Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_4014na 1ON31930912781e-178
AFR291Cna 1ON18829750.42
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4014
         (319 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4014 Chr4 (33833..34792) [960 bp, 319 aa] {ON} similar to A...   496   e-178
AFR291C Chr6 complement(964460..965026) [567 bp, 188 aa] {ON} NO...    33   0.42 

>Ecym_4014 Chr4 (33833..34792) [960 bp, 319 aa] {ON} similar to
           Ashbya gossypii AFR291C
          Length = 319

 Score =  496 bits (1278), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 254/309 (82%), Positives = 254/309 (82%)

Query: 1   MHGHRNIKQDTQRQARSRRSGVLVVVPPRTESGCSSPAGVAPAGRRPLHAMLTSSSSRKV 60
           MHGHRNIKQDTQRQARSRRSGVLVVVPPRTESGCSSPAGVAPAGRRPLHAMLTSSSSRKV
Sbjct: 1   MHGHRNIKQDTQRQARSRRSGVLVVVPPRTESGCSSPAGVAPAGRRPLHAMLTSSSSRKV 60

Query: 61  PQNTSSCTMTSIMHRXXXXXXXXXXXXXXLDRYTKRRRRLGSESDGTLSTLLFPSGNRQQ 120
           PQNTSSCTMTSIMHR              LDRYTKRRRRLGSESDGTLSTLLFPSGNRQQ
Sbjct: 61  PQNTSSCTMTSIMHRATGSTSSSSGTAAALDRYTKRRRRLGSESDGTLSTLLFPSGNRQQ 120

Query: 121 LAGVQTLRSALRPSAEVAPRLQSALFRFATESKVRRHRGGXXXXXXXXXXXXXXXXXXXX 180
           LAGVQTLRSALRPSAEVAPRLQSALFRFATESKVRRHRGG                    
Sbjct: 121 LAGVQTLRSALRPSAEVAPRLQSALFRFATESKVRRHRGGAAEPSEEALTAAASAATGAL 180

Query: 181 XDSRVNGMQQVVSVRPIFDPQGCAGRSARCGGPLDDIMGAGHGAECQEGVPRAEXXXXXX 240
            DSRVNGMQQVVSVRPIFDPQGCAGRSARCGGPLDDIMGAGHGAECQEGVPRAE      
Sbjct: 181 GDSRVNGMQQVVSVRPIFDPQGCAGRSARCGGPLDDIMGAGHGAECQEGVPRAEQRQPGQ 240

Query: 241 XXXXXXXXXXXXXXYWLQVASGETVIIDGTLQREDAVRAGSTIYVDGSVTFQLYDKVYWC 300
                         YWLQVASGETVIIDGTLQREDAVRAGSTIYVDGSVTFQLYDKVYWC
Sbjct: 241 QGRFPGQDPPRRRFYWLQVASGETVIIDGTLQREDAVRAGSTIYVDGSVTFQLYDKVYWC 300

Query: 301 LRWSTKKDG 309
           LRWSTKKDG
Sbjct: 301 LRWSTKKDG 309

>AFR291C Chr6 complement(964460..965026) [567 bp, 188 aa] {ON}
           NOHBY635; No homolog in Saccharomyces cerevisiae
          Length = 188

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 280 GSTIYVDGSVTFQLYDKVYWCLRWSTKKD 308
           G  I  DG +TF LY  VYW + W  +++
Sbjct: 157 GDRICTDGPLTFALYTGVYWSVGWRAERE 185

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 135 AEVAPRLQSALFRFATESKVRRHR 158
           A++  R+QSAL RFATE KVRR R
Sbjct: 84  ADMPERIQSALGRFATECKVRRSR 107

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,957,465
Number of extensions: 681463
Number of successful extensions: 1430
Number of sequences better than 10.0: 3
Number of HSP's gapped: 1461
Number of HSP's successfully gapped: 4
Length of query: 319
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 209
Effective length of database: 40,868,139
Effective search space: 8541441051
Effective search space used: 8541441051
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)