Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40125.709ON39539521390.0
AFR293C5.709ON36534012131e-166
SAKL0E15070g5.709ON38538810971e-148
Kwal_55.196615.709ON3713359921e-133
KLTH0E00880g5.709ON3713789881e-132
TDEL0B021105.709ON3893809741e-129
NCAS0G002005.709ON4383979701e-128
Suva_9.355.709ON3933619601e-127
YIL153W (RRD1)5.709ON3933769601e-127
ZYRO0B16478g5.709ON3913849531e-126
Smik_9.165.709ON3933769461e-125
Kpol_2001.775.709ON4133309461e-125
Skud_9.155.709ON4023339381e-124
NDAI0F002405.709ON4643359301e-122
CAGL0H06655g5.709ON4243239051e-119
KLLA0A00462g5.709ON3533638961e-118
TPHA0D046505.709ON4213318961e-117
TBLA0E016905.709ON4883408921e-116
KAFR0D021905.709ON4263888641e-112
KNAG0L021705.709ON3963917561e-96
KAFR0H024408.674ON3533083899e-43
ACR139C8.674ON3592933891e-42
Suva_16.1588.674ON3582873846e-42
KLTH0D11176g8.674ON3533733792e-41
Skud_16.1308.674ON3582563784e-41
YPL152W (RRD2)8.674ON3583033751e-40
CAGL0M02255g8.674ON3583063741e-40
Smik_6.3498.674ON3583033706e-40
Kpol_1013.48.674ON3583073707e-40
NCAS0C016908.674ON3593053699e-40
KLLA0F11187g8.674ON3603223672e-39
ZYRO0F07326g8.674ON3523003644e-39
TPHA0D012408.674ON3593733636e-39
TBLA0C018608.674ON3563703602e-38
Kwal_26.87838.674ON3553263522e-37
KNAG0J016908.674ON3633113506e-37
Ecym_23998.674ON3512563489e-37
SAKL0H06622g8.674ON3553243461e-36
TDEL0A062008.674ON3553113443e-36
NDAI0E024108.674ON3592453286e-34
TBLA0H025105.165ON49847703.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4012
         (395 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   828   0.0  
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   471   e-166
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   427   e-148
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   386   e-133
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   385   e-132
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   379   e-129
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      378   e-128
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   374   e-127
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   374   e-127
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   371   e-126
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   369   e-125
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   369   e-125
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   365   e-124
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      362   e-122
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   353   e-119
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   349   e-118
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   349   e-117
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   348   e-116
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   337   e-112
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   295   1e-96
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   154   9e-43
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   154   1e-42
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   152   6e-42
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   150   2e-41
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   150   4e-41
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   149   1e-40
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   148   1e-40
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   147   6e-40
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   147   7e-40
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   146   9e-40
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   145   2e-39
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   144   4e-39
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   144   6e-39
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   143   2e-38
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   140   2e-37
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   139   6e-37
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   138   9e-37
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   137   1e-36
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   137   3e-36
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   130   6e-34
TBLA0H02510 Chr8 complement(593502..594998) [1497 bp, 498 aa] {O...    32   3.4  

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/395 (100%), Positives = 395/395 (100%)

Query: 1   MTVELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSV 60
           MTVELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSV
Sbjct: 1   MTVELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSV 60

Query: 61  SSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAY 120
           SSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAY
Sbjct: 61  SSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAY 120

Query: 121 ENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLY 180
           ENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLY
Sbjct: 121 ENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLY 180

Query: 181 LWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILD 240
           LWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILD
Sbjct: 181 LWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILD 240

Query: 241 MKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEV 300
           MKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEV
Sbjct: 241 MKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEV 300

Query: 301 LNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTAT 360
           LNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTAT
Sbjct: 301 LNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTAT 360

Query: 361 GSSGKLTTSAAMPPPRMTTGYSHHTPSGRYTVPRR 395
           GSSGKLTTSAAMPPPRMTTGYSHHTPSGRYTVPRR
Sbjct: 361 GSSGKLTTSAAMPPPRMTTGYSHHTPSGRYTVPRR 395

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  471 bits (1213), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 273/340 (80%), Gaps = 10/340 (2%)

Query: 1   MTVELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSV 60
           M   +  T+FS PVKRIFD+ GTHDFQ+SLTMYRLQSHLERYL LV  Q++PK S N +V
Sbjct: 1   MEFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAV 60

Query: 61  SSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAY 120
             FV I L+R   L+DETPP T + RRFG++ACRDWH ++Q E+D L    LP     A 
Sbjct: 61  VRFVCI-LERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLP----EAA 115

Query: 121 ENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLY 180
                ELRYYLG+AFGS ERLDYGTGHEL+FLAVVVA+DMLGLW   +     TG D+LY
Sbjct: 116 RRSAAELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDK----FTGEDMLY 171

Query: 181 LWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILD 240
           +W +YY++VH+LILTY LEPAGSHGVWGLDDH+HLAYI+GASQW+ +D+N P+Q SDILD
Sbjct: 172 VWARYYALVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWA-QDRNVPMQPSDILD 230

Query: 241 MKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEV 300
            K++ +Y +TNLYCNSIAF+++VK+G F+QHSPML+DI++TVPTWSK T+GLIKMY+VEV
Sbjct: 231 PKAVARYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEV 290

Query: 301 LNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACK 340
           LNKFPVVQHFWFGTGFFPWVDM  GMSLPNYE  S+ + K
Sbjct: 291 LNKFPVVQHFWFGTGFFPWVDMAHGMSLPNYEAPSETSEK 330

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  427 bits (1097), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 215/388 (55%), Positives = 271/388 (69%), Gaps = 20/388 (5%)

