjct: 1225 ELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRS 1284

Query: 1173 HVDEFVIEAIDKAQSKFNQLNKDAKASGRESITTI---DDGKFNFIALVTDDINMRNKAR 1229
            HVDEFVIEA+ KAQSKF ++N+       +        D     F+ LVTDD NMR KA+
Sbjct: 1285 HVDEFVIEAVYKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQ 1344

Query: 1230 AQSIRAFSTKFMFAICHEIGLSKKVCTD 1257
             Q +R FSTKF+F++C+ IGL  K+CT+
Sbjct: 1345 DQDVRTFSTKFVFSLCNSIGLRSKICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/975 (54%), Positives = 648/975 (66%), Gaps = 77/975 (7%)

Query: 308  NVSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNA 367
            NV +V VPSK SSQ LV+KLQ+IYK IVKQE ELQERCSQLT SQTT+LK LWVIYK+N+
Sbjct: 225  NVPSVVVPSKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNS 284

Query: 368  ELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDP 427
            +LI+NY TFITTALLP Q   DL IGQEI+E+YRIERRLW+YGTITFLDVLKNFSNFMDP
Sbjct: 285  DLINNYVTFITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDP 344

Query: 428  EVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQ 487
            EVC QFI +VFISISN+L +IP  +++ W +RLGDLSRMAIALYPSGFIDWKLSAEHWY 
Sbjct: 345  EVCAQFITHVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYM 404

Query: 488  EALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFA 547
            EA+KY +GHGKLYYHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQRAF 
Sbjct: 405  EAMKYIYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFV 464

Query: 548  ERNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGA-TGSANFFDPSLI 606
            ERN+G+HR S ++EYLKH+EVMLLPSFLE+ + Q VVL +F  KFG  T   N FD   +
Sbjct: 465  ERNNGNHRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQM 524

Query: 607  FVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIX--XXXXXXXXXXX 664
            F Q+ ++LK+FFRHA  +AESHILQLVGFGDP+NPFALLFELP+C+              
Sbjct: 525  FDQNPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKS 584

Query: 665  XXTASNQSDMSIDDT-------FLGDPV-QFFETLNSTKTAYRFSQDLNIWKESLNYVNK 716
              T    S M+ID+         LG  V QFF+ ++S  + Y F   L +W  SL Y+N 
Sbjct: 585  SVTTETSSAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNI 644

Query: 717  TSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFP 776
            TS+ CSM+VL+KFL   ++ ALPHLLPWAYF++AV  ++  I +  S+ FW+  + +IFP
Sbjct: 645  TSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFP 704

Query: 777  WESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTL 836
            W +I NFLNVL+ Y  D      PID        M L +L+E+F  NEDLPEVW CWG L
Sbjct: 705  WNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLL 764

Query: 837  WFDVINSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGI 896
            WFD I  K    +    S G+KDHMFLD P+DGI FD  DESG KFWKR  RVI LF+ I
Sbjct: 765  WFDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRI 824

Query: 897  AYQFPFGFTEFNGSD-----------DWKSLVFKFNEPPAEWKEQYLGSFS---KEYGEF 942
            A  F       + +              KS  FK        ++ +  S S        F
Sbjct: 825  AENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKL-------RDTFYNSNSVLQNTIEVF 877

Query: 943  ESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGG 1002
            E  S  N D+Q  P   ++    I    GYK+L+ D  C+++ G+ ++ SLYTS  +E  
Sbjct: 878  EEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETS 937

Query: 1003 SGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQC 1062
                  SE    T++   N                  E  +  E +    +  N  + +C
Sbjct: 938  KNEIPQSE---PTQQQTAN------------------EADLFIEGINTSLTEFNIDFPEC 976

Query: 1063 LPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKD 1122
               G          T+FVLDAT+WLRHF HVYKLA++ +L+FAICLTTFQELRFLRKSKD
Sbjct: 977  KMNG--------KDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKD 1028

Query: 1123 ESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAI 1182
            E+V+EAATRAVITVRQLY E ++LPLRFTGNVA H+EEHLE EEQ+TWRSHVDEFV EAI
Sbjct: 1029 ENVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAI 1088

Query: 1183 DKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMF 1242
             KAQ++ +Q N+D                F+ + LVTDD NMR KA+  +I   ST+F+F
Sbjct: 1089 KKAQARLSQENRD----------------FHHVVLVTDDANMRRKAQQHAIHTLSTRFVF 1132

Query: 1243 AICHEIGLSKKVCTD 1257
            A C+ +G   K+CT+
Sbjct: 1133 ATCNAVGNRLKICTN 1147

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/1021 (49%), Positives = 673/1021 (65%), Gaps = 102/1021 (9%)

Query: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375
            ++ SSQ LV+KLQ+IYK IVKQE ELQERCSQLTTSQTT+LKNLW IYK+N +LI+NY T
Sbjct: 284  TRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTT 343

Query: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435
            FITTALLP+QP  D+LIG+EI+E+YRIERRLW+YGTITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 344  FITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 403

Query: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495
            +VFIS+S IL +IPP  ++ WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+ + 
Sbjct: 404  HVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 463

Query: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNS-GHH 554
            HGKLYYHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN+ G++
Sbjct: 464  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNY 523

Query: 555  RYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFDPSLIFVQDCER 613
            R   +++YLKH+EVMLLPSFL + + Q VVL +F  +FG   S  N FD   +F Q    
Sbjct: 524  RNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSC 583

Query: 614  LKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXTA----S 669
            L+ FFRHA  +AESHILQLVGFG+P+NPFALLFELPK +              T+    S
Sbjct: 584  LRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVS 643

Query: 670  NQSDMSIDD-----------------TFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLN 712
            + +  ++DD                   L  P ++ + + + K A   + D+  W +SL+
Sbjct: 644  STAPKTVDDQATDNVNEGTNDDHELTATLSGP-EYLDNIETLKYAIE-TPDICTWIKSLD 701

Query: 713  YVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIR 772
            ++N TS++CSM+VL+KFL+  LL ALPH LPW  F++A G++++ + NE + +FW + ++
Sbjct: 702  FINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMK 761

Query: 773  QIFPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNC 832
            +IFPW++IT+FLNVLL Y+ D       I+E    Y +M L ++L +F ++EDLPEVW C
Sbjct: 762  RIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKC 821

Query: 833  WGTLWFDVINSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILL 892
            WGTLW+D I +K+  +       G+ DHMFLD P+DGI FD  DE+G KFWKR +RVI L
Sbjct: 822  WGTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFL 881

Query: 893  FRGIAYQFPFGFTEFNGSDDWKSLVFKFNEPPAEWK--------EQYLGSFSKEYGEF-- 942
            F+GI+ +F FG    +     ++ V+  NE  A+          E Y    S ++ EF  
Sbjct: 882  FKGISKKFDFGLKISH-----EAGVYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEFIP 936

Query: 943  --ESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGM-- 998
              E +S +N D  + P   +V G +I    GY+ L  D   F+KNG++++ S+YTS M  
Sbjct: 937  LCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMID 996

Query: 999  -----------------SEG-----GSGVP----------------NDSEDFGSTKRLLE 1020
                             SEG      +G P                 D +D G    L E
Sbjct: 997  TGEAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPG----LNE 1052

Query: 1021 NELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFV 1080
            N+L      + + +L D  +  +    +  +     + WE  +         D   T+F+
Sbjct: 1053 NDLF-----KKFMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDE------LDRLKTFFI 1101

Query: 1081 LDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLY 1140
             DAT+WLRHF H+YK+AT+ +LKF +CLTTFQELRFLRKSKDE+V+EAA RA+IT+RQLY
Sbjct: 1102 FDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLY 1161

Query: 1141 YERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNK----DA 1196
             E +LLPLRFTGNVA  +EEHLE EEQ+TWRSHVDEFVIEA+ KAQ KF    +    + 
Sbjct: 1162 RENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEE 1221

Query: 1197 KASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCT 1256
            + +G   +  +   +F+++ LVT+D NM+ KA+ Q I+ FST F+F++C ++G+S  +CT
Sbjct: 1222 EGTGPPRV-PLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCT 1280

Query: 1257 D 1257
            +
Sbjct: 1281 N 1281

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/977 (50%), Positives = 656/977 (67%), Gaps = 80/977 (8%)

Query: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375
            +K S   L++KLQE+Y+ IVKQE ELQERCSQLT SQTT+LK+LW IYK+N EL++NY T
Sbjct: 249  NKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVT 308

Query: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435
            FITTALLP+QP  DL+IGQEI+E+YRIERRLW+YGTITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 309  FITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 368

Query: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495
            +VFIS+S ++ +IP  +S+ WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY + 
Sbjct: 369  HVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYN 428

Query: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHR 555
            HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ R
Sbjct: 429  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 488

Query: 556  YSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFDPSLIFVQDCERL 614
             S ++EYLKH+E MLLPSFLE+ + Q VVL++F +KFG   +  N F+   +F+Q+ +  
Sbjct: 489  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFF 548

Query: 615  KHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXTASNQSDM 674
            K+FFRH   +A+SHILQ+VGFG+P+NPFA+LFELPK +                S+ ++ 
Sbjct: 549  KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTES 608

Query: 675  SI--------DD-------TFLGDP---VQFFETLNSTKTAYRFSQDLN-IWKESLNYVN 715
            S         DD       T + DP   V+FF  +++ +     S   N  W E+L ++N
Sbjct: 609  STGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPILPSMLTNEAWLETLKFLN 668

