Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40135.708ON54254229290.0
AFR292W5.708ON54154226700.0
SAKL0E15048g5.708ON54254225530.0
KLLA0A00484g5.708ON54354325060.0
TDEL0B021205.708ON54854824800.0
YKR097W (PCK1)5.708ON54954824720.0
Smik_11.3615.708ON54954824580.0
NDAI0E050805.708ON55155124540.0
CAGL0H06633g5.708ON54453524500.0
Suva_11.3345.708ON54854824450.0
NCAS0A031605.708ON55255224440.0
KNAG0C066405.708ON54753424440.0
Skud_11.3375.708ON54954824430.0
KAFR0H001605.708ON54954924220.0
ZYRO0B16456g5.708ON54854824090.0
KLTH0E00902g5.708ON54454424010.0
Kwal_55.196635.708ON54454423430.0
Kpol_1043.755.708ON55851822410.0
TPHA0E001705.708ON57852422240.0
TBLA0E017005.708ON57654222210.0
Suva_7.275singletonON961001413e-10
KLTH0F02024g1.67ON734100800.37
TPHA0B046201.67ON72086780.72
Kpol_2000.791.67ON70786751.7
CAGL0E00385g1.67ON60887741.8
TPHA0O001601.527ON125397707.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4013
         (542 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...  1132   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...  1033   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   988   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   969   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   959   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...   956   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...   951   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   949   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   948   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...   946   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   946   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...   946   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   945   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   937   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   932   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   929   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   907   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   867   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   861   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   860   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    59   3e-10
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...    35   0.37 
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...    35   0.72 
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...    33   1.7  
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...    33   1.8  
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...    32   7.2  

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score = 1132 bits (2929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/542 (100%), Positives = 542/542 (100%)

Query: 1   MSPSKVFQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGE 60
           MSPSKVFQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGE
Sbjct: 1   MSPSKVFQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGE 60

Query: 61  KTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAG 120
           KTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAG
Sbjct: 61  KTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAG 120

Query: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180
           WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS
Sbjct: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180

Query: 181 SKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVT 240
           SKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVT
Sbjct: 181 SKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVT 240

Query: 241 LFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAI 300
           LFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAI
Sbjct: 241 LFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAI 300

Query: 301 RYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCD 360
           RYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCD
Sbjct: 301 RYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCD 360

Query: 361 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420
           ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT
Sbjct: 361 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420

Query: 421 MLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVF 480
           MLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVF
Sbjct: 421 MLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVF 480

Query: 481 GLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGP 540
           GLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGP
Sbjct: 481 GLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGP 540

Query: 541 QL 542
           QL
Sbjct: 541 QL 542

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score = 1033 bits (2670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/542 (89%), Positives = 520/542 (95%), Gaps = 1/542 (0%)

Query: 1   MSPSKVFQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGE 60
           MSPSKV+Q+PEEKIR+ELGLSSGVL IRRNAPAA+LYEDAL ER TAISSTGALIAYSGE
Sbjct: 1   MSPSKVYQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGE 60

Query: 61  KTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAG 120
           KTGRSPKDKRIVDEPTS++ +WWGPVNRK SE+TW INRERA D+LRTREHLYIVDA+AG
Sbjct: 61  KTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAG 120

Query: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180
           WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS
Sbjct: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180

Query: 181 SKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVT 240
           SKTTVEINF+AMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG    DVT
Sbjct: 181 SKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVT 239

Query: 241 LFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAI 300
           LFFGLSGTGKTTLSADQHR LIGDDEHCWSDYGVFNIEGGCYAKCIGLS EKEPEIFNAI
Sbjct: 240 LFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAI 299

Query: 301 RYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCD 360
           +YGSVLENVVY+PV+RVVDY+DSSITENTRCAYPIEYIPSA+IPCLS +HPSNIVLLTCD
Sbjct: 300 KYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCD 359

Query: 361 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420
           ASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT
Sbjct: 360 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 419

Query: 421 MLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVF 480
           MLAEKMSQHNA+AWLINTGWTG+SY +GGKRCPLKYTRAILD+IH G+LA A+YETLPVF
Sbjct: 420 MLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVF 479

Query: 481 GLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGP 540
           GLSIP+AVEGVP+ELLNP++NWVEGE KY+ AV++LA+ F +NFKIYQDQAT+EV+ AGP
Sbjct: 480 GLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGP 539

Query: 541 QL 542
           Q+
Sbjct: 540 QI 541

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  988 bits (2553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/542 (84%), Positives = 499/542 (92%)

Query: 1   MSPSKVFQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGE 60
           MSPSK + S E++IR+EL LS  V+ IRRNAPAALLYEDAL ER T ISS+GALIAYSGE
Sbjct: 1   MSPSKTYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGE 60

Query: 61  KTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAG 120
           KTGRSP+DKRIVDE TS + VWWGPVN+K SERTW INRERA DYLRTR+HLYIVDA+AG
Sbjct: 61  KTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAG 120