Query: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62
           +++  TKF+ PVK+IFD+ GT DFQ S+TMYRLQS+L +Y+ LV  + +P  S N +V+ 
Sbjct: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVNR 69

Query: 63  FVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYEN 122
           F  I +D     IDETPP    PRRFGN ACR WH K++  +D+L + F+P      Y  
Sbjct: 70  FTQI-IDALSRTIDETPPLPG-PRRFGNFACRTWHVKMRGSLDALLQAFIP----EKYHV 123

Query: 123 CIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLW 182
           CI+E+RYYLGNAFGS ERLDYGTGHELSFLAVV A+DML LW ++ SG      D+L+L+
Sbjct: 124 CIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGE-----DILFLF 178

Query: 183 NKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMK 242
           N YY++V KLI TYTLEPAGSHGVWGLDDH HLAYI+G+SQ +    N P++ SDILD  
Sbjct: 179 NGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHN-PLRPSDILDRH 237

Query: 243 SLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLN 302
           ++  Y  TNLY  +IAF+ KVKSG FS+HSPMLYDI++TV TWSK   GL+KMY  EVLN
Sbjct: 238 TVEDYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLN 297

Query: 303 KFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTATGS 362
           KFPVVQHFWFGTGFFPWV++K G  LP YE        +      +S  S + +PTAT S
Sbjct: 298 KFPVVQHFWFGTGFFPWVNVKSGAILPTYE------ANQEENPHFSSVTSISNMPTATKS 351

Query: 363 SGKLTTSAAMPPPRMTTGYSHHTPSGRY 390
               T+S  MPPP +    S ++P G++
Sbjct: 352 VLPATSSTTMPPPTILP--SRNSPMGKF 377

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  386 bits (992), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 193/335 (57%), Positives = 235/335 (70%), Gaps = 20/335 (5%)

Query: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62
           +++  T F+ PVKRIFDS GTH FQ S+ M RL+ HL +YLG++  Q +P  ++N +V S
Sbjct: 6   IDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVIS 65

Query: 63  FVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYEN 122
              I L  F +L+DETP     PRR+GN+ACRDWH K++E++    + FLP      Y  
Sbjct: 66  LRKI-LHFFSKLVDETPALPG-PRRYGNLACRDWHDKMEEQIREQLQEFLP----EKYYP 119

Query: 123 CIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLW 182
            I+EL YYLGNAFGS ERLDYGTGHELSF +V+ A+DMLG+W     G G    DLLYL+
Sbjct: 120 SIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIW-----GSGFQAKDLLYLF 174

Query: 183 NKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSD-KDQNA---PIQLSDI 238
           N+YYS+V KLI  Y+LEPAGSHGVWGLDDH HL YI GASQW+D KD  A    IQ   I
Sbjct: 175 NEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMI 234

Query: 239 LDMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQV 298
           +D     +Y  +N YC +I+F+ KVKSGPFS+HSPMLYDISR+VPTWSK   GL+KMY  
Sbjct: 235 VD-----EYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFA 289

Query: 299 EVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYEL 333
           EVLNKFPVVQHFWFGT  FPW     G  LP YE+
Sbjct: 290 EVLNKFPVVQHFWFGTALFPWTSTDGGDVLPTYEV 324

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  385 bits (988), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 248/378 (65%), Gaps = 30/378 (7%)

Query: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62
           ++     F+ P KRIFDS G+H FQ S+ M RL+S+L +Y+  +   ++P+ STN  V S
Sbjct: 6   IDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEVRS 65

Query: 63  FVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYEN 122
           F  + L    EL+D TP     PRR+GN+ACR WH KV E +++L  +FLP       E 
Sbjct: 66  FAEL-LKTLSELVDSTPALPG-PRRYGNLACRTWHDKVDESLEALLHKFLP-------EP 116

Query: 123 C---IIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLL 179
           C   I+EL+YYLGNAFGS ERLDYGTGHELSF A + A+DMLG+W     G     +D+L
Sbjct: 117 CHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVW-----GADFQASDVL 171

Query: 180 YLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDIL 239
           +L++KYY++V KL+LTYTLEPAGSHGVWGLDDH HL YI GASQW D  + API   ++ 
Sbjct: 172 FLFDKYYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVD-GKCAPIAPREVQ 230

Query: 240 DMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVE 299
           D   + +Y  TN YC +I+F+ +VKSGPFS+HSPML+DISR+VPTWSK   GL+KMY  E
Sbjct: 231 DKLIVDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAE 290

Query: 300 VLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTA 359
           VLNKFPVVQHFWFGTG FPW  +  G +LP YE         +   G   + +T   PT 
Sbjct: 291 VLNKFPVVQHFWFGTGLFPWTSLGDGYALPTYE-------ASQEAQGQVLQHTTAPAPTN 343

Query: 360 TGSSGKLTTSAAMPPPRM 377
             S+ +      M PP +
Sbjct: 344 LNSARR-----QMNPPNL 356

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  379 bits (974), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 197/380 (51%), Positives = 249/380 (65%), Gaps = 18/380 (4%)

Query: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62
           +++ +TKF +PVK IFDS G  DFQ+S+ + RL+ HLE+Y  ++H Q +    +   V +
Sbjct: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIEVVN 66

Query: 63  FVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYEN 122
            V   L R  EL+DETPP +  PRR+GN+ACRDWH K+   +  L ++ LP +    Y  
Sbjct: 67  RVVSLLSRLSELVDETPPFSG-PRRYGNLACRDWHDKLDANLTELLQQVLPQD----YHK 121