Query: 716  KTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIF 775
             TS++C M+VLRKFL+  L  ALPH+LPW YF++++ L+ + + +  SK FWIV I+++F
Sbjct: 669  MTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMF 728

Query: 776  PWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGT 835
            PW+++  F+NVL+ Y+ D + +   I +    Y  + L ELL  F ENEDLPE+W CWGT
Sbjct: 729  PWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGT 788

Query: 836  LWFDVI---NSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILL 892
            LWFD I   N+  +S+  +    G++D+M LD+P DGI FD  DE+GEKFWKR  R+I L
Sbjct: 789  LWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFL 848

Query: 893  FRGIAYQFPFGF----------TEFNGSDDWKSLVFKFNEPPAEWKEQ--YLGSFSKEYG 940
            FR ++  FP G           +    ++  + LV+K  EP    +     L +    + 
Sbjct: 849  FREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKL-EPLTNIRSSVPVLSTLESIFD 907

Query: 941  EFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSE 1000
              E+ S +NTDL + P   ++ G +I    GYK+L PDY CF+KNG+ ++ SLYTS    
Sbjct: 908  ISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWY-- 965

Query: 1001 GGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWE 1060
                VPN + +       LE  +   +ER         E   +  E +K  +       E
Sbjct: 966  ----VPNCNNN-------LETNISYANER---------ENEALFLECMKSVHP------E 999

Query: 1061 QCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKS 1120
               P  D +       TYFV DAT+WLRH   ++KLA + LL+FAICLTTFQELRFLRKS
Sbjct: 1000 IAYPEIDFK------TTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKS 1053

Query: 1121 KDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIE 1180
            KDE+V+EAATR +IT+RQLY E K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDEFVIE
Sbjct: 1054 KDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIE 1113

Query: 1181 AIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKF 1240
            +I KAQ K     ++AK         I   +FN++ L++DD  M+ KA  + IR  ST+F
Sbjct: 1114 SIMKAQEKL----ENAKQPN------ISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRF 1163

Query: 1241 MFAICHEIGLSKKVCTD 1257
            +F++C ++G  + +CTD
Sbjct: 1164 VFSLCTKLGEQRHLCTD 1180

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/983 (51%), Positives = 666/983 (67%), Gaps = 59/983 (6%)

Query: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375
            +K +S+ L+EKLQ IYK IVKQE ELQ+RCSQLTTSQTT+LKNLW IYKLN +LI+NY T
Sbjct: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336

Query: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435
            FITTALLP+Q   D+ IG+EI+E+YRIERRLW+YGTITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 337  FITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396

Query: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495
            +VFIS+S +L ++PP  S+ WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+ + 
Sbjct: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456

Query: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN-SGHH 554
            HGKLYYHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN +G+ 
Sbjct: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516

Query: 555  RYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGAT-GSANFFDPSLIFVQDCER 613
            R S +++YLKH+EVMLLPSFLEN + Q VVL +F+ +FG      N F+   +F Q    
Sbjct: 517  RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPAS 576

Query: 614  LKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXTASNQSD 673
            L+ +FRHA  +AESHILQLVGFG+P+NPFALLF+LP  +              +++  S 
Sbjct: 577  LRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFL-KERKDKKEKNKSKSSTEIST 635

Query: 674  MSIDDTFLGDPV--------------QFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSM 719
            MSID      P+              ++F+ ++S +        L +W +SL ++N TS+
Sbjct: 636  MSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPNIL-VWLKSLEHLNMTSL 694

Query: 720  RCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWES 779
            +CS++VLRKFL   LL ALPH+LPW YF++A  L+  + +N  S +FW + +R+I PW +
Sbjct: 695  KCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNT 754

Query: 780  ITNFLNVLLLYIND---QKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTL 836
            +T+FLNVLL YI D   Q  +   + E  +N+ N    ELL+YF  NE+LPE+W CWGTL
Sbjct: 755  LTSFLNVLLAYILDNFYQTESIAKLCETYSNFEN--FYELLDYFNRNENLPEIWKCWGTL 812

Query: 837  WFDVINSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGI 896
            WFDVI++K   N    +  G++DHMFLD P+DGI FD  DE+GE FW R +R++ LF+GI
Sbjct: 813  WFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGI 872

Query: 897  AYQFPFGF------------TEFNGSDDWKSLVFK---FNEPPAEWKEQYLGSFSKEYGE 941
            A     G              + + +   KS  FK   F+E  + +  Q   + +K    
Sbjct: 873  AENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDE--SSYSGQPFSTINKLLPL 930

Query: 942  FESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEG 1001
            FE+I   N D  + P   +V G +I    GYK+L  +   F++NG+L++ S+YT+ + + 
Sbjct: 931  FENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDN 990

Query: 1002 GSGVPND-SEDFGSTKRLLENEL-LVTSERRDYN--NLLDKEETPIIDEF---LKWRYSS 1054
             + + N     + S  ++ + +  L+  E++++   N    E+T   D+F   L      
Sbjct: 991  DNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTE--DDFNFELYMNPEK 1048

Query: 1055 TNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQEL 1114
             N   +Q           + ++TYFV DAT+WLRHF H+YKL+T+N+L FA+CLTTFQEL
Sbjct: 1049 LNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQEL 1108

Query: 1115 RFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHV 1174
            RFLRKSKDE+V+ AA RA+IT+RQLY E KLLPLRFTGNVA  +EEHLE EEQ+TWRSHV
Sbjct: 1109 RFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHV 1168

Query: 1175 DEFVIEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIR 1234
            DEFVIEA+ KAQ+KF         S  ES+ T+  G FN + LVTDDINM+ KA+ Q I+
Sbjct: 1169 DEFVIEAVVKAQNKF--------ISANESV-TLRKG-FNHVVLVTDDINMKRKAQEQGIK 1218

Query: 1235 AFSTKFMFAICHEIGLSKKVCTD 1257
             F+T F+F++C ++G+   VCT+
Sbjct: 1219 TFTTHFIFSVCRKLGIQDNVCTN 1241

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/981 (50%), Positives = 647/981 (65%), Gaps = 93/981 (9%)

Query: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375
            +K SS  L++KLQE+YK IVKQE ELQERCSQLT SQTT+LK+LW IY++N EL++NY T
Sbjct: 261  NKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVT 320

Query: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435
            FITTALLP+QP+ DL+IGQEI+E+YRIERRLW+YGTITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 321  FITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 380

Query: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495
            +VF+S+S ++ +IP  +S+ WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY + 
Sbjct: 381  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYN 440

Query: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHR 555
            HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ R
Sbjct: 441  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 500

Query: 556  YSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFDPSLIFVQDCERL 614
             S ++EYLKH+E MLLPSFLE+ + Q VVL++F +KFG   +  N F+P  +F+Q+ +  
Sbjct: 501  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 560

Query: 615  KHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXTA------ 668
            K+FFRHA  +A+SHILQ+VGFG+P+NPFA+LFELPK +                      
Sbjct: 561  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITES 620

Query: 669  ----------------SNQSDMSIDDTFLGDPVQFFETLNSTKTAYRFSQDLN-IWKESL 711
                            S+ + +S  D+     ++FF  +++ +     S   N  W ESL
Sbjct: 621  STSNSRNENDDNDEIMSSTTSISERDSL----IEFFNDIDTLRRPIVSSMLTNEAWLESL 676

Query: 712  NYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFI 771
             ++N TS++C M+VLRKFL+  L  ALPH LPW YF++++ L+   + +  SK FWIV +
Sbjct: 677  KFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIV 736

Query: 772  RQIFPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWN 831
            ++IFPW+++  F+N+L+  + D + T   I      Y ++ L ELL+ F E E+LPE+W 
Sbjct: 737  KRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWG 796

Query: 832  CWGTLWFDVI---NSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVR 888
            CWGTLWFD I   N+  +S+  D    G+KD+M LD+P+DGI FD +DE+GEKFWKR  R
Sbjct: 797  CWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACR 856

Query: 889  VILLFRGIAYQFPFGFTEFNGSDDWKS----------LVFKFNEPPAEWKEQY--LGSFS 936
             I LFR ++  F  G    N S   +S          L +K  EP +        L +  
Sbjct: 857  TIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKL-EPLSTLGSSIPTLNTLE 915

Query: 937  KEYGEFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTS 996
                 FE+ S  N DL + P   ++ G  I    GYK+L P+Y CF+KNG+ ++ SLYTS
Sbjct: 916  GIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTS 975

Query: 997  GMSEGGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTN 1056
                 GS  P  + +    K   ENE                       +FL        
Sbjct: 976  WYVPNGSNNPETNINSNCEK---ENE----------------------GQFL-------- 1002

Query: 1057 SRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRF 1116
                +CL   D +   D + TYFV DAT+WLRH   ++KLA + LLKFAICLTTFQELRF
Sbjct: 1003 ----ECLKSDDRE--IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRF 1056

Query: 1117 LRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDE 1176
            LRKSKDE+V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDE
Sbjct: 1057 LRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDE 1116

Query: 1177 FVIEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAF 1236
            FVIE+I KAQ K    N+   +S R          FN++ L++DD  M+ KA  + I+  
Sbjct: 1117 FVIESIMKAQEKLENANQLPVSSCR----------FNYVILISDDDTMKKKAEEKKIKTL 1166