Query: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180
           WDPRYRIK+R+VC RAYHALFMTNMLIRPTE+ELAEFGEPDFTVWNAGQFPANTHT GM+
Sbjct: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMT 180

Query: 181 SKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVT 240
           SKTTVEINFK MEM+ILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQGIA  DVT
Sbjct: 181 SKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVT 240

Query: 241 LFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAI 300
           LFFGLSGTGKTTLSAD HRLLIGDDEHCWSD+GVFNIEGGCYAKCIGLSAEKEPEI+NAI
Sbjct: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAI 300

Query: 301 RYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCD 360
           ++GSVLENV+Y P +R VDY+DSSITENTRCAYPI+YIPSAKIPCL+++HPSNIVLLTCD
Sbjct: 301 KFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCD 360

Query: 361 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420
           ASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT
Sbjct: 361 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420

Query: 421 MLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVF 480
           MLAEKM++HNANAWLINTGWTG+SYVSGGKRCPLKYTRAILD+IH GSLA   YETLP F
Sbjct: 421 MLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF 480

Query: 481 GLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGP 540
            L IP  V  VPSELLNP++NW+EGE KY+ AV +LA LFV+NFK YQD+AT +VL AGP
Sbjct: 481 NLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGP 540

Query: 541 QL 542
           QL
Sbjct: 541 QL 542

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/543 (82%), Positives = 499/543 (91%), Gaps = 1/543 (0%)

Query: 1   MSPSKVFQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGE 60
           MSP+K   S EE IR+ELGLS+ V+ IRRNAPAALLYEDAL ER+TAIS+ GALIAYSG+
Sbjct: 1   MSPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGD 60

Query: 61  KTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAG 120
           KTGRSP+DKRIV+E TS + VWWGPVN+  SERTW+INRERA DYLRTR+H+YIVDA+AG
Sbjct: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120

Query: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180
           WDPRYRIK+R+VC RAYHALFMTNMLIRP++EEL  FGEPDFTVWNAGQFPANTHT GM+
Sbjct: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180

Query: 181 SKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVT 240
           SKTTVEINFK MEMVILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQGI   DVT
Sbjct: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240

Query: 241 LFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAI 300
           LFFGLSGTGKTTLSAD HRLLIGDDEHCWSD+GVFNIEGGCYAKC+GLSAEKEPEIFNAI
Sbjct: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300

Query: 301 RYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCD 360
           ++GSVLEN++Y+P +R VDY+DS+ITENTRCAYPIEYIPSAKIPCL++ HP NIVLLTCD
Sbjct: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360

Query: 361 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420
           ASGVLPPVSKLTP+QVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL+LHPMKYAT
Sbjct: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420

Query: 421 MLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVF 480
           MLAEKM++HNANAWLINTGWTG+SYV+GGKRCPLKYTRAILDAIH GSLA  +YE LP+F
Sbjct: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480

Query: 481 GLSIPRAV-EGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAG 539
            L IP+AV + VP+ LLNPS+NW EGE KY+  V SLANLFV+NFK YQD+AT++VL AG
Sbjct: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAG 540

Query: 540 PQL 542
           PQL
Sbjct: 541 PQL 543

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/548 (81%), Positives = 497/548 (90%), Gaps = 6/548 (1%)

Query: 1   MSPSKVFQSP------EEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGAL 54
           MSPSK+ +S       E+KIR EL LS+ V+ IRRNAPAA+LYEDAL E+ T I+S+GAL
Sbjct: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYI 114
           IAYSG+KTGRSPKDKRI++E TS + +WWGPVN+ + E+TW INRERA DYLRTR HLYI
Sbjct: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120

Query: 115 VDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           VDAFAGWDPRYRIK+R+VC RAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180

Query: 175 HTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGI 234
           HT+GMSSKTTVEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQGI
Sbjct: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 AKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEP 294
            K DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCIGL+AEKEP
Sbjct: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300

Query: 295 EIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNI 354
           EI+NAI++GS+LENVVY+P +R VDY+DSSITENTRCAYPIE+IPSAKIPCL++SHP N+
Sbjct: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360

Query: 355 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           VLLTCDASGVLPP+SKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADY 474
           P++YATMLA+KMS+H ANAWLINTGWTG+SYV+GGKRCPLKYTRAILDAIH GSLA   Y
Sbjct: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480

Query: 475 ETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKE 534
           ETLP F L IP  V GVP ELLNPS+NWVEGE KY+ AV +LA LFV+NFKIYQD+AT E
Sbjct: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540

Query: 535 VLYAGPQL 542
           VL AGPQ+
Sbjct: 541 VLAAGPQV 548

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/548 (81%), Positives = 492/548 (89%), Gaps = 6/548 (1%)