Query: 123 CIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLW 182
           CI EL YYLGN+FGS  RLDYGTGHELSFLAV+ A+DMLGLW TSE     +G D+L L+
Sbjct: 122 CIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLW-TSE----FSGKDVLLLF 176

Query: 183 NKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMK 242
           + YY +V KLILTYTLEPAGSHGVWGLDDH H+ YI+G+SQWS  D   P+   D+ +  
Sbjct: 177 DTYYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWS-SDPAVPMTPRDVKNKV 235

Query: 243 SLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLN 302
            +  Y DTNLYC +I F+  VKSGPFS+HS MLYDI+ TV TWSK  SGL+KMY VEVL 
Sbjct: 236 LVQDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLK 295

Query: 303 KFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDST----TAVPT 358
           KFPVVQHFWFG GF+PW+  + G  LP YE       +  ++   A  ++T    T  P 
Sbjct: 296 KFPVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPSNTTMYHLTTRPI 355

Query: 359 ATGSSG---KLTTSAAMPPP 375
             G      KL T   M PP
Sbjct: 356 PHGKLSQVHKLPTRGTMQPP 375

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  378 bits (970), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 198/397 (49%), Positives = 253/397 (63%), Gaps = 25/397 (6%)

Query: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62
           ++L+ T+FS P KRIFDS  T DFQ S+ + RL+  L++Y+ +V N + P   T  SV+ 
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92

Query: 63  FVSI--FLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFL-PIERDAA 119
             SI   L+    LIDETPP    PRR+GN+ACRDWH K++ ++ +L    L P     +
Sbjct: 93  VNSIVQLLNHLSTLIDETPPLVG-PRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151

Query: 120 YEN-----CIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLT 174
            E+     CI EL YY+ NAFGS  RLD+GTGHELSF+A + A+DMLGLW       G+ 
Sbjct: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTD-----GMQ 206

Query: 175 GTDLLYLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQ 234
           GTD+L L+N YY++V KLILTYTLEPAGSHGVWGLDDH HLAYI+G+SQW    +NAP++
Sbjct: 207 GTDILLLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI---RNAPMR 263

Query: 235 LSDILDMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIK 294
             D+ D+  + QY  +NLYC  IAF+ +VKSGPFS+HSP+LYDI+ +V TWSK   GLIK
Sbjct: 264 PRDVKDISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIK 323

Query: 295 MYQVEVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKG--ACKERAVDGDA---- 348
           MY  EVL KFPVVQHFWFG GF+PW++   G  LP YE   +     +ER +   A    
Sbjct: 324 MYMDEVLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWH 383

Query: 349 --SEDSTTAVPTATGSSGKLTTSAAMPPPRMTTGYSH 383
             +    TA P  T       T   M PP      SH
Sbjct: 384 KENAHVRTAKPGITAMPSVTNTRTNMAPPSSRMMNSH 420

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  374 bits (960), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 183/361 (50%), Positives = 238/361 (65%), Gaps = 14/361 (3%)

Query: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62
           V+     FS PVKRIFD+  T DFQ SL ++R++ HL +Y  L+ +   P      S   
Sbjct: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIP 65

Query: 63  FVS---IFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAA 119
            V+     LDRF +LID+TPP    PRR+GN+ACR+WH K+   +    R  LP    A 
Sbjct: 66  MVNGLMAVLDRFAQLIDDTPPLPG-PRRYGNLACREWHYKLDAHLAQWLREVLP----AQ 120

Query: 120 YENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLL 179
           Y   + EL+YYLGN+FGS  RLDYGTGHELSF+A V A+D+LGL+        L GTD+ 
Sbjct: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFP------HLRGTDVF 174

Query: 180 YLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDIL 239
            L++KYY+I+ +LILTYTLEPAGSHGVWGLDDH HL YI+G+SQW   D  AP+Q  D+L
Sbjct: 175 LLFSKYYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVL 234

Query: 240 DMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVE 299
           D   + +Y+DTN YC  I F+ +VK GPF +HSP+LYDI+ TVP WSK   GL+KMY VE
Sbjct: 235 DKSLVREYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294

Query: 300 VLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTA 359
           VL KFPVVQHFWFGTGFFPW++++ G  LP +E   + +  +        + ++T  P +
Sbjct: 295 VLQKFPVVQHFWFGTGFFPWINVQNGTDLPVFEEKEEESIDQANATSATPDRTSTRFPAS 354

Query: 360 T 360
           T
Sbjct: 355 T 355

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  374 bits (960), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 188/376 (50%), Positives = 244/376 (64%), Gaps = 24/376 (6%)

Query: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62
           V+     FS PVKRIFD+  T DFQ SL ++R++ HL +Y  L+ +   P      S  +
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIA 65

Query: 63  FVSIF---LDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAA 119
            V+     LD+   LIDETPP    PRR+GN+ACR+WH K+ E +    +  LP E    
Sbjct: 66  MVNGLMGVLDKLAHLIDETPPLPG-PRRYGNLACREWHHKLDERLPQWLQEMLPSE---- 120

Query: 120 YENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLL 179
           Y   + EL+YYLGN+FGS  RLDYGTGHELSF+A V A+DMLG++        + G D+ 
Sbjct: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPH------MRGADVF 174

Query: 180 YLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDIL 239
            L+NKYY+I+ +LILTYTLEPAGSHGVWGLDDH HL YI+G+SQW   D  AP+Q  +IL
Sbjct: 175 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREIL 234

Query: 240 DMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVE 299
           D   + +Y+DTN YC  I F+ +VK GPF +HSP+LYDI+ TVP WSK   GL+KMY VE
Sbjct: 235 DKSLVREYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294

Query: 300 VLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTA 359
           VL KFPVVQHFWFGTGFFPWV+++ G  LP +E   + + ++        E ++T  PT+
Sbjct: 295 VLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTS 354