Query: 1237 STKFMFAICHEIGLSKKVCTD 1257
            ST+F+F++C ++G  + +CTD
Sbjct: 1167 STRFVFSLCTKLGEQRHLCTD 1187

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  944 bits (2440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/982 (50%), Positives = 654/982 (66%), Gaps = 95/982 (9%)

Query: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375
            SK SS  L++KLQE+YK IVKQE ELQERCSQLT SQTT+LK+LW IY++N ELI+NY T
Sbjct: 262  SKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVT 321

Query: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435
            FITTALLP+QP  DLLIGQEI+E+YRIERRLW+YGTITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 322  FITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 381

Query: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495
            +VF+S+S ++ +IP  +S+ WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY + 
Sbjct: 382  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYN 441

Query: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHR 555
            HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ R
Sbjct: 442  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 501

Query: 556  YSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFDPSLIFVQDCERL 614
             S ++EYLKH+E MLLPSFLE+ + Q VV+++F +KFG   +  N F+P  +F+Q+ +  
Sbjct: 502  NSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 561

Query: 615  KHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXTASNQSDM 674
            K+FFRHA  +A+SHILQ+VGFG+P+NPFA+LFELPK +                S+ +D 
Sbjct: 562  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYL-----KERKDKKERKKSSNNDS 616

Query: 675  SIDDTFLGDP----VQFFETLNSTKTA------YRFSQDLNI--------------WKES 710
            S+ ++  G+         E ++ST +         F  D++               W E+
Sbjct: 617  SVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTSEAWLET 676

Query: 711  LNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVF 770
            L ++N TS++C M+VLRKFL+  L  ALPH+LPW YF++A  L+ + + +  SK FW++ 
Sbjct: 677  LKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMII 736

Query: 771  IRQIFPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVW 830
            ++++FPW++I  F+NVL+ Y+ D +     I E  + Y  + L  LLE F E+E+LPE+W
Sbjct: 737  VKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIW 796

Query: 831  NCWGTLWFDVI---NSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCV 887
            NCWGTLWFD I   N+  +S+  +    G+KD+M LDAP DGI FD  DESGEKFWKR  
Sbjct: 797  NCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRAC 856

Query: 888  RVILLFRGIAYQFPFGFTEFN----------GSDDWKSLVFKFNEPPAEWKEQ--YLGSF 935
            R+I LFR ++  FP G    N           S   ++LV+K  EP +  +     L + 
Sbjct: 857  RIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKL-EPLSNIRSNTPILTAL 915

Query: 936  SKEYGEFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYT 995
                   E+ S  N DL + P   +  G +I    GYK+L PDY CF++NG+ ++ SLYT
Sbjct: 916  ENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYT 975

Query: 996  SGMSEGGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSST 1055
                  G+ +               +E LV S+       ++K +  +  E +K      
Sbjct: 976  RWYLPNGNNI---------------SEALVNSD-------IEKGDEDLFLECMK------ 1007

Query: 1056 NSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELR 1115
                  C P  D +       TYFV DAT+WLRH   ++KLA + LLKFAICLTTFQELR
Sbjct: 1008 ----PDC-PGIDFE------TTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELR 1056

Query: 1116 FLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVD 1175
            FLRKSKDE+V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVD
Sbjct: 1057 FLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVD 1116

Query: 1176 EFVIEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRA 1235
            EFVIE+I KAQ K        + +G+  +T       N++ L++DD  M+ KA  + I+ 
Sbjct: 1117 EFVIESIKKAQEKL-------ENAGQPHVTPRHS---NYVVLISDDDTMKKKAEEKEIKT 1166

Query: 1236 FSTKFMFAICHEIGLSKKVCTD 1257
             STKF+F++C ++G  + +CTD
Sbjct: 1167 LSTKFVFSLCTKLGEKRHLCTD 1188

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  942 bits (2434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/977 (50%), Positives = 652/977 (66%), Gaps = 74/977 (7%)

Query: 309  VSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAE 368
            V +V+VP + SSQ LV+KLQ+IYK I+KQE ELQERCSQLT SQTT++KNLWVIYKLNA+
Sbjct: 304  VPSVSVPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNAD 363

Query: 369  LIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPE 428
            LI+NY TFITTAL P+Q K+DLLIG+EI+++Y+IERRLW+YGTITFLDVLKNFSNFMDPE
Sbjct: 364  LINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPE 423

Query: 429  VCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQE 488
            VCCQFI +VFISIS++L +IP  +++ WL++LGDLSRMA+AL+PSGFIDWKLSAE WY  
Sbjct: 424  VCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMA 483

Query: 489  ALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 548
            A++Y++G+GKLYYHMSTVQQNTL AFVNLGKSVFC++TF+PSQQY+QLVIDNIYQRAFA+
Sbjct: 484  AMEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFAD 543

Query: 549  RNSGHHRYS--HIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSAN---FFDP 603
            RNS  +  +   +V+YLKH+EVMLLP+F+E+ + Q VVL +F +KFG   + N    F P
Sbjct: 544  RNSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQP 603

Query: 604  SLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXX 663
              +F+Q+ ++LK +FRHA+ +AE+ ILQLVG+G+P+NPFALLF LPK +           
Sbjct: 604  RQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRK 663

Query: 664  ----------XXXTASNQSDMSI-----DDTFLGDPVQFFETLNSTKTAYRFSQDLNIWK 708
                         T S+ S M        + FLG    FF  ++           +++W 
Sbjct: 664  PKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSE-DFFNNIDKLAINNFMPNSISLWN 722

Query: 709  ESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWI 768
            +SL Y N T+ +CSM+VL+KFLN  L+ ALPH+LPW YFL+++ L+++  ++     FW 
Sbjct: 723  DSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWY 782

Query: 769  VFIRQIFPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPE 828
             FI++IFPW S+  FLNVLL Y+ D      P++E    Y ++ L ELL  F  NEDLPE
Sbjct: 783  AFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPE 842

Query: 829  VWNCWGTLWFDVINSKHVSNLVDIHS-TGVKDHMFLDAPVDGISFDHSDESGEKFWKRCV 887
            VW C G+LWFD+I+ K  S   D ++  G+KD+ FLD PVDGI FD +DE G KFWKR V
Sbjct: 843  VWKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSV 902

Query: 888  RVILLFRGIAYQFPFGFTEFNGSDDWKSLVFKFNEPPAEWKEQYLGSFSKEY-------- 939
            RVI LFRGI          FNG   + +L   +N P    +   + S    Y        
Sbjct: 903  RVIFLFRGIV-------ERFNG---FGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKS 952

Query: 940  ----------GEFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLI 989
                        FE I   N+D  + P   M+ G +I    GYK++  DY  F+KNGDLI
Sbjct: 953  DDIMFDDMLVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLI 1012

Query: 990  TGSLYTSGMSEGGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLK 1049
            + S Y +      +GV N      ++           +E+  +N   D E    +DEF  
Sbjct: 1013 STSFYNTWSINQDTGV-NGGPLSNNSSSSNAASSDPMNEKELFNKCFDPEYDS-VDEF-- 1068

Query: 1050 WRYSSTNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLT 1109
            W        ++    +  ++ + D   TYF+LDAT+WLRHF HVYK+AT+++LKF+ICLT
Sbjct: 1069 W----NKEIYDDIGRKFGMELYED---TYFILDATSWLRHFAHVYKIATNSILKFSICLT 1121

Query: 1110 TFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMT 1169
            TFQELRFLRKSKDE+V+EAATRA+IT+RQL+ E KLLPLRFTGNVA H+EEHLE EEQ+T
Sbjct: 1122 TFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQIT 1181

Query: 1170 WRSHVDEFVIEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKAR 1229
            WRSHVDEFVIEA+ KA++K     K+ +    +            I LVTDD NM+NKA 
Sbjct: 1182 WRSHVDEFVIEAVIKAETK----RKEQEMHNMKGFQ---------IVLVTDDSNMKNKAL 1228

Query: 1230 AQSIRAFSTKFMFAICH 1246
             +  + FST+F+FAI +
Sbjct: 1229 EKGSKTFSTRFVFAISN 1245

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  935 bits (2416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/1040 (49%), Positives = 658/1040 (63%), Gaps = 113/1040 (10%)

Query: 317  KPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTF 376
            K + + LV KLQ+IYK IVKQE ELQERCSQLTTSQTTDLKNLW IYK+N +LI+NY TF
Sbjct: 294  KKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTF 353

Query: 377  ITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVY 436
            ITTALL +Q + DL IG+EIIE+YRIERRLW+YGTITFLDVLKNFSNFMDPEVCCQFI +
Sbjct: 354  ITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 413

Query: 437  VFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGH 496
            VFIS+S +L +IP  +S+ WL+RLGDLSRMAIALYPSGFIDWKLSAE WY EA+K+ + H
Sbjct: 414  VFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNH 473

Query: 497  GKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRY 556
            GKLYYHMSTVQQNTL AFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN+G++R 
Sbjct: 474  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRN 533

Query: 557  SHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGA--------------------TG 596
              ++EYLKH+EVMLLP+FLEN E Q VVL +F +KFG                     T 
Sbjct: 534  LQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTR 593

Query: 597  SANFFDPSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXX-- 654
            + + F    +F+Q+ E+LK+FFRHA  +AESHILQLVGFGDP+NPFALLFELPK +    
Sbjct: 594  TIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERK 653