Query: 1   MSPSKVFQSP------EEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGAL 54
           MSPSK+  +       E+KIR EL LS  V  IRRNAPAA+LYED L E  T ISS+GAL
Sbjct: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYI 114
           IAYSG KTGRSPKDKRIV+EPTS +++WWGPVN+  SERTW INRERA DYLRTR+H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           VDAFAGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGI 234
           HT+ MSSK+T+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 AKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEP 294
             GDVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD+GVFNIEGGCYAKCI LSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNI 354
           EIF+AI++GSVLENV+Y+  S VVDYDDSSITENTRCAYPI+YIPSAKIPCL++SHP NI
Sbjct: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADY 474
           P++YATMLA KMSQH ANA+LINTGWTG+SYVSGGKRCPLKYTRAILD+IH GSLAN  Y
Sbjct: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 475 ETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKE 534
           ETLP+F L +P  V GVP+ELLNP++NW +GE KY  AVT+LANLFVQNFKIYQD+AT +
Sbjct: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540

Query: 535 VLYAGPQL 542
           VL AGPQ 
Sbjct: 541 VLAAGPQF 548

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/548 (81%), Positives = 491/548 (89%), Gaps = 6/548 (1%)

Query: 1   MSPSKV------FQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGAL 54
           MSPSK+          E+KIR EL LS  V  IRRNAPAA+LYED L E+ T ISS+GAL
Sbjct: 1   MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYI 114
           IAYSG KTGRSPKDKRIV+EPTS +++WWGPVN+  SERTW INRERA DYLRTR+H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           VDAFAGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGI 234
           HT+ MSSK+T+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 AKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEP 294
             GDVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD+GVFNIEGGCYAKCI LSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNI 354
           EIF+AI++G+VLENV Y+  S VVDYDDSSITENTRCAYPI+YIPSAKIPCL++SHP NI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADY 474
           P++YATMLA KMSQH ANA+LINTGWTG+SYVSGGKRCPLKYTRAILD+IH GSLAN  Y
Sbjct: 421 PIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 475 ETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKE 534
           E+LP+F L +P  V+GVP+ELLNP++NW +GE KY  AVTSLA LFV+NFKIYQD+AT +
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPD 540

Query: 535 VLYAGPQL 542
           VL AGPQ 
Sbjct: 541 VLAAGPQF 548

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/551 (80%), Positives = 493/551 (89%), Gaps = 9/551 (1%)

Query: 1   MSPSKVFQSP---------EEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISST 51
           MSP K   +P         E+KIR EL LS  V  IRRNAPAA+LYEDAL ERNT ISST
Sbjct: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60

Query: 52  GALIAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREH 111
           GAL+AYSGEKTGRSP+DKRIV+E TS + +WWGPVN+  SERTW INRERA DYLRTR+H
Sbjct: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120

Query: 112 LYIVDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFP 171
           LYIVDAFAGWDP YRIK+R+VC RAYHALFMTNMLIRPT+EELAEFGEPDFTVWNAGQFP
Sbjct: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180

Query: 172 ANTHTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSAN 231
           AN HT+ MSSKTT+EINFKAMEMVILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSAN
Sbjct: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240

Query: 232 QGIAKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAE 291
           QGI  GDVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LS E
Sbjct: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300

Query: 292 KEPEIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHP 351
           KEPEIF AI+YGS+LENV+Y+P +RVV YDDS++TENTRCAYPIE+IPSAKIPCL+++HP
Sbjct: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360

Query: 352 SNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL 411
           SNI+LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL
Sbjct: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420

Query: 412 ALHPMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLAN 471
           ALHP++YATMLA+K+S+H+ANAWLINTGWTG+SYVSGGKRCPLKYTRAILD+IH GSLA 
Sbjct: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480

Query: 472 ADYETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQA 531
            ++ETLPVF L +P  V  VP ELLNP++NW +GE KY+ AV++LA+LFV+NFKIYQD+A
Sbjct: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540

Query: 532 TKEVLYAGPQL 542
           T EVL A P++
Sbjct: 541 TPEVLAAAPRI 551

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  948 bits (2450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/535 (82%), Positives = 484/535 (90%)

Query: 8   QSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGEKTGRSPK 67
            S EE+IRSELGLS  V +IRRNAPAA+LY+DAL E+ T ISS GALIAYSGEKTGRSPK
Sbjct: 10  NSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPK 69

Query: 68  DKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPRYRI 127
           DKRIV+E TS + VWWGPVN+  SERTW INRERA DYLRTRE LY+VDAFAGWDP+YRI
Sbjct: 70  DKRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRI 129

Query: 128 KIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEI 187
           K+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN  T+ M+SKTT+EI
Sbjct: 130 KVRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEI 189

Query: 188 NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFGLSG 247
           NFKAMEMVILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSS NQGI  GDVTLFFGLSG
Sbjct: 190 NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSG 249

Query: 248 TGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGSVLE 307
           TGKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEIF+AIR+GSVLE
Sbjct: 250 TGKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLE 309