Query: 360 TGSSGKLTTSAAMPPP 375
           T          +MPPP
Sbjct: 355 T----------SMPPP 360

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  371 bits (953), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 191/384 (49%), Positives = 250/384 (65%), Gaps = 23/384 (5%)

Query: 7   KTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSV-SSFVS 65
            T+F+ PVKRIFDS  T +FQ S+ + RL+  +++Y  +++   +P+  +  SV + FV 
Sbjct: 8   NTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFVG 67

Query: 66  IFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCII 125
           + L+    L+D+TPP    PRR+GN+ACRDWHAK+ E+M SLWR+ LP      + +CI+
Sbjct: 68  V-LNHMSLLVDQTPPLEG-PRRYGNLACRDWHAKIDEQMPSLWRKVLPDR----FHHCIV 121

Query: 126 ELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKY 185
           EL +YLGN+FGS  RLDYGTGHELSFLAVV A+DMLGL+ T E      G D L + N Y
Sbjct: 122 ELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLF-TDE----FQGEDFLLIMNAY 176

Query: 186 YSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMKSLY 245
           Y++V KLILTYTLEPAGSHGVWGLDDH HLAY+ G++QW++  + AP++  DIL+   + 
Sbjct: 177 YAVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKE-APLRPRDILNHHLVQ 235

Query: 246 QYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFP 305
           +Y   NLYC +I F+ +VK GPF +HS MLYD++ TV TW+K  SGL+KMY VEVLNKFP
Sbjct: 236 EYAHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFP 295

Query: 306 VVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTATGSSGK 365
           VVQHFWFGTGF+PWVD + G  L  Y+            D D    S+T    A   S  
Sbjct: 296 VVQHFWFGTGFYPWVDNQTGKQLLIYD----------PADADRRNTSSTGGKYAAFVSSI 345

Query: 366 LTTSAAMPPPRMTTGYSHHTPSGR 389
            +     P P  T       P  R
Sbjct: 346 NSPVPHFPAPSTTAASEARAPPAR 369

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  369 bits (946), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 187/376 (49%), Positives = 246/376 (65%), Gaps = 24/376 (6%)

Query: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVP---KVSTNGS 59
           V+     FS PVKRIFD+  T DFQ SL ++R++ HL +Y  L+ +   P    V+++  
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIP 65

Query: 60  VSSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAA 119
           + + +   LD+   LIDETPP    PRR+GN+ACR+WH K+ E +    R  LP E    
Sbjct: 66  MDNGLMQVLDKLAHLIDETPPLPG-PRRYGNLACREWHHKLDERLPQWLREMLPPE---- 120

Query: 120 YENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLL 179
           Y   + EL+YYLGN+FGS  RLDYGTGHELSF+A V A+D+LG++        L GTD+ 
Sbjct: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFP------HLRGTDVF 174

Query: 180 YLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDIL 239
            L+NKYY+I+ +LILTYTLEPAGSHGVWGLDDH HL YI+G+SQW   D  AP+Q  +IL
Sbjct: 175 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREIL 234

Query: 240 DMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVE 299
           D   + +Y++TN YC  I F+ +VK GPF +HSP+LYDI+ TVP WSK   GL+KMY VE
Sbjct: 235 DKSLVREYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 294

Query: 300 VLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTA 359
           VL KFPVVQHFWFGTGFFPWV+++ G +LP +E   +   ++        E ++T  P  
Sbjct: 295 VLKKFPVVQHFWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGPPGPEHTSTRFP-- 352

Query: 360 TGSSGKLTTSAAMPPP 375
                    S +MPPP
Sbjct: 353 --------ASMSMPPP 360

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  369 bits (946), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 178/330 (53%), Positives = 234/330 (70%), Gaps = 14/330 (4%)

Query: 9   KFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPK---VSTNGSVSSFVS 65
           +F  PVKRI+DS GT  FQ S+ ++RL+  + +Y+ LV N ++P    VS   +V+  V 
Sbjct: 14  EFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVK 73

Query: 66  IFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENC-- 123
           +  +  L L+DETPP    PRRFGN++CR+WH KV   + SL  + L  ++      C  
Sbjct: 74  LISELSL-LVDETPPAPG-PRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKD 131

Query: 124 -IIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLW 182
            ++EL YYLGN+FGS  RLDYGTGHELSF+AV+  +DMLGLW        + G DLL ++
Sbjct: 132 SVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWT-----ENIKGGDLLIIF 186

Query: 183 NKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMK 242
           N+YY ++ KLILTYTLEPAGSHGVWGLDDH H AYI+G++QWS+ + N P++  DI++  
Sbjct: 187 NEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-NPPLKPMDIVNKD 245

Query: 243 SLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLN 302
            + +Y +TN+YC++I F+  VKSGPFS+HSPMLYDIS++V  WSK  SGL+KMY VEVLN
Sbjct: 246 LVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLN 305

Query: 303 KFPVVQHFWFGTGFFPWVDMKKGMSLPNYE 332
           KFPVVQHFWFGTG FPW+D     SLP YE
Sbjct: 306 KFPVVQHFWFGTGLFPWIDNNTKKSLPLYE 335

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  365 bits (938), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 228/333 (68%), Gaps = 14/333 (4%)

Query: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62
           V+     FS PVKRIFD+  T DFQ SL ++R++ HL +Y  L+ +   P      S  +
Sbjct: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIA 74

Query: 63  FVSIF---LDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAA 119
            V+     LD+  +LIDETPP    PRR+GN+ACR+WH K+ E +    +  LP E    
Sbjct: 75  MVNGLMGVLDKLAQLIDETPPLPG-PRRYGNLACREWHYKLDEHLSQWLQEMLPAE---- 129