Query: 655  ---------XXXXXXXXXXXXTASNQSDMSIDDTFLGD----------------PVQFFE 689
                                 TA + S MSID++ +G+                  +FF+
Sbjct: 654  DKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQ 713

Query: 690  TLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLV 749
             +   +  Y     L IW  SLN++N  S++CSM+VL+KFL+  LL ALPHLLPW YF++
Sbjct: 714  NIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFII 773

Query: 750  AVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLY------------IND--QK 795
            ++ L+ + + +EDSK FWI  ++ IFPW  I NFLNVLL Y            +ND  QK
Sbjct: 774  SILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQK 833

Query: 796  PTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIHST 855
                 I +    Y  M   +LL++F ENEDLPEVW CWGTLWFD I++K+  +     + 
Sbjct: 834  DMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENL 893

Query: 856  GVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF-PFGF-TEFNGSDDW 913
            G+KDHMFLD P+DGI +   DE+GE FWKR +R+I LF+GIA  F   G    +N   ++
Sbjct: 894  GIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEY 953

Query: 914  -----------KSLVFKFNEPPAEWKEQYLGSFSKEY--------GEF----ESISFVNT 950
                       K   FK+    A++ +  LG   + Y         EF    E I   N 
Sbjct: 954  RNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNL 1013

Query: 951  DLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSE 1010
            + + PP K M+   DI    GYK+L P+   F+KNG+  +GS+YT+         P D +
Sbjct: 1014 NFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAW--------PMDYD 1065

Query: 1011 DFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQY 1070
                  +   N    T E  D         T  IDE    +      R +  L       
Sbjct: 1066 QL-ILAQNNNNNTNATDEMTDL-----FTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTE 1119

Query: 1071 FTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAAT 1130
              + + TYFV DAT+WLRHF H+YKLA++++LKFA+CLTTFQELRFLRKSKD +V+EA+T
Sbjct: 1120 PFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEAST 1179

Query: 1131 RAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFN 1190
            RA+IT+RQLY +  LLPLRFTGNVA  +EEHLE EEQ+TWRSHVDEFVIEA+ KAQ KF 
Sbjct: 1180 RAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFV 1239

Query: 1191 QLNKDAKASGRESITTID-------------DGKFNFIALVTDDINMRNKARAQSIRAFS 1237
            +        G  +   ID                F ++ L+TDD +MR KA+ + I  F 
Sbjct: 1240 KSKTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFG 1299

Query: 1238 TKFMFAICHEIGLSKKVCTD 1257
            T+ +F++C  +G+ + VCT+
Sbjct: 1300 TQVVFSVCSMMGIDEGVCTN 1319

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  924 bits (2389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/986 (49%), Positives = 653/986 (66%), Gaps = 84/986 (8%)

Query: 307  HNVSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLN 366
             N S     +K S   L++KLQE+YK IVKQE ELQERCSQLT SQTT+LK+LW IYK+N
Sbjct: 259  ENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKIN 318

Query: 367  AELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMD 426
             +L++NY TFITTALLP+QP  DL+IGQEI+E+YRIERRLW+YGTITFLDVLKNFSNFMD
Sbjct: 319  TDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMD 378

Query: 427  PEVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWY 486
            PEVCCQFI +VF+S+S ++ +IP  +S+ WL+RLGDLSRMAIALYPS FIDWKLSAEHWY
Sbjct: 379  PEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWY 438

Query: 487  QEALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAF 546
             EA+KY + HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF
Sbjct: 439  TEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAF 498

Query: 547  AERNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFDPSL 605
             ERN+G+ R S ++EYLKH+E MLLPSFLE+ + Q VVL++F +KFG   +  N F+   
Sbjct: 499  VERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAED 558

Query: 606  IFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCI---------XXXX 656
            +FVQ+ +  K+FFRH   +A+SHILQ+VGFG+P+NPFA+LFELPK +             
Sbjct: 559  MFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSS 618

Query: 657  XXXXXXXXXXTASNQSDMSIDDTFLGDP---------VQFFETLNSTKTAYRFSQDLN-I 706
                      T ++++D   DD  +             +FF  +++ +     S   N  
Sbjct: 619  NNDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEA 678

Query: 707  WKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRF 766
            W E+L ++N TS++C ++VLRKFL+  L  ALPH+LPW YF++++ L+   + +  SK F
Sbjct: 679  WLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEF 738

Query: 767  WIVFIRQIFPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDL 826
            W++ +++ FPW+++  F+NVL++Y+ D + +   I +   +Y  + L ELLE F E E+L
Sbjct: 739  WMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEEL 798

Query: 827  PEVWNCWGTLWFDVI---NSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFW 883
            PE+  CWGTLWFD I   N+  +S+  +    G+KD+M LD+P DGI FD  DE+GEKFW
Sbjct: 799  PEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFW 858

Query: 884  KRCVRVILLFRGIAYQFPFGF----------TEFNGSDDWKSLVFKFNEPPAEWKEQ--Y 931
            KR  R I LFR ++  FP G           + F  ++   SLVFK  EP          
Sbjct: 859  KRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKL-EPLCNIHNNIPV 917

Query: 932  LGSFSKEYGEFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITG 991
            LG+        E+ S  NTDL + P   +  G +I    GYK+L  DY CF+KNG+ ++ 
Sbjct: 918  LGALESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSA 977

Query: 992  SLYTSGMSEGGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWR 1051
            SLYT+        VPN      S    +E+ +       +YN+  +KE   +  E +K  
Sbjct: 978  SLYTTWY------VPN------SNNTNIEDNI-------NYNS--EKENEGLFLECIKSD 1016

Query: 1052 YSSTNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTF 1111
            Y           P  D +       TYFV DAT+WLRH   ++KLA + LL+FAICLTTF
Sbjct: 1017 Y-----------PEIDFK------TTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTF 1059

Query: 1112 QELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWR 1171
            QELRFLRKSKDE+V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TWR
Sbjct: 1060 QELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWR 1119

Query: 1172 SHVDEFVIEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQ 1231
            +HVDEFVIE++ KAQ K    + + + S R         +FN++ L++DD  M+ KA  +
Sbjct: 1120 THVDEFVIESVMKAQEKLESAS-EPRLSPR---------RFNYVVLISDDDAMKKKAEEK 1169

Query: 1232 SIRAFSTKFMFAICHEIGLSKKVCTD 1257
             I+  ST+F+F++C ++G  + +CTD
Sbjct: 1170 EIKTLSTRFVFSLCTKLGEQRHLCTD 1195

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1013 (46%), Positives = 648/1013 (63%), Gaps = 76/1013 (7%)

Query: 319  SSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFIT 378
            S+Q L+ KLQ+IYK+I+ QE ELQ  CS +T+SQTTDLK +W +YK+N EL++NY  FIT
Sbjct: 272  STQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFIT 331

Query: 379  TALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVF 438
            TALLP+Q + DLLIGQEII+VY+IERRLW+YGTITFLDVLK+FSNFMDPE+CCQFI++VF
Sbjct: 332  TALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVF 391

Query: 439  ISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGK 498
            ISI+N+   IP  FS+ W  RLGDLSRMA ALYP G  DWKLSAE+WY EA+KY +G GK
Sbjct: 392  ISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGK 451

Query: 499  LYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSH 558
            LYYHM+TVQQN+LAAF+NLGKSVFCRD F+P+QQY+QLVIDNIYQRA+  R         
Sbjct: 452  LYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSSNVQ 511

Query: 559  IVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFDPSLIFVQDCERLKHF 617
            I++YLKH E+M+LP+F+EN E Q +   +F +KFG      NFFD   +FVQ+ E +K +
Sbjct: 512  ILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKFY 571

Query: 618  FRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXTASNQS----D 673
            FRH+ L+A++HILQ+VG+G+  N FALL+ELPK I                 N S     
Sbjct: 572  FRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTLS 631

Query: 674  MSIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSS 733
              +    + D  ++F +L +    +    +++IW +SL Y N T + C M+VL+KFL   
Sbjct: 632  FQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQGP 691

Query: 734  LLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYIND 793
             +TALPHLLPW YFL++V  +++ +R+ +S+ FW +FIR+IFPW +I NFLNVL+ ++ D
Sbjct: 692  FVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFLKD 751

Query: 794  QKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIH 853
               +   +++    Y  + L E+L  F ENE+LPEVWNCWG+LWFD I +K  ++   + 
Sbjct: 752  NSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSGLK 811

Query: 854  STGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFG--FTEFNGSD 911
            + G+KD  FLDAP DGI FD  D++G KFWKR  R++ LF+G A +F  G   T  N  +
Sbjct: 812  TAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTNINSLN 871

Query: 912  DWK-------------SLVFKFNE-----PPAEWKEQYL---GSFSKEYGEFESISFVNT 950
              +               +FKF+      P  E   +Y      F+++   FESIS  N 
Sbjct: 872  SEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISENNI 931

Query: 951  DLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTS--GMSEGGSGVP-- 1006
             L + P   ++ G  I    GYK+L+P Y  ++KNG++  G++Y++    ++ G+G+   
Sbjct: 932  ILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGLKPR 991

Query: 1007 ------------NDSEDFG-STKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYS 1053
                        +DS++F    KRL    L     +   ++L + E      E      +
Sbjct: 992  MENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESSDHLAEVEREGDETEDETEETN 1051