Query: 308 NVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGVLPP 367
           NV+Y+  S  VDYDDSSITENTRCAYPI++IPSAKIPCL+ +HP NI+LLTCDASGVLPP
Sbjct: 310 NVIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPP 369

Query: 368 VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMS 427
           VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHPM+YATMLAEKM 
Sbjct: 370 VSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMH 429

Query: 428 QHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSIPRA 487
           +H+ANAWLINTGWTG+SYVSGGKRC LKYTRAILDAIH GSLA A++E+LP+F L +P+A
Sbjct: 430 EHSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKA 489

Query: 488 VEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGPQL 542
           VEGVPSELLNP+RNW EGE KY  AV+ LA LFV+NFK YQD+AT +VL AGPQL
Sbjct: 490 VEGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/548 (80%), Positives = 488/548 (89%), Gaps = 6/548 (1%)

Query: 1   MSPSKV------FQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGAL 54
           MSPSK+          E+KIR EL LS  V  IRRNAPAA+LYED L E+ T ISS+GAL
Sbjct: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYI 114
           IAYSG KTGRSPKDKRIV+EPTS +++WWGPVN+  SERTW INRERA DYLRTR+H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           VDAFAGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGI 234
           HT+ MSSK+T+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240

Query: 235 AKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEP 294
             GDVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LSAEKEP
Sbjct: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNI 354
           EIF+AIR+G+VLENV Y+  S VVDYDDSSITENTRCAYPI+YIPSAKIPCL++SHP NI
Sbjct: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADY 474
           P++YATMLA KMSQH ANA+LINTGWTG+SYVSGG RC LKYTRAILD+IH GSLA A Y
Sbjct: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480

Query: 475 ETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKE 534
           E+LP+F L +P  V GVP+ELLNP++NW +GE KY  AVT+LANLFV+NFKIYQD+AT +
Sbjct: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540

Query: 535 VLYAGPQL 542
           VL AGPQ 
Sbjct: 541 VLAAGPQF 548

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/552 (79%), Positives = 491/552 (88%), Gaps = 10/552 (1%)

Query: 1   MSPSKVFQSP----------EEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISS 50
           MSP KV  S           E+ IR ELGLS  V  IRRNAPAA+LYEDAL ER T I+S
Sbjct: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60

Query: 51  TGALIAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTRE 110
           +GALIAYSG KTGRSP+DKRIV+E TS + VWWGPVN+  SE+TW INRERA DYLRTR+
Sbjct: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120

Query: 111 HLYIVDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQF 170
           HLYIVDAFAGWDP+YRIK+R+VC RAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQF
Sbjct: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180

Query: 171 PANTHTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSA 230
           PAN +T+ MSSKTT+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP+ HN+LTLHSSA
Sbjct: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240

Query: 231 NQGIAKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSA 290
           NQGI  GDVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LSA
Sbjct: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300

Query: 291 EKEPEIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSH 350
           EKEPEIFNAI+YGS+LENV+Y+  +RVVDYDD+SITENTRCAYPIEYIPSAKIPCL++SH
Sbjct: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360

Query: 351 PSNIVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPF 410
           P NI+LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420

Query: 411 LALHPMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLA 470
           LALHP++YATMLAEK+S H+A+AWLINTGWTG+SYV+GGKRCPLKYTRAILD+IH GSLA
Sbjct: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480

Query: 471 NADYETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQ 530
              YETLP+F LS+P AV GVP E+LNP++NW EGE KYS AV+ L +LFV+NFK YQD+
Sbjct: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540

Query: 531 ATKEVLYAGPQL 542
           AT +VL AGPQ+
Sbjct: 541 ATPDVLAAGPQI 552

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/534 (82%), Positives = 487/534 (91%)

Query: 9   SPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGEKTGRSPKD 68
           S E+KIR EL LS  V+ IRRNAPAA+LYEDAL ER T I+S+GALIAYSGEKTGRSPKD
Sbjct: 14  SVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKD 73

Query: 69  KRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPRYRIK 128
           KRIV+E TS + VWWGPVN+  SERTW+INRERA DYLRTR+HLYIVDAFAGWDP+YRIK
Sbjct: 74  KRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIK 133

Query: 129 IRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEIN 188
           +R+VC RAYHALFMTNMLIRP++EELA FGEPDFTVWNAGQFPAN HT+ MSSK+T+EIN
Sbjct: 134 VRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEIN 193

Query: 189 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFGLSGT 248
           FKAMEMVILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQGI  GDVTLFFGLSGT
Sbjct: 194 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGT 253

Query: 249 GKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGSVLEN 308
           GKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LSAEKEPEIF+AIR+GSVLEN
Sbjct: 254 GKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLEN 313

Query: 309 VVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGVLPPV 368
           V Y+  S  VDYDDS+ITENTRCAYPIEYIPSAKIPCL++SHP NI+LLTCDASGVLPPV
Sbjct: 314 VAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPV 373