Query: 120 YENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLL 179
           Y   + EL+YYLGN+FGS  RLDYGTGHELSF+A V A+D+LG++        L G D+ 
Sbjct: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPH------LRGNDVF 183

Query: 180 YLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDIL 239
            L+NKYY+I+ +LILTYTLEPAGSHGVWGLDDH HL YI+G+SQW   D  AP+Q  ++L
Sbjct: 184 LLFNKYYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVL 243

Query: 240 DMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVE 299
           D   ++ Y+DTN YC  I F+ +VK GPF +HSP+LYDI+ TVP WSK   GL+KMY VE
Sbjct: 244 DKSLVHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVE 303

Query: 300 VLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYE 332
           VL KFPVVQHFWFGTGFFPWV+++ G  LP +E
Sbjct: 304 VLKKFPVVQHFWFGTGFFPWVNIQNGTDLPVFE 336

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  362 bits (930), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 231/335 (68%), Gaps = 19/335 (5%)

Query: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPK-----VSTN 57
           ++L+ T FS PVKRIFDS  T DFQ S+ + RL+  L+RY+ LV N E+P      VS  
Sbjct: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73

Query: 58  GSVSSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERD 117
             V+S + + L+    ++ +TPP    PRR+GN+ACRDWH+K++ E+  L  + +P    
Sbjct: 74  LMVNSIIHL-LNELSTIVQDTPPLKG-PRRYGNLACRDWHSKIEVELPKLLEKAIP---S 128

Query: 118 AAYENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTD 177
              +  IIEL YY+ N+FGS  RLDYGTGHELSF+A + A+DMLGL+        LTG D
Sbjct: 129 PDLQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFP------DLTGKD 182

Query: 178 LLYLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSD 237
           LL ++N YYS+V +LILTYTLEPAGSHGVWGLDDH HLAYI+G+SQW +   NAP+   +
Sbjct: 183 LLIMFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN---NAPLTPKE 239

Query: 238 ILDMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQ 297
           I + + +  Y   NLYC  I FV+ VKSGPF++HSP+LYDIS +V  W K   GLIKMY 
Sbjct: 240 ITNSRLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYM 299

Query: 298 VEVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYE 332
            EVLNKFPVVQHFWFGTGF+PW++ +    LP YE
Sbjct: 300 DEVLNKFPVVQHFWFGTGFYPWINFQTLRELPVYE 334

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 226/323 (69%), Gaps = 12/323 (3%)

Query: 10  FSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSSFVSIFLD 69
           FS PVKRI+DS G + FQ S  + RL+  + +Y  LV +++V  +  +  V   V   LD
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELS-GVVGGVVKVLD 60

Query: 70  RFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELRY 129
           R  +L+ ETPP    PRR+GNMACRDWH K++ E+  L    +     +  + C++ELRY
Sbjct: 61  RLDQLVSETPPIPG-PRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQ-CVVELRY 118

Query: 130 YLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYSIV 189
           YL N+FGS  RLD+GTGHELSFLA V A+DMLG            G  +LY++++YYS+V
Sbjct: 119 YLANSFGSATRLDFGTGHELSFLATVAALDMLGA--------SFDGDQVLYIFDRYYSLV 170

Query: 190 HKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMKSLYQYED 249
           H+LIL+YTLEPAGSHGVWGLDDH HLAYI+G+SQW ++ + A ++ +D+ D   + QY  
Sbjct: 171 HRLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLA-MEPNDLSDPVLVEQYSR 229

Query: 250 TNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPVVQH 309
           TN++C ++ FV  VKSG F +HSPML+DISR+V TW+K   GL KMY+ EVLNKFPV+QH
Sbjct: 230 TNIFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQH 289

Query: 310 FWFGTGFFPWVDMKKGMSLPNYE 332
           FWFGTGF+PWVD K G  LPNYE
Sbjct: 290 FWFGTGFYPWVDYKNGKPLPNYE 312

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  349 bits (896), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 180/363 (49%), Positives = 227/363 (62%), Gaps = 18/363 (4%)

Query: 1   MTVELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSV 60
           M  +    KFS P KRIFDS GT DFQ S+ M R+Q HL++Y+ L   Q++P        
Sbjct: 1   MDFDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFF 60

Query: 61  SSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAY 120
           ++ V   L R   LIDETPP      R+GN++ RDW  K Q ++++     LP      Y
Sbjct: 61  TNIVVELLKRLSALIDETPPE-RMHSRYGNLSYRDWQTKFQNQLENWLHELLP----EKY 115

Query: 121 ENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLY 180
            N IIEL YY+ NAFGS ER+DYGTGHELSFLAV++ +DML + ET      + G  LLY
Sbjct: 116 NNSIIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI-ET------IKGPALLY 168

Query: 181 LWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILD 240
            +N YY ++ KLILTY LEPAGSHGVWGLDDH H +YI+GA+Q  D   N  +   DI +
Sbjct: 169 CFNSYYDVIQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDV--NTSLIPKDISN 226

Query: 241 MKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEV 300
            + + Q   +NL+C SI F+  VKSGPFS HSP+LY+ISR+V TW K   GLIKMY+VEV
Sbjct: 227 TRLMEQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEV 286

Query: 301 LNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTAT 360
           LNKFPVVQHFWFGT FFPW       SLP Y+     A      D   + ++TT +P   
Sbjct: 287 LNKFPVVQHFWFGTAFFPWTSYGNNHSLPIYQ----PAENNDDADFLTANNATTKMPPPL 342