Query: 1054 S-------TNSR-----WEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNL 1101
            S       TN R     ++     G+++     + TYF+ DATTWLRHF H+YK+A S L
Sbjct: 1052 SRKVDKYYTNQRDLDTIFKTIKINGEMR--VAYYSTYFIFDATTWLRHFAHIYKIAYSGL 1109

Query: 1102 LKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEH 1161
            L F ICLTTFQELRFLR+S+DE+V+EAATRAVI +R LY  +K++PLRF G +A H+EEH
Sbjct: 1110 LNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKVIPLRFNGKIASHIEEH 1169

Query: 1162 LEIEEQMTWRSHVDEFVIEAIDKAQSK--FNQL-NKDAKAS-GRESITTIDD------GK 1211
            LE EEQ+TWRSHV+EFVIEA+ K+Q    F++L N+ AKA    E++ T D       G 
Sbjct: 1170 LEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDAENMDTADSADTKQRGN 1229

Query: 1212 FN-------FIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCTD 1257
             N          LVTDD NM +KA+ + IR  ST+F+F+IC ++G+   +CT+
Sbjct: 1230 SNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQLGMKYGICTN 1282

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/975 (50%), Positives = 635/975 (65%), Gaps = 59/975 (6%)

Query: 308  NVSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNA 367
            N +  A  S   +Q LV+KLQ+IYKNIV+QE ELQE+C+QLT+SQTTDL ++W IY++N 
Sbjct: 355  NSNDKANNSNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINV 414

Query: 368  ELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDP 427
            EL+ NY TFI+TALL +Q + DL+IGQEI+E YRI RRLW+YGTITFLDVLKNFS+FMDP
Sbjct: 415  ELVTNYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDP 474

Query: 428  EVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQ 487
            EVC QFI +VFISIS +L +IP  +S+ W++RLGDLSRMAIALYPSGFIDWKLS+E+WY 
Sbjct: 475  EVCSQFITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYN 534

Query: 488  EALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFA 547
            +ALKY +G+GKLYYHMST+QQNTL AFVNLGKSVFC+DTFIPS QYMQLVIDNIYQRAF 
Sbjct: 535  QALKYTYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFI 594

Query: 548  ERNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGAT-GSANFFDPSLI 606
            ER S + R S ++EYLKH+EVMLLP+F+ N   Q VV+ +F+ KFG      N F P  I
Sbjct: 595  ERGSNNTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDI 654

Query: 607  FVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXX 666
            F+Q+ E LK+FFRHA  +AESHILQ VGFGD +NPFALLF+LPK +              
Sbjct: 655  FLQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKS 714

Query: 667  TA---SNQSDMSIDDTFLGDPV---QFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMR 720
            +    SN+S MS+D+      +   Q+F  L S +  Y      +IW +SL+Y+N T+++
Sbjct: 715  SGEPTSNESVMSLDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQ 774

Query: 721  CSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESI 780
            C ++VLRKFL+   + ALPHL+ W YF+++V L+ + + +E+S+ FW  F+R++ P  SI
Sbjct: 775  CGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSI 834

Query: 781  TNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDV 840
             +FLNVL+ Y  D       I        +M L ELL  F  NE+LPEVW CWGTLWFD 
Sbjct: 835  VSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDA 894

Query: 841  INSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF 900
            I  K  ++       GV DH+F D+P+DGI FD  DE+GEKFWKR +R+I LF+ IA  F
Sbjct: 895  ITDKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETF 954

Query: 901  PFGFT--------------EFN---GSDDWKSLVFKFNEPPAEWK-EQYLGSFSKEYGEF 942
              G T              E N   GS  +K      N    + + E  LG+  +     
Sbjct: 955  DIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMT--- 1011

Query: 943  ESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGG 1002
            E  + VN  + + P   +    +I    GYK++ P+   F+KNG+L + + YTS  S   
Sbjct: 1012 EMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYS-AQ 1070

Query: 1003 SGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQC 1062
              VP  +          EN +  +S  R + +  D EE  I   F     +ST       
Sbjct: 1071 EIVPKSAAS-------PENSVAGSSPGRSFQS-QDVEEN-IFSVFTNEEENST------S 1115

Query: 1063 LPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKD 1122
            L  G      +   T FVLDAT+WLRH  H+YKLA+++ L F+ICLTTFQELRFLRKSKD
Sbjct: 1116 LLDG-----LNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKD 1170

Query: 1123 ESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAI 1182
            E+V+EAA RA+I +RQLY + K++PLRFTGN+A H+EEHLE EEQ+TWRSHVDEFVIE+I
Sbjct: 1171 ENVMEAAARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESI 1230

Query: 1183 DKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMF 1242
             KAQ KF Q            +    D    F  LV+DD NM+ KA  + IR F+T+F+F
Sbjct: 1231 SKAQKKFLQ----------PFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVF 1280

Query: 1243 AICHEIGLSKKVCTD 1257
            A+C E+G  + +CT+
Sbjct: 1281 ALCSEMGKGRLICTN 1295

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/1009 (47%), Positives = 634/1009 (62%), Gaps = 99/1009 (9%)

Query: 309  VSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAE 368
            + +V+VP + SSQ LV+KLQ+IYK IVKQE ELQERC +LT SQTT+LKNLW IY++N+E
Sbjct: 370  IPSVSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSE 429

Query: 369  LIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPE 428
            L+DNY TFITTA+ PTQP++D  IG+EIIE+Y+IERRLW+YGTITFLD+LKNFSNFMDPE
Sbjct: 430  LVDNYITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPE 489

Query: 429  VCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQE 488
            VCCQFI +VFISISN+L +IP  + V W ++LGDLSRMAIALYPS FIDWKLSAE WY  
Sbjct: 490  VCCQFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMA 549

Query: 489  ALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 548
            A+++ +GHGKLYYHMSTVQQNTL AFVNLGKS+FC++TF+PSQQY+QLVI NIYQRA+A+
Sbjct: 550  AMEFTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYAD 609

Query: 549  RNSGHHRYSH--IVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGA---TGSANFFDP 603
             N+ ++  +   +V+Y+KH EV LLP+F E+ E Q VVL +F  KFG      S N F  
Sbjct: 610  SNNSNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFIS 669

Query: 604  SLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXX 663
              +FVQ+ ++ K F+R+++ +AES ILQ+VG+G+ ++PF+LLFELPK +           
Sbjct: 670  RKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRK 729

Query: 664  XXX---------------TASNQSDMSIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWK 708
                                +    M  ++ FL    +FFE +++          ++IW 
Sbjct: 730  PKTMLILKITQPRLYHRWVGTTLPTMPNNNVFLTAE-EFFENIDTINYPSFMPNSVDIWN 788

Query: 709  ESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWI 768
             SL Y N  S++CSM+V +KFL++  + ALPH LPW YF++++ L+LD  +N     FW+
Sbjct: 789  HSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWV 848

Query: 769  VFIRQIFPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPE 828
             F+R+IFPW SI  FLNVLL Y+ D    +  ++E    Y +M L ELL YF ENE+LPE
Sbjct: 849  EFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPE 908

Query: 829  VWNCWGTLWFDVINSKHVS--------------NLVDIHSTGVKDHMFLDAPVDGISFDH 874
            VW C G+LWFD I  K                 N+ D    GVKD+ F D P+DG  FD 
Sbjct: 909  VWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDE 968

Query: 875  SDESGEKFWKRCVRVILLFRGIAYQFPFGFTEFNGSDDWKSLVFK-----FNEPPAEWKE 929
            SDE GE+FWKR  RVI LF+ +A      +T   G      L+       FN    E+K 
Sbjct: 969  SDEIGERFWKRAARVIFLFKKLAE----SYTGLGG------LILSYEAPVFNRRKDEYKV 1018

Query: 930  ----QYLGSFSKEYG-------------EFESISFVNTDLQSPPHKGMVLGTDIRTLQGY 972
                Q L  FS +                FE+   VN D    P   MV G  I    GY
Sbjct: 1019 NTVCQELLEFSFKLNASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGY 1078

Query: 973  KQLVPDYLCFNKNGDLITGSLY--------TSGMSEGG-SGVPNDSEDFGSTKRLLENEL 1023
            K++ P++  F+KNGD I+ S +        T+ +S    S + +D+   GS      N+ 
Sbjct: 1079 KRVCPNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSG-----NDS 1133

Query: 1024 LVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFVLDA 1083
               S   D  N     E  + +E    +Y +    W Q +        +    TYF+LDA
Sbjct: 1134 AAASTNNDPMN-----ELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDA 1188

Query: 1084 TTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYER 1143
            T+WLRHF H+YK+ATS +LKFAICLTTFQELR+LRKSKD +V+EAATRA+IT+RQLY+E 
Sbjct: 1189 TSWLRHFAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHEN 1248

Query: 1144 KLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSK----FNQLNKDAKAS 1199
             LLPLRFTGNVA H+EEHLE EEQ+TWRSHVDEFVIEA+ KA+ K     N +N D    
Sbjct: 1249 NLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEK 1308

Query: 1200 GRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEI 1248
             +     I         LVTDDI M+NKA  + I+ FST+F+F++ + I
Sbjct: 1309 EKSIFGII---------LVTDDITMKNKAMDRKIKTFSTRFIFSMANYI 1348

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/974 (48%), Positives = 638/974 (65%), Gaps = 83/974 (8%)