Query: 369 SKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQ 428
           +KL+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP++YA MLA KMS+
Sbjct: 374 AKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSE 433

Query: 429 HNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSIPRAV 488
           H ANA+LINTGWTG+SYVSGGKRCPLKYTRAILDAIH GSLA A+YE+LP+F L +P AV
Sbjct: 434 HKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAV 493

Query: 489 EGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGPQL 542
            GVP ELLNP++NW +GE KY+ AV++LA+LFV+NFKIYQD+AT +VL AGP L
Sbjct: 494 NGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/548 (80%), Positives = 491/548 (89%), Gaps = 6/548 (1%)

Query: 1   MSPSKVFQSP------EEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGAL 54
           MSPSK+  +       E+KIR EL LS  V  IRRNAPAA+LYED L E+ T ISS+GAL
Sbjct: 1   MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYI 114
           IAYSG KTGRSPKDKRIV+E TS +++WWGPVN+  SERTW INRERA DYLRTR+H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           VDAFAGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGI 234
           HT+ MSSK+T+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 AKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEP 294
             GDVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD+GVFNIEGGCYAKCI LSAEKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 295 EIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNI 354
           EIF+AI++G+VLENV Y+  S VVDYDDSSITENTRCAYPI+YIPSAKIPCL++SHP NI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 355 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           +LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADY 474
           P++YATMLA KMS H +NA+LINTGW+G+SYVSGGKRCPLKYTRAILD+IH GSLAN  Y
Sbjct: 421 PIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 475 ETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKE 534
           E+LP+F L +P  V+GVP+ELLNP++NW +GE KY  +VT+LANLFV+NFKIYQD+AT +
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPD 540

Query: 535 VLYAGPQL 542
           VL AGPQ 
Sbjct: 541 VLAAGPQF 548

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/549 (79%), Positives = 486/549 (88%), Gaps = 7/549 (1%)

Query: 1   MSPSKV------FQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALL-ERNTAISSTGA 53
           MSPSKV        + E+KIR EL LSSGV  IRRNAP ++LYEDAL  E+NT ISSTGA
Sbjct: 1   MSPSKVTTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGA 60

Query: 54  LIAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLY 113
           LIAYSGEKTGR PKDKRIV+E  S   +WWGPVN+  SERTW+INRERA DYLRTREH+Y
Sbjct: 61  LIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIY 120

Query: 114 IVDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPAN 173
           IVDAFAGWDP+YRIK+R+VC RAYHALFMTNMLIRPT++EL  FG+PDFTVWNAGQFPAN
Sbjct: 121 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPAN 180

Query: 174 THTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG 233
            HTE MSSKTT+EINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPI+HNVLTLHSSAN+G
Sbjct: 181 FHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEG 240

Query: 234 IAKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKE 293
           I K DVTLFFGLSGTGKTTLSAD HRLLIGDDEHCWSD GVFNIEGGCYAKCI LS EKE
Sbjct: 241 IEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKE 300

Query: 294 PEIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSN 353
           PEIFN+I++GS+LENVVY+P SR VDYDDSSITENTRCAYPIE+IPSAKIPC++NSHP N
Sbjct: 301 PEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKN 360

Query: 354 IVLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLAL 413
           I+LLTCDASGVLPPVSKLT +QVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLAL
Sbjct: 361 IILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLAL 420

Query: 414 HPMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANAD 473
           HPMKYATMLAEKM +H ANAWLINTGWTG+SY++GGKRCPL YTRAILDAIH GSL    
Sbjct: 421 HPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKES 480

Query: 474 YETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATK 533
           +ETLP+F L +P+ V  VP++LLNPS+NW EGE KYS AV  L+ LF++NFK Y+D+ATK
Sbjct: 481 FETLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATK 540

Query: 534 EVLYAGPQL 542
           EVL AGP+L
Sbjct: 541 EVLAAGPRL 549

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/548 (79%), Positives = 483/548 (88%), Gaps = 6/548 (1%)

Query: 1   MSPSKV------FQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGAL 54
           MSPSKV          EE+IR EL L S V+ IR NAPAA LYED L E+ TA+ S+GAL
Sbjct: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYI 114
            AYSG KTGRSPKDKRI++E TS N+VWWGPVN+  SE+TW INRERA DYLRTR+HLYI
Sbjct: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120

Query: 115 VDAFAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           +DA+AGWDPRYRIK+R++C RAYHALFMTNMLIRP+ EELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180

Query: 175 HTEGMSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGI 234
           +TEGM+SKTTVEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQGI
Sbjct: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 235 AKGDVTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEP 294
            +GDVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCI L+AEKEP
Sbjct: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300

Query: 295 EIFNAIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNI 354
           EI+NAI++GSVLENVV++  +R VDY D+SITENTRCAYPI+YIPSAKIPCL++ HPSNI
Sbjct: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360