Query: 361 GSS 363
            +S
Sbjct: 343 STS 345

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  349 bits (896), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 170/331 (51%), Positives = 227/331 (68%), Gaps = 16/331 (4%)

Query: 2   TVELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVS--TNGS 59
           T+ +++  FS P+KRI+DS  T  FQ S+ +YRL+ +L +Y+ +VHN E+P ++  +  +
Sbjct: 6   TINIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEIT 65

Query: 60  VSSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAA 119
           + + +S  L      ID  PP    PRR+GN+ACR+WH+ +  ++  L  + L     A 
Sbjct: 66  IVNEMSSLLTELSNDIDTIPPFEG-PRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHAT 124

Query: 120 -------YENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHG 172
                   + CIIEL YYL N+ GS  RLDYGTGHELSFLAV+ A+DMLGLW        
Sbjct: 125 EKGEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWT-----EN 179

Query: 173 LTGTDLLYLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAP 232
             G DLL++++ YY +V KLI+TYTLEPAGSHGVWGLDDH HL+YI+G+SQ S+ + N P
Sbjct: 180 FKGVDLLHMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSE-NPNPP 238

Query: 233 IQLSDILDMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGL 292
              SDI++ K + +Y   N YC +I F+ KVKSGPFS+HSP+LYDIS TV +W K  SGL
Sbjct: 239 FSPSDIINKKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGL 298

Query: 293 IKMYQVEVLNKFPVVQHFWFGTGFFPWVDMK 323
           +KMY VEVLNKFPVVQHFWFG GF+PW ++K
Sbjct: 299 VKMYMVEVLNKFPVVQHFWFGEGFYPWKNVK 329

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  348 bits (892), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 163/340 (47%), Positives = 228/340 (67%), Gaps = 24/340 (7%)

Query: 10  FSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKV---STNGSVSSFVSI 66
           FSAP K+IFDS GT  F RS+  +R+Q  + +Y  L+  + +P     S+N ++S  VS 
Sbjct: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISG-VSK 73

Query: 67  FLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDA-AYENCII 125
            ++  ++L++ETPP    PRR+GN++CR WH +V + ++ L+ ++L I       +   +
Sbjct: 74  IINDLIKLVEETPPLPG-PRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFL 132

Query: 126 ELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKY 185
           EL YY   + GSP RLDYGTGHELSFLA + A+DML L         ++GTD+L+++N+Y
Sbjct: 133 ELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLT------DISGTDILFIFNEY 186

Query: 186 YSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQN------------API 233
           Y ++ KLIL YTLEPAGSHGVWGLDDH HL YI G+SQW  ++ +            API
Sbjct: 187 YRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPI 246

Query: 234 QLSDILDMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLI 293
           +  DIL+   + +++ +N YC SI F++ VK+GPF +HSP+L+DI++ V  W K  SGL+
Sbjct: 247 KPVDILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLL 306

Query: 294 KMYQVEVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYEL 333
           KMY VEVLNKFPVVQHFWFGTGF+PW++    M LP YEL
Sbjct: 307 KMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYEL 346

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  337 bits (864), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 182/388 (46%), Positives = 235/388 (60%), Gaps = 33/388 (8%)

Query: 8   TKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTN--GSVSSFVS 65
           +KFS P KRIFDS  T  FQ S+  YRL+    +Y+ LV    +P VS N   +++ ++ 
Sbjct: 15  SKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLP-VSRNITMTITRYIL 73

Query: 66  IFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQE----EMDSLWRRFLPIERDAAYE 121
             LD+  + IDETPP    PRRFGN++CR WH K+      E+ ++   F  IE     E
Sbjct: 74  DLLDKCSQFIDETPPLI-EPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIEN----E 128

Query: 122 NCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYL 181
           N   EL YYL N+FGS  RLDYGTGHELSFLA +  +DM+ + +       +T  D L +
Sbjct: 129 NMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQ------DMTADDFLLI 182

Query: 182 WNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQW-SDKDQNAPIQLSDILD 240
           W  YY++  KLILTYTLEPAGSHGVWGLDDH HLAYI G+SQ  SD    AP    DIL 
Sbjct: 183 WQSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAP---KDILK 239

Query: 241 MKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEV 300
              + ++++ NLYC +I F+  VK GPF++HSP+LYDIS+ V +WSK   GL+KMY  EV
Sbjct: 240 KDVVAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEV 299

Query: 301 LNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTAT 360
           LNKFPVVQHFWFG GFFPW D   G  LP +E +S+G     A+         T +P++T
Sbjct: 300 LNKFPVVQHFWFGDGFFPWKDNNSGKDLPVFE-HSEGESPNPAI--------MTMMPSST 350

Query: 361 GSSGKLTTSAAMPPPRMTTGY--SHHTP 386
            +      + +   P M   Y  S H P
Sbjct: 351 ETMASFNLARSSKSPIMNPNYKMSMHRP 378

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  295 bits (756), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 172/391 (43%), Positives = 224/391 (57%), Gaps = 24/391 (6%)

Query: 1   MTVELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSV 60
           + +++    F  P KRIFDS  T  FQ S+ + R++ H+E+Y+ ++       +S   SV
Sbjct: 14  LPLDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGGISA--SV 71

Query: 61  SSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAY 120
           +  + I LDR   L+DETPP    PRR+GN+ACRDWH KV   +  L  +   ++  A  
Sbjct: 72  ARMLQI-LDRLDALVDETPPLVG-PRRYGNLACRDWHDKVDSSLPGLTSQ---VDCLAGG 126

Query: 121 ENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLY 180
             CI E  YYL N+FGS  RLDYGTGHELSFLA V A+DM+          G+T  +L  
Sbjct: 127 GACI-EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMM------SQPRGITPVELSR 179