Query: 314  VPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNY 373
            +PS   +QT ++KLQEIYK IV QETELQ+RC  LTTSQTT+LK+LW IY+LN ELI NY
Sbjct: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257

Query: 374  FTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQF 433
              FI TALL TQP  DL++GQEI+++YRIE+RLW+YG ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317

Query: 434  IVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYN 493
            I+Y FIS+SN+L +IP  +S++W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++KY 
Sbjct: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377

Query: 494  FGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGH 553
            +G GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+SG 
Sbjct: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGS 437

Query: 554  -------HRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSAN-FFDPSL 605
                   HR S +++YLKHTEVMLLPSFLEN++ Q VVL +F  KFG   + N  FD   
Sbjct: 438  ANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKD 497

Query: 606  IFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXX 665
            +F Q+ E L+++FRHA  +AES +LQL+GFG+P+NPFALLF+LPK +             
Sbjct: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSE 557

Query: 666  XTASNQSDMSIDDTFLGDPVQFFETLNSTKTAYR-FSQDLNIWKESLNYVNKTSMRCSMV 724
             T ++      D     +   +F+ +++  +++     +LNIW +SLN++N TS++CS+ 
Sbjct: 558  ATETSSYTDPFDVQISSE--SYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIH 615

Query: 725  VLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFL 784
            VL KFL++ L+ ALPH L W +F+VA+  +L+ + ++    FWI F+R+  PW SI    
Sbjct: 616  VLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLG 675

Query: 785  NVLLLYINDQ-KPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINS 843
            NVL+ Y+ D   P    + + +  + ++ L +L+EY+ ENE+LPE+W CWGTLWFD I  
Sbjct: 676  NVLVCYMLDNLHPF---LKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIKK 732

Query: 844  KHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFP-- 901
              V  +      GV+DH+F D+P+DGI FD  DE GEKFW R VR +LL +GIA +FP  
Sbjct: 733  CDVMEI-----PGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDL 787

Query: 902  -----FGFTEFNGSDD------WKSLVFKFNEPPAEWKEQY-----LGSFSKEYGEFESI 945
                 F  + F   +D       K+L FK +   A  ++ Y     L          E I
Sbjct: 788  GLKVSFQASVFCRRNDIPPDYFLKNLTFKLD---AYDEDNYNDNNELDDLYDTIEINEEI 844

Query: 946  SFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGV 1005
              VN D Q+ P+  +V G  I    GY +L PDY CF+KNG   +  +Y S  S  G+GV
Sbjct: 845  EAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIY-SQWSNVGNGV 903

Query: 1006 PNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPR 1065
              D    G +   + N           NNL    E    D+                  +
Sbjct: 904  TLDVS--GESIYDVAN-----------NNLSLHWEKIFFDKI-------------AAASK 937

Query: 1066 GDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESV 1125
            G  + +  T   YFV+DAT+WLRHF H++KLA +N LKFAICLTTFQELR+LR SKD++V
Sbjct: 938  GSDENYNCT--LYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTV 995

Query: 1126 LEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKA 1185
            +EAATR+VIT+RQLY E+K++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFVI+AI K 
Sbjct: 996  VEAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKL 1055

Query: 1186 QSKFN--QLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFA 1243
              +F   +L  + K  G+E           F  LVTDD NM  KA+ + I+  +TK++F+
Sbjct: 1056 NQRFQAERLTDENKNKGKE-----------FAVLVTDDDNMNQKAKDRMIKTCNTKYLFS 1104

Query: 1244 ICHEIGLSKKVCTD 1257
            +  ++G++  +CT+
Sbjct: 1105 LGSKLGINSGLCTN 1118

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/972 (48%), Positives = 625/972 (64%), Gaps = 73/972 (7%)

Query: 311  TVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELI 370
            T  +PS   +QT ++KLQEIYK IV QETELQ+RC  LTTSQTT+LK+LW IYKLN ELI
Sbjct: 194  TRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELI 253

Query: 371  DNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVC 430
             NY  FI TALL TQP  DL++GQEI+++YRIE+RLW+YG ITFLDVLK+FSNFMDPEVC
Sbjct: 254  KNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVC 313

Query: 431  CQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEAL 490
            CQFI Y FI ISN+L +IP  +S++W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++
Sbjct: 314  CQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESM 373

Query: 491  KYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN 550
            KY +G GKLYYH++T+QQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+
Sbjct: 374  KYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRS 433

Query: 551  SGH-------HRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSAN-FFD 602
            SG+       HR S +++YLKHTEVMLLPSFLEN++ Q VVL +F  KFG   + N  F 
Sbjct: 434  SGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFS 493

Query: 603  PSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXX 662
               +F Q+ E L+++FRHA  +AES ILQL+GFG+P+NPFALLF+LPK +          
Sbjct: 494  TKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKK 553

Query: 663  XXXXTASNQSDMSIDDTFLGDPVQFFETLNSTKTAYRF-SQDLNIWKESLNYVNKTSMRC 721
                          DD   G    +F+ +++  + +     ++ IW +SLNY+N TS++C
Sbjct: 554  KSGAAEIPHYRDPFDDQ--GSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQC 611

Query: 722  SMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESIT 781
            S+ VL KFL++ L  ALPH L W +F++AV  +L+ I +E    FWI F+R+  PW S+ 
Sbjct: 612  SIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMV 671

Query: 782  NFLNVLLLYINDQ-KPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDV 840
             F NVL+ Y+ D   P    +++ +  + ++ L +L+EYF ENE+LPEVW CWG+LWFD 
Sbjct: 672  TFSNVLVCYMLDNLHPF---LEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDA 728

Query: 841  INSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF 900
            +    V  +      GV+DH+F D+P+DGI FD  DE GEKFW R VR IL  +GIA +F
Sbjct: 729  VKKCDVMEI-----PGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKF 783

Query: 901  P-------FGFTEFNGSDD------WKSLVFKFN--EPPAEWKEQYLGSFSKEYGEFESI 945
            P       F  + F   +D       K+L FK +  E  A      L          E I
Sbjct: 784  PDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEINELI 843

Query: 946  SFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGV 1005
              VN DLQ+ P   +V G  I    GY +L  DY CF+KNG   +  +YT   S  G+GV
Sbjct: 844  ETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQ-WSNVGNGV 902

Query: 1006 PNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPR 1065
              D          + +E L  S   D +              L W        +++    
Sbjct: 903  TLD----------VSSESLYDSTTNDLS--------------LHW----AKILFDKVFTI 934

Query: 1066 GDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESV 1125
            G       +   YFV+DAT+WLRHF H++KLA +N+LKFAICLTTFQELR+LR SKD++V
Sbjct: 935  GKNTDDDGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNV 994

Query: 1126 LEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKA 1185
            +EAATR+VIT+RQLY E+K++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFVI+AI K 
Sbjct: 995  VEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKL 1054

Query: 1186 QSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAIC 1245
               F       K  GR            F  LVTDD NM  KA+ + I+  +TK++F++ 
Sbjct: 1055 NQNFQTERTIDKNKGRSK---------EFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLG 1105

Query: 1246 HEIGLSKKVCTD 1257
             ++G++  +CT+
Sbjct: 1106 SKLGINSGLCTN 1117

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/979 (46%), Positives = 632/979 (64%), Gaps = 93/979 (9%)

Query: 314  VPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNY 373
            +PS   +QT ++KLQEIYK IV QETELQ+RC  LTTSQTT+LK+LW IY+LN ELI NY
Sbjct: 198  LPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNY 257

Query: 374  FTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQF 433
              FI TALL TQP  DL++GQEI+++Y +E+RLW+YG ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 258  INFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317

Query: 434  IVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYN 493
            I+Y FIS+SN+L +IP  +S++W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++KY 
Sbjct: 318  IIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377

Query: 494  FGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER---- 549
            +G GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R    
Sbjct: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSG 437

Query: 550  ---NSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSAN-FFDPSL 605
               N   H+ S +++YLKHTEVMLLPSFLEN++ Q VVL +F  KFG   + N  FD   
Sbjct: 438  TNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKD 497

Query: 606  IFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXXXXX 665
            +F Q+ E L+++FRHA  +AES +LQL+GFG+P+NPFALLF+LPK +             
Sbjct: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSS 557

Query: 666  XTASNQSDMSIDDTFLGDPVQFFETLNSTKTAY-RFSQDLNIWKESLNYVNKTSMRCSMV 724
             T + Q      D     P  +F+ +++  + +     +LNIW ESLN++N TS++CS+ 
Sbjct: 558  ATETPQYRDPFHDK--KSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIH 615

Query: 725  VLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFL 784
            VL KFL++  + ALPH L W YFLVA+  RL+ I ++    FWI F+R+  PW S+ +  
Sbjct: 616  VLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLA 675

Query: 785  NVLLLYINDQ-KPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINS 843
            NVL+ Y+ D   P    + + + ++ +  L +L+E+F ENE+LPE+W CWG+LWFD I  
Sbjct: 676  NVLVCYMLDNLHPF---LKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIKK 732

Query: 844  KHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFG 903
              V  +      GV+DH+F D+P+DGI FD  DE GE+FW R VR I L +GIA +FP  
Sbjct: 733  CDVMEI-----PGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFP-- 785