Query: 355 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 414
           VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420

Query: 415 PMKYATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADY 474
           PM+YATMLA+KM QHNANAWL+NTGWTG+SY +GGKRCPLKYTRAILD+IH GSL+ ADY
Sbjct: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480

Query: 475 ETLPVFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKE 534
           ETLP+F L  P  V GVP  LLNP+++WVEG  KY+ AV +LA  F +NFKIYQDQAT +
Sbjct: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540

Query: 535 VLYAGPQL 542
           VL AGPQ 
Sbjct: 541 VLAAGPQF 548

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/544 (79%), Positives = 478/544 (87%), Gaps = 2/544 (0%)

Query: 1   MSPSKVFQ--SPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYS 58
           MSP+K     S ++ IR EL L   V+ IRRNAPAALLYEDAL E  T I+S+GALIA+S
Sbjct: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60

Query: 59  GEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAF 118
           G KTGRSPKDKRIVDEPTS + +WWGPVN+K SE+TW +NRERA DYLRTR+HLYIVDA+
Sbjct: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120

Query: 119 AGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEG 178
           AGWDPRYRIKIR+VC RAYHALFMTNMLIRPT+EEL  FGEPDFTVWNAGQFPANTHT+G
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180

Query: 179 MSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGD 238
           M+SKTTVEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQGI   D
Sbjct: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240

Query: 239 VTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFN 298
           VTLFFGLSGTGKTTLSAD  R LIGDDEHCWSD+GVFNIEGGCYAKCIGL+  KEPEIFN
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 299 AIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLT 358
           AI++GSVLENV Y+P++RVVDY+D  ITENTRCAYPIEYIPSAKIPCL+NSHP NIVLLT
Sbjct: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360

Query: 359 CDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 418
           CDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 419 ATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLP 478
           ATMLAEKMSQH ANAWLINTGWTGAS+V GG RCPLKYTRAILDA+H GSLA  D+ETLP
Sbjct: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480

Query: 479 VFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYA 538
            F L +PR V  VP  +LNP++NW EGE KY   V +LA LF +NFK YQD+A+ +V+ A
Sbjct: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540

Query: 539 GPQL 542
           GP L
Sbjct: 541 GPVL 544

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  907 bits (2343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/544 (77%), Positives = 474/544 (87%), Gaps = 2/544 (0%)

Query: 1   MSPSKV--FQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYS 58
           MSPSK+    S +++IR EL L   V+ IRRNAPAALLYEDAL E  T IS++GALIA+S
Sbjct: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60

Query: 59  GEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAF 118
           G KTGRSPKDKRIVDEPTS+  +WWGPVN+K SE+TW +NRERA D+LRTR+HLYIVDA+
Sbjct: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120

Query: 119 AGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEG 178
           AGWDPRYRIKIR+VC RAYHALFMTNMLI+PT +EL EFGEPDFTVWNAGQFPANTHT+G
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180

Query: 179 MSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGD 238
           M+SKTT+EINF+ MEMVILGTEYAGEMKKGIFTVMFYLMPINH VLTLHSSANQGI   D
Sbjct: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240

Query: 239 VTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFN 298
           VTLFFGLSGTGKTTLSAD  R LIGDDEHCWSD+GVFNIEGGCYAKCIGL+  KEPEIFN
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 299 AIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLT 358
           AIR+GSVLENV Y+  +R VD+++  ITENTRCAYPIEYIPSAKIPCL++ HP NIVLLT
Sbjct: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360

Query: 359 CDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 418
           CDASGVLPPVSKLTPEQVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 419 ATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLP 478
           ATMLA+KMS H A+AWLINTGWTG S+V GG RCPLKYTRAILDAIH G+LA  +YETLP
Sbjct: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480

Query: 479 VFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYA 538
            F L IP  V  VPS +LNP+R+WV GE KY   V +LANLFV+NFK Y+  A+ E++ A
Sbjct: 481 TFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCA 540

Query: 539 GPQL 542
           GP L
Sbjct: 541 GPLL 544

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/518 (77%), Positives = 453/518 (87%)

Query: 25  LIIRRNAPAALLYEDALLERNTAISSTGALIAYSGEKTGRSPKDKRIVDEPTSANKVWWG 84
           + I+RN P A LYED L E +T +SSTGAL+AYSG KTGRSPKDKRIV+EP+S + +WWG
Sbjct: 41  ITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100

Query: 85  PVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPRYRIKIRIVCCRAYHALFMTN 144
           PVN+  SE TW INRERA+DYL TR+ LY++DA+AGWD  YRIKIR+VC R YHALFM N
Sbjct: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160

Query: 145 MLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFKAMEMVILGTEYAGE 204
           MLIRPT EEL  FGEPDFT+WNAG F AN+ T+ M+SKT++EINFK+MEMVILGTEYAGE
Sbjct: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220