Query: 181 LWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILD 240
           LW++YY +V +LI+ Y LEPAGSHGVWGLDDH HLAY+ GASQ+++      +Q  D+L 
Sbjct: 180 LWDRYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVG--VQPRDVLS 237

Query: 241 MKSLYQYEDT--NLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQV 298
              +   +D   N    +I FV  VK GPF ++SPML DI   V +W K   GL +MY  
Sbjct: 238 -GVIPGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNA 296

Query: 299 EVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPT 358
           EVLNKFPVVQHFWFGT FFPW  ++ G  LP YE  S    +E    G      TT +P 
Sbjct: 297 EVLNKFPVVQHFWFGTAFFPWTSVRDGTPLPVYE-QSADTEQETFDSGAPPGPGTTTLPA 355

Query: 359 ATGSSGKLTTS--AAMPPP--RMTTGYSHHT 385
              S+     S   AM PP  R    +  HT
Sbjct: 356 LDTSTMASVPSRRPAMGPPAGRQVNKFIQHT 386

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  154 bits (389), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 158/308 (51%), Gaps = 20/308 (6%)

Query: 11  SAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVP--KVSTNGSVSSFVSIFL 68
           S P KR+        +  S T   L + +      V +++    K   +  VSS +++ L
Sbjct: 3   SCPQKRLLTKDDMEIWDSSQTKKELINFITDLAEAVKDRDNTQFKEPISAEVSSTLAL-L 61

Query: 69  DRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELR 128
           D  L ++DE P   +T  RFG    R ++  V+    +L  +      D    N I +L 
Sbjct: 62  DSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAF----DTLTTNQIEQLS 117

Query: 129 YYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYSI 188
            Y   ++G+ ER+DYG+GHEL+F+  +  +    ++        +    ++ ++ KY  I
Sbjct: 118 IYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNI----VILVFVKYLKI 173

Query: 189 VHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAP--IQLSDILDMKSLYQ 246
           + +L   Y LEPAGSHGVWGLDD+  L ++ GA Q S+     P  I   +I+DM     
Sbjct: 174 MRRLETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSNHKHLKPKSIHNDEIVDM----- 228

Query: 247 YEDTNLYCNSIAFVMKVKS-GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFP 305
           ++D  LY   IAF+  VK+      HSPML DIS  V  WSK + G+IKMY  EVL+K P
Sbjct: 229 FKDKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLP 287

Query: 306 VVQHFWFG 313
           V+QHF+F 
Sbjct: 288 VMQHFYFS 295

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  154 bits (389), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 156/293 (53%), Gaps = 26/293 (8%)

Query: 87  RFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELRYYLGNAFGSPERLDYGTG 146
           RFG +  RD+H +VQ   ++L  +  P   D   +    EL  YLGNA+G  +R+DYG+G
Sbjct: 87  RFGKVEFRDFHKEVQARAEALVLQVDPSLTDEQAQ----ELAVYLGNAWGDCKRIDYGSG 142

Query: 147 HELSFLAVVVAVDMLGLWETSE-SGHGLTGTDLLYLWNKYYSIVHKLILTYTLEPAGSHG 205
           HEL+F+       + GLW+    S H  T   +L ++ KY  ++  L   Y LEPAGSHG
Sbjct: 143 HELNFVCF-----LYGLWKYGVLSEHDFTNA-VLRVFVKYMDVMRVLETKYWLEPAGSHG 196

Query: 206 VWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMKSLYQYEDTNLYCNSIAFVMKVKS 265
           VWGLDD+  L ++ GA Q +      P     I + + +  +E+  LY   IAF+ +VK+
Sbjct: 197 VWGLDDYHFLPFLFGAFQLATHKHLKP---KSIHNPEVVELFENRYLYFGCIAFINRVKT 253

Query: 266 -GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPVVQHFWFGTGFFPWVDMKK 324
                 HSPML DIS  V +W+K + G++KMY+ EVL K P++QHF+F + F P  D   
Sbjct: 254 TASLRWHSPMLDDIS-GVRSWTKVSEGMVKMYKAEVLGKLPIMQHFFF-SRFLPVPD--- 308

Query: 325 GMSLPNYELYSKGACKERAVD--GDASEDSTTAVPTATGSSGKLTTSAAMPPP 375
           G+S P         C E A    GD        +P+A  +S + T   + P P
Sbjct: 309 GVSPPRTSEEELADCSEHAHSTWGDC---CGIPIPSAVAAS-EATRKHSKPLP 357

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  152 bits (384), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 156/287 (54%), Gaps = 23/287 (8%)

Query: 67  FLDRFLELIDETPPTTNT-PRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCII 125
            L R  ++I++ P   +    RFG +  RD++ +V +    L +    +  D   E    
Sbjct: 58  LLSRVRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLTDEQLE---- 113

Query: 126 ELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKY 185
           +L  YL  ++G+  R+DYG+GHEL+F+ ++  +   G++  S     L    +L ++ +Y
Sbjct: 114 QLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNL----ILKVFIEY 169

Query: 186 YSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQL--SDILDMKS 243
             I+  L   Y LEPAGSHGVWGLDD+  L ++ GA Q +      PI +  S++++M  
Sbjct: 170 LDIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNSELVEM-- 227

Query: 244 LYQYEDTNLYCNSIAFVMKVKS-GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLN 302
              + D  LY   IAF+ KVKS      HSPML DIS  V TWSK   G+IKMY+ EVL+
Sbjct: 228 ---FSDRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLS 283