Query: 904  FTEFNGSDDWKSLVF-KFNEPPAEWKEQYLGSFSKEYGEF-------------------- 942
              +     ++++ VF + N+ P ++   +L  F+ +   +                    
Sbjct: 786  --DLGLKVNFQAPVFCRRNDIPQDY---FLRKFTFKLDAYDEGNNNDNNELDELYETIEI 840

Query: 943  -ESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEG 1001
             E I  VN DL++ P+  +V G  I    GY +L PDY CF+KNG   +  +Y S  S  
Sbjct: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIY-SQWSNV 899

Query: 1002 GSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWR---YSSTNSR 1058
            G+GVP D          + NE +      D +              L W    +    + 
Sbjct: 900  GNGVPID----------VSNEPIYDVTDNDLS--------------LHWEKIFFDRIAAA 935

Query: 1059 WEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLR 1118
            ++ C          D    YFV+DAT+WLRHF H++KLA +++L FAICLTTFQELR+LR
Sbjct: 936  YKNCDE-------NDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLR 988

Query: 1119 KSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFV 1178
             SKD++V+EAATR+VIT+RQLY ERK++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFV
Sbjct: 989  GSKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFV 1048

Query: 1179 IEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFST 1238
            I+AI K    F      A+   +            F  LVTDD NM  KA+ + I+  +T
Sbjct: 1049 IDAIAKLNQNFQTERMIAENKNKNK---------QFAVLVTDDDNMNKKAKDKMIKTCNT 1099

Query: 1239 KFMFAICHEIGLSKKVCTD 1257
            K++F++  ++G++  +CT+
Sbjct: 1100 KYLFSLGSKLGINSGLCTN 1118

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/978 (47%), Positives = 636/978 (65%), Gaps = 85/978 (8%)

Query: 311  TVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELI 370
            T  +PS   +QT ++KLQEIY+ IV QETELQ+RC  LTTSQTT+LK+LW IY+LN ELI
Sbjct: 195  TRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELI 254

Query: 371  DNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVC 430
             NY  FI TALL TQP  DL++GQEI+++YRIE+RLW+YG ITFLDVLKNFSNFMDPEVC
Sbjct: 255  KNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVC 314

Query: 431  CQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEAL 490
            CQFI+Y FIS+S++L +IP  +S++W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++
Sbjct: 315  CQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESM 374

Query: 491  KYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN 550
            KY +G GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+
Sbjct: 375  KYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRS 434

Query: 551  SG-------HHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSAN-FFD 602
            S         HR S +++YLKHTEVMLLPSFLEN++ Q VVL +F  KFG   + N  FD
Sbjct: 435  SAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFD 494

Query: 603  PSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIXXXXXXXXXX 662
               +F Q+ E L+++FRHA  +AES +LQL+GFG+P+NPFALLF+LPK +          
Sbjct: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKK 554

Query: 663  XXXXTASNQSDMSIDDTFLGDPVQFFETLNSTKTAY-RFSQDLNIWKESLNYVNKTSMRC 721
                T   Q     DD    +   +F+ ++S  + +     +LNIW +SLN++N TS++C
Sbjct: 555  KSGATEVPQYRDPFDDQISSE--SYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQC 612

Query: 722  SMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESIT 781
            S+ VL KFL++ L+ ALPH L W +F+VA+  +L+ + ++    FWI F+R+  PW S+ 
Sbjct: 613  SIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMV 672

Query: 782  NFLNVLLLYINDQ-KPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDV 840
            N  NVL+ Y+ D   P    ++  +  + ++ L +L+EYF ENE+LPE+W CWG+LWFD 
Sbjct: 673  NLANVLVCYMLDNIHPF---LERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDA 729

Query: 841  INSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF 900
            I    V  +      GV+DH+F D+P+DGI FD  DE GE+FW R +R IL+ +G+A +F
Sbjct: 730  IKKCDVMEI-----PGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKF 784

Query: 901  P-------FGFTEFNGSDD------WKSLVFKFNEPPAEWKEQYLGSFSKEYGEF----- 942
            P       F    F   +D       K+  FK +E      E+   + + E  E      
Sbjct: 785  PDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDE-----YEENDHNDNNELDELYDTIE 839

Query: 943  --ESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSE 1000
              E I  VN DL++ P+  +V G +I    GY +L PDY CF+KNG   +  +Y S  S 
Sbjct: 840  INEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIY-SQWSN 898

Query: 1001 GGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWE 1060
             G+G+  D                V+SE     ++ D     +   + K  +    +   
Sbjct: 899  VGNGMVLD----------------VSSE-----SMYDAANNNLSPHWEKIFFDRITTAGH 937

Query: 1061 QCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKS 1120
                 G+          YFV+DAT+WLRHF H++KLA +N+LKFAICLTTFQELR+LR S
Sbjct: 938  NGDKNGNCS-------VYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGS 990

Query: 1121 KDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIE 1180
            KD++V+EAATR+VIT+RQLY E+K++PLRFTGN+A ++EE+LE EEQ+TW +HVDEFVI+
Sbjct: 991  KDDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVID 1050

Query: 1181 AIDKAQSKFNQLNKDAKASGRESITTIDDGKFN-FIALVTDDINMRNKARAQSIRAFSTK 1239
            AI K    F            E +   +  K N +  LVTDD NM  KA+ + I+  +TK
Sbjct: 1051 AIAKLNQNFQT----------ERLIDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTK 1100

Query: 1240 FMFAICHEIGLSKKVCTD 1257
            ++F++  +IG++  +CT+
Sbjct: 1101 YLFSLGSKIGINSGLCTN 1118

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  483 bits (1244), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 247/382 (64%), Positives = 292/382 (76%), Gaps = 44/382 (11%)

Query: 313 AVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDN 372
           ++ +K SSQ L++KLQ+IYK IVKQE +LQ+RCSQLTTSQTTDLKNLW IYK+N +LI+N
Sbjct: 388 SITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINN 447

Query: 373 YFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQ 432
           Y  FIT ALLPTQ K DL IG+EIIE+YRIERRLW+YGTITFLDVLK+FSNFMDPEVCCQ
Sbjct: 448 YINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQ 507

Query: 433 FIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKY 492
           FI +VFI+IS IL +IP  +S+ WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+
Sbjct: 508 FISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKF 567

Query: 493 NFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSG 552
            + HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN+G
Sbjct: 568 TYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNG 627

Query: 553 HHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-------------- 598
           +HR   ++EYLKHTEVMLLP+FLE+++ Q VVL +F  KFG   S               
Sbjct: 628 NHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNG 687

Query: 599 ------------------------------NFFDPSLIFVQDCERLKHFFRHASLYAESH 628
                                         + F    +F+Q+ + LK+FFRH+  +A+SH
Sbjct: 688 ANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSH 747

Query: 629 ILQLVGFGDPRNPFALLFELPK 650
           ILQLVGFGDP+NPFALLFELPK
Sbjct: 748 ILQLVGFGDPKNPFALLFELPK 769

 Score =  367 bits (942), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 226/588 (38%), Positives = 328/588 (55%), Gaps = 95/588 (16%)

Query: 686  QFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWA 745
            +FFE ++  +  Y+  Q + IW ESL  +N  S++CS++VL+KFLN  +L ALPHLL W 
Sbjct: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926

Query: 746  YFLVAVGLRLD-AIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLY----INDQKPTKFP 800
            +F++++ L+++ +I +  SK FW  F++ I PW SI NFLNVL++Y    IND+    F 
Sbjct: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDEN---FK 983

Query: 801  IDEYMANYINM----PLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSN-------- 848
            +   ++N  N      L E+L++F +NE+LPE+W CWGTLWFDVI +K++++        
Sbjct: 984  LIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQN 1043

Query: 849  ---------------LVDIHST-------GVKDHMFLDAPVDGISFDHSDESGEKFWKRC 886
                           L D + T       G++DH  LD P+DGI F  +DE G  F+KR 
Sbjct: 1044 NNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRS 1103

Query: 887  VRVILLFRGIAYQFP-FGFTEFNGSDDW------------KSLVFKFN---EPPA----- 925
            +R+I L + +   FP  G    + + ++             +  FK     +P       
Sbjct: 1104 IRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQ 1163

Query: 926  ----------------EWKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGMVLGTD-IRT 968
                            E+ +  L +  + +   E I  +N +LQ  P   ++ G + I  
Sbjct: 1164 TEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFN 1223

Query: 969  LQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLEN-ELLVTS 1027
              GYK+L  +   F++NG++I+GS+Y+S         P D   F   ++  +  E LV  
Sbjct: 1224 YLGYKRLNFNIQSFHENGEIISGSIYSSW--------PIDYNKFKEQQQQQQQQEHLVND 1275

Query: 1028 ERRDYNNLLDKEETP---IIDEFLKWRYS---STNSRWEQCLPRGDLQYFTDTHVTYFVL 1081
                  N+   + TP      EF+K  +    ST S   Q      +    + H T+FV 
Sbjct: 1276 STMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVF 1335

Query: 1082 DATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYY 1141
            DAT+WLRHF H+YKL+ +  LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+IT+RQLY 
Sbjct: 1336 DATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYK 1395

Query: 1142 ERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKF 1189
            E KLLPLRFTGNVA  +EEHLE EEQ+TWRSHVDEFVIEAI ++Q +F
Sbjct: 1396 EGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  422 bits (1086), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 218/411 (53%), Positives = 274/411 (66%), Gaps = 77/411 (18%)