Query: 205 MKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFGLSGTGKTTLSADQHRLLIGD 264
           MKKGIFTVMFYLMP+ HNVLTLHSSANQG+  GDVTLFFGLSGTGKTTLSAD HR LIGD
Sbjct: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280

Query: 265 DEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGSVLENVVYEPVSRVVDYDDSS 324
           DEHCWSD+GVFNIEGGCYAKCIGL+ EKEPEIFNAI++GSVLEN VY+  + VVDYDDS 
Sbjct: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340

Query: 325 ITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGVLPPVSKLTPEQVMYHFISGY 384
           ITENTRCAYPI++I SAKIPCL++ HP+N++LLTCDASGVLPPVSKLTPEQVMYHFISGY
Sbjct: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400

Query: 385 TSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNANAWLINTGWTGAS 444
           TSKMAGTEQGVTEPE TFS+CFGQPFLALHPMKYA MLA+KM+ H A+AWLINTGWTGAS
Sbjct: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460

Query: 445 YVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSIPRAVEGVPSELLNPSRNWVE 504
           Y +GGKRCPLKYTRAILDAIH GSLAN +YETLPVF L IP+ VE VPSELLNPS+ W +
Sbjct: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520

Query: 505 GEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGPQL 542
            +  YS+AV  L +LFVQNF IYQDQAT +V+ AGP L
Sbjct: 521 PDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/524 (76%), Positives = 448/524 (85%), Gaps = 1/524 (0%)

Query: 20  LSSGVLI-IRRNAPAALLYEDALLERNTAISSTGALIAYSGEKTGRSPKDKRIVDEPTSA 78
           LS+  LI I+RN P A LYED L E  T +SSTGALIAYSG KTGRSPKDKRIV+E  S 
Sbjct: 55  LSNHQLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSK 114

Query: 79  NKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPRYRIKIRIVCCRAYH 138
           + +WWGPVN++ SERTW INRERAVDYL TR+ LY++DAF GWDPRYRIKIR+VC RAYH
Sbjct: 115 DNIWWGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYH 174

Query: 139 ALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFKAMEMVILG 198
           ALFM NMLIRPT+EEL  FG+PDFTVWNAGQF AN+ T  MSSKT+VEINFK MEM ILG
Sbjct: 175 ALFMNNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILG 234

Query: 199 TEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFGLSGTGKTTLSADQH 258
           TEYAGEMKKGIFTVMFYLMPI HNVLTLHSSANQ    GDVTLFFGLSGTGKTTLSAD H
Sbjct: 235 TEYAGEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPH 294

Query: 259 RLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGSVLENVVYEPVSRVV 318
           R LIGDDEHCWSD GVFNIEGGCYAKCIGLS EKEP+IFNAI++GSVLEN +Y+  +  V
Sbjct: 295 RQLIGDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEV 354

Query: 319 DYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGVLPPVSKLTPEQVMY 378
           DYD+S+ITENTRCAYPI+YI +AKIPCL++ HP+N++LLTCDASGVLPPVSKLTPEQVMY
Sbjct: 355 DYDNSTITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMY 414

Query: 379 HFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNANAWLINT 438
           HFISGYTSKMAGTE GVTEP+ TFSSCFGQPFLALHPMKYA+MLAEKM +H ANAWL+NT
Sbjct: 415 HFISGYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNT 474

Query: 439 GWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSIPRAVEGVPSELLNP 498
           GWTG+SYVSGG RCPLKYTRAILDAIH GSL N +YETLP+F L IP+   GVPSELLNP
Sbjct: 475 GWTGSSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNP 534

Query: 499 SRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGPQL 542
           + +W +  E Y  AV  L  LF +NFK Y+D+AT EV+ AGP L
Sbjct: 535 AGSWTDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/542 (74%), Positives = 463/542 (85%), Gaps = 8/542 (1%)

Query: 9   SPEEKIRSELGLS----SGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGEKTGR 64
           S E+++ S+L       S ++ I+ N  AA+LYEDAL E  T ISS+GALIAYSG KTGR
Sbjct: 35  SMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGR 94

Query: 65  SPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAGWDPR 124
           SPKDKRIV E  S + VWWGPVN+  SE+TW INRER +DYL TR +LY++DA+ GWDPR
Sbjct: 95  SPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPR 154

Query: 125 YRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTT 184
           YR+K+R+VC RAYHALFMTNMLIRPTEEEL  F EPDFTVWNAG F AN++T  M+SKT+
Sbjct: 155 YRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTS 214

Query: 185 VEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVTLFFG 244
           VEINFKAMEM+ILGTEYAGEMKKGIFTVMFYLMPI+HN+LTLHSSAN+GI K DVT+FFG
Sbjct: 215 VEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFG 274

Query: 245 LSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAIRYGS 304
           LSGTGKTTLSAD +RLLIGDDEHCWSD+GVFNIEGGCYAKCIGL+ EKEPEIF+AIR+GS
Sbjct: 275 LSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGS 334

Query: 305 VLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCDASGV 364
           VLENV Y  ++  VDY+D +ITENTRCAYPI+YI SAKIPCL+NSHP N++LLTCDASGV
Sbjct: 335 VLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGV 394

Query: 365 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAE 424
           LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP+ YATMLA+
Sbjct: 395 LPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAK 454

Query: 425 KMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVFGLSI 484
           KM Q+ +NAWLINTGWTG+SY +GG RCPLKYTRAILDAIH G+LAN +YETLPVF L I
Sbjct: 455 KMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQI 514

Query: 485 PRAVEGVPSELLNPSRNWVEGEEK----YSKAVTSLANLFVQNFKIYQDQATKEVLYAGP 540
           P  V GVP+E+LNP  +W     K    Y+KAV  LA LFV+NFKIYQD+AT +VL AGP
Sbjct: 515 PTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGP 574

Query: 541 QL 542
           Q+
Sbjct: 575 QV 576

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 58.9 bits (141), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 52/100 (52%), Gaps = 17/100 (17%)

Query: 371 LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHN 430
           LT E+VMYHF SG+ S   G         +       +PFLALHP+ Y T++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 431 ANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLA 470
            +A+LINTG+             LK TR   D+IH  SLA
Sbjct: 58  -SAYLINTGYA------------LK-TRVNFDSIHDDSLA 83

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 50/100 (50%), Gaps = 20/100 (20%)

Query: 234 IAKGDVTLFFGLSGTGKTTLSA--------DQHRLLIGDDEHCWSDYGVFNIEGGCYAKC 285
           I  G+     G SG GK+T+++        D   +LIG       +   FN+    Y + 
Sbjct: 474 IDPGEHVCIVGPSGGGKSTVASLLLRFYDVDAGAILIGGQ-----NIADFNLR--KYRRL 526

Query: 286 IGLSAEKEPEIFNAIRYGSVLENVVYEPVSRVVDYDDSSI 325
           +G+  ++EP +FN    G++LEN++Y    R+++ +D  +
Sbjct: 527 VGI-VQQEPMLFN----GTILENILYTVPQRLLNEEDGRV 561

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 20/86 (23%)

Query: 234 IAKGDVTLFFGLSGTGKTTLS--------ADQHRLLIGDDEHCWSDYGVFNIEGGCYAKC 285
           I  G+   F G SG+GK+T+S        A +  +LIG+D        + ++    Y K 
Sbjct: 476 IEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDN-------IKSLSLRKYRKL 528

Query: 286 IGLSAEKEPEIFNAIRYGSVLENVVY 311
           +G+  ++EP +FN    G++++N++Y
Sbjct: 529 LGV-VQQEPMLFN----GTIIDNILY 549

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 20/86 (23%)

Query: 234 IAKGDVTLFFGLSGTGKTTLSADQHR--------LLIGDDEHCWSDYGVFNIEGGCYAKC 285
           I  G+   F G SG+GK+T+S+   R        +L+G ++       + N     Y + 
Sbjct: 479 IEPGEHVCFVGPSGSGKSTVSSLLLRYYDVAKGSILVGGED-------IKNFSLRKYRRL 531

Query: 286 IGLSAEKEPEIFNAIRYGSVLENVVY 311
           +G+  ++EP +FN    G++LEN++Y
Sbjct: 532 LGV-VQQEPMLFN----GTILENILY 552

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 10/87 (11%)

Query: 228 SSANQGIAKGDVTLFFGLSGTGKTTLSA---DQHRLLIGDDEHCWSDYGVFNIEGGCYAK 284
           S  N  I  G+   F G SG GK+T+S+     +R   G+      D   FN+    Y +
Sbjct: 383 SEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFNLRK--YRR 440

Query: 285 CIGLSAEKEPEIFNAIRYGSVLENVVY 311
            +G+  ++EP +FN    G++L+N+ Y
Sbjct: 441 MLGV-VQQEPLLFN----GTILDNITY 462

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 22/97 (22%)

Query: 224  LTLHSSANQGIAKGDVTLFFGLSGTGKTTL--------SADQHRLLI-GDDEHCWSDYGV 274
            + ++   N  I  G+     G SG+GK+TL            +R+LI G D + WS Y +
Sbjct: 1025 VNVYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWS-YDI 1083

Query: 275  FNIEGGCYAKCIGLSAEKEPEIFNAIRYGSVLENVVY 311
               E      C+    E++P +F    +G++ EN+ Y
Sbjct: 1084 LRAE-----ICV---VEQKPNLF----HGTIRENITY 1108

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,224,538
Number of extensions: 2485358
Number of successful extensions: 6186
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6286
Number of HSP's successfully gapped: 30
Length of query: 542
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 428
Effective length of database: 40,409,475
Effective search space: 17295255300
Effective search space used: 17295255300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)