Query: 317 KPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTF 376
           K S+Q L++KLQ IYK IV QE ELQ++C++L+TSQ+T LK LW IYKLN +LI+NY  F
Sbjct: 263 KKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILF 322

Query: 377 ITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVY 436
           I T+L P+Q   D LIG+EI+E+Y+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFI +
Sbjct: 323 ILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITH 382

Query: 437 VFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGH 496
           VF SISN++ ++P  F   W +RLGDLSRMAIALYPS FIDWKLS+E+WY E++K+ F H
Sbjct: 383 VFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSH 442

Query: 497 GKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN------ 550
           GKLYYH+STVQQN L AFVNLGKSVFC DTFIPSQ+YMQLVIDNIYQRAF ERN      
Sbjct: 443 GKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSS 502

Query: 551 -----------------SGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFG 593
                            + + +   ++EYLKH+EVMLLP+FLEN   + VVL +F   FG
Sbjct: 503 NNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562

Query: 594 A-------------------------TGSAN----------------------------F 600
                                     +G AN                             
Sbjct: 563 KIAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINL 622

Query: 601 FDPSLIFVQ-DCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPK 650
           F+   IF Q + + LK+FF++++ +AESHILQL+GFGDP+NPFALLF+LPK
Sbjct: 623 FNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPK 673

 Score =  257 bits (656), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 154/340 (45%), Positives = 206/340 (60%), Gaps = 45/340 (13%)

Query: 942  FESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEG 1001
            FE  S  NTDL   P   ++    +   +GYK+ +PD+  F+KNG+LI+ SLYTS + + 
Sbjct: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDT 1209

Query: 1002 GSGVPNDSEDFGSTKRLLENELLVTSERRDYN----------NLLDKE----ETPIIDEF 1047
             +G  +++    +T    +     +S     N          N+ +KE    E  I ++ 
Sbjct: 1210 INGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269

Query: 1048 LKWRYSSTNSRWEQCLPRGDLQYFTDTHV----TYFVLDATTWLRHFGHVYKLATSNLLK 1103
            L   Y + +  W     RG++  F DT +    TYFVLDAT+WLRHF HVYKLAT+ +LK
Sbjct: 1270 LDPDYKNIDEIW-----RGEM--FHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILK 1322

Query: 1104 FAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLE 1163
            FAICLTTFQELRFLRKSKDE+V+EAATRA+IT+RQLY E++LLPLRFTGN+A H+EEHLE
Sbjct: 1323 FAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLE 1382

Query: 1164 IEEQMTWRSHVDEFVIEAIDKAQSK----FNQLNKDAKAS---------GRESITTIDDG 1210
             EEQ+TWRSHVDEFVIEAI +AQ K     NQ + +  +S                + D 
Sbjct: 1383 FEEQITWRSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDM 1442

Query: 1211 KFNFIALVTDDINMRNKARAQ----SIRAFSTKFMFAICH 1246
             F    LVTDDI+M  K + +     I  FSTKF+F++C+
Sbjct: 1443 IF---VLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCN 1479

 Score =  201 bits (510), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 96/219 (43%), Positives = 140/219 (63%), Gaps = 2/219 (0%)

Query: 684  PVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLP 743
            P  FF  L S K ++     L IW ESL Y+N  S+ CS++VL+KFLN  L  +LPH+LP
Sbjct: 788  PQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLP 847

Query: 744  WAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYINDQKPTKFPIDE 803
            W+YF++++ LR++++ N +S+ FW+ FIR+IFPW SI ++LNV++  + D       I +
Sbjct: 848  WSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITK 907

Query: 804  YMANYINMPLPELLEYFCENE-DLPEVWNCWGTLWFDVINSKHVSNLVDI-HSTGVKDHM 861
             + NY N  L ELL  F ENE +LPEVW C+G+LWFDVI   +     D   +  +KD  
Sbjct: 908  LINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDTK 967

Query: 862  FLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF 900
             L+ P+DG+ FD  +E+G  FWKR  R+I LF+ +  +F
Sbjct: 968  CLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRF 1006

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  137 bits (345), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 178/825 (21%), Positives = 328/825 (39%), Gaps = 145/825 (17%)

Query: 359  LWVIYKLNAELIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVL 418
            L  ++KL+ +++  Y  FI  AL     + DL+ G+E +   R+  RL  +     L+++
Sbjct: 144  LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 419  KNFSNFM----------DPEVCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAI 468
            +N+ N M          + +   +FI    I I+++L  IP  F   W   +GDL+R+ +
Sbjct: 204  ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 469  ALYPSGFIDWKLSAEHWYQ-----EALKYNFGHGK----------LYYHMSTVQQNTLAA 513
             L       ++L++ H Y       A+ Y+  +GK           Y+++S VQ ++LA 
Sbjct: 264  LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 514  FVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSHIVEYLKHTEVMLLPS 573
             V L K +   +T +  +   QL ID I  +         ++  ++ + +  T +++   
Sbjct: 324  IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLL-------NKQVNLKQSMGGTTILM--- 373

Query: 574  FLENVESQGVVLAFFDQKFGATGSANFFDPSLIFVQDCERLK-HFFRHASLYAESHILQL 632
                      +L+ F   FG+T S+         +   ER   H+F +   +A  + L  
Sbjct: 374  ------KYFTLLSLF---FGSTSSSQ--------LSGMERSSLHYFWNE--FANEYHLNY 414

Query: 633  VGFGDPRNPFALLFELPKCIXXXXXXXXXXXXXXTASNQSDMSIDDTFLGDPVQFFETLN 692
                 P N          C                A   S +SI +T + +     + LN
Sbjct: 415  SSLRKPVN----------CKYRQKEINYSMFYFNNAPLFSLISIVETIIMN-----KKLN 459

Query: 693  STKTAYRFSQDLNI-------WKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWA 745
                 Y+ S D  I       WK  +  ++ T +  + ++ +KFL  ++  + P +LPW 
Sbjct: 460  PFFCVYKSSDDFEIKSVSLSNWKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWL 519

Query: 746  YFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYINDQKPTKFPIDEYM 805
             F ++V   +  + +      W   ++ + PW+ I  +LN  +  +N        +   +
Sbjct: 520  LFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTLRALI 579

Query: 806  ANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIHSTGVKDHMFLDA 865
             N  +  L +LL Y     +  E+  C G +WFD + SK     +  + + +K   + +A
Sbjct: 580  KNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASKIKQASITTNESLMKFKSY-NA 638

Query: 866  PVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFTEFNGSDDWKSLVFKFNEPPA 925
              D + +D  D+   K W R + +ILL + +   +P      + S   +SL    N    
Sbjct: 639  SEDSLIYDDDDQVYTKMWTRALLIILLIKNVINDYP---ELIDVSIRGQSLT---NSSCI 692

Query: 926  EWKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQL-----VPDYL 980
            +  +     +  ++G FE             +   V+  D  TL G  ++     +PD+ 
Sbjct: 693  KNSDSLTNDYLFDWG-FE-----------LNNNNAVIIDD--TLHGRNRIFKFSYIPDFQ 738

Query: 981  CFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFG----STKRLLENELLVTSERRDYNNLL 1036
             F+KNGD+  G    S      S   N  ED       ++RLL       S   DY+   
Sbjct: 739  DFDKNGDITWGYSLISNYDYIYSNDFNSEEDGNFFQRYSRRLL-------SAHNDYSE-- 789

Query: 1037 DKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKL 1096
            DK +                            +Y       YF++D   WL+H   + + 
Sbjct: 790  DKSK----------------------------KYLPKLENNYFMVDTLAWLKHSNKLKRF 821

Query: 1097 ATSNLLKFAICLTTFQELRFLRK-SKDESVLEAATRAVITVRQLY 1140
                 +K  + ++   +L  L+  S+ ESV  +A+R +I +  LY
Sbjct: 822  IAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLY 866

>Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON}
           YGR067C (REAL)
          Length = 806

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 87/191 (45%), Gaps = 36/191 (18%)

Query: 688 FETLNSTKTA-YRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSLL-----TALPHL 741
           +  LNS + A + F   +NI ++S N+ N + +  +  V ++F+ S+ L     T LP  
Sbjct: 319 YHYLNSRENAWFIFDLWVNILRDSNNFNNDSLLIFNWFVNQEFILSNSLKDFVYTGLP-- 376

Query: 742 LPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNF-LNVLLLYIND----QKP 796
                 ++   L L  I       +    I+++FP E   +F ++ LL+Y+N+    Q+P
Sbjct: 377 ------IIKTDLTLKQINVLTDSAYVYFIIKKVFPQELPPDFRVHDLLIYLNECFIMQQP 430

Query: 797 TKFPIDE---YMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIH 853
            K          AN +N  + +     C+++     W  W T+WF+ IN+      + I 
Sbjct: 431 IKSDTSSNSSLFANVLNARITD-----CKSK---SHWLLWETIWFEFINN------LTIR 476

Query: 854 STGVKDHMFLD 864
           S   ++  F+D
Sbjct: 477 SGTTRNIWFID 487

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 131,271,873
Number of extensions: 5894607
Number of successful extensions: 16161
Number of sequences better than 10.0: 37
Number of HSP's gapped: 16396
Number of HSP's successfully gapped: 65
Length of query: 1257
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1136
Effective length of database: 39,606,813
Effective search space: 44993339568
Effective search space used: 44993339568
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 72 (32.3 bits)