Query: 303 KFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYS-KGACKERAVDGDA 348
           K P++QHF+F + F P     +G+S P   ++    A  E  ++G A
Sbjct: 284 KLPIMQHFYF-SEFLP---CPEGVSQPRGHIHDGTDADDECNIEGHA 326

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  150 bits (379), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 117/373 (31%), Positives = 177/373 (47%), Gaps = 33/373 (8%)

Query: 13  PVKRIFDSHGTHDFQRSLTMYRLQSHL----ERYLGLVHNQEVPKVSTNGSVSSFVSIFL 68
           P KR+        +  S T   L S L    E   GL +N+   +  T  S+ S   + L
Sbjct: 3   PQKRLLTQDDMDIWSHSETFNNLISFLSGLAESVKGLENNEY--QKPTGSSIESCCQL-L 59

Query: 69  DRFLELIDETPPTTNTP-RRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIEL 127
           +    L ++ P   +    RFG +  R ++  ++ +   L +R      DA       EL
Sbjct: 60  EEVASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAF----DALDGTQCEEL 115

Query: 128 RYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYS 187
             Y   ++G   R+DYG+GHEL+FL  +  +   G+++       +    +L L+ KY  
Sbjct: 116 SVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNM----VLKLFIKYLG 171

Query: 188 IVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAP--IQLSDILDMKSLY 245
           ++  L   Y LEPAGSHGVWGLDD+  L ++ GA Q S      P  I  S++++M    
Sbjct: 172 VMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPKSIHNSEVVEM---- 227

Query: 246 QYEDTNLYCNSIAFVMKVKS-GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKF 304
            +    LY   I F+ KVK+      HSPML DIS  V TW+K   G+IKMY+ EVLNK 
Sbjct: 228 -FGKRYLYFGCIDFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNKL 285

Query: 305 PVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTATGSSG 364
           P++QHF+FG+    ++   +G+S P     S   C    ++    +     VP+A  +  
Sbjct: 286 PIMQHFFFGS----FLQCPEGISPPGTHAESHQHCSHSPLENTWGDCCGIRVPSAVAA-- 339

Query: 365 KLTTSAAMPPPRM 377
             T S    P R+
Sbjct: 340 --TESQKAGPKRI 350

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  150 bits (378), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 142/256 (55%), Gaps = 19/256 (7%)

Query: 67  FLDRFLELIDETPPTTNT-PRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCII 125
            L +  ++I + P   +    RFG +  RD++ +V +    L R   P   D   E    
Sbjct: 58  LLSQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQLE---- 113

Query: 126 ELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKY 185
           +L  YL  ++G+  R+DYG+GHEL+F+ ++  +   G++  S+    L    +L ++ +Y
Sbjct: 114 QLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNL----ILKVFIEY 169

Query: 186 YSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQL--SDILDMKS 243
             I+  L   Y LEPAGSHGVWGLDD+  L ++ GA Q +      PI +  +++++M  
Sbjct: 170 LQIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEM-- 227

Query: 244 LYQYEDTNLYCNSIAFVMKVKS-GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLN 302
              +    LY   IAF+ KVKS      HSPML DIS  V TWSK   G+IKMY+VEVL+
Sbjct: 228 ---FAHRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLS 283

Query: 303 KFPVVQHFWFGTGFFP 318
           K P++QHF+F   F P
Sbjct: 284 KLPIMQHFYF-CEFLP 298

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  149 bits (375), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 153/303 (50%), Gaps = 30/303 (9%)

Query: 87  RFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELRYYLGNAFGSPERLDYGTG 146
           RFG +  RD++ +V      + R   P   D   E    +L  YL  ++G+  R+DYG+G
Sbjct: 79  RFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLE----QLSIYLDESWGNKRRIDYGSG 134

Query: 147 HELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYSIVHKLILTYTLEPAGSHGV 206
           HEL+F+ ++  +   G++  S     L    +L ++ +Y  I+  L   Y LEPAGSHGV
Sbjct: 135 HELNFMCLLYGLYSYGIFNLSNDSTNL----VLKVFIEYLKIMRILETKYWLEPAGSHGV 190

Query: 207 WGLDDHIHLAYIIGASQWSDKDQNAPIQL--SDILDMKSLYQYEDTNLYCNSIAFVMKVK 264
           WGLDD+  L ++ GA Q +      PI +  +++++M     +    LY   IAF+ KVK
Sbjct: 191 WGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEM-----FAHRYLYFGCIAFINKVK 245

Query: 265 S-GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPVVQHFWFGTGFFPWVDMK 323
           S      HSPML DIS  V TWSK   G+IKMY+ EVL+K P++QHF+F + F P  D  
Sbjct: 246 SSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYF-SEFLPCPD-- 301

Query: 324 KGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTATGSSGKLTTSAAMPPPRMTTGYSH 383
            G+S P   ++          D D   +    V T  G    +   +A+    M     H
Sbjct: 302 -GVSPPRGHIHD-------GTDKDDECNFEGHVHTTWGDCCGIKLPSAIAATEMNK--KH 351

Query: 384 HTP 386
           H P
Sbjct: 352 HKP 354

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  148 bits (374), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 106/306 (34%), Positives = 155/306 (50%), Gaps = 21/306 (6%)

Query: 13  PVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVS--TNGSVSSFVSIFLDR 70
           P KRI        ++ S T   + S +E     V   E  +VS   + SV S +++ L  
Sbjct: 3   PSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVSDSVQSTIAV-LTE 61

Query: 71  FLELIDETPPTTN-TPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELRY 129
             +LI   P   +    RFG +  RD++  V E+ D L     P    A     I +L  
Sbjct: 62  IDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFP----ALTSEQIEQLSI 117

Query: 130 YLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYSIV 189
           YL  ++G+  R+DYG+GHEL+F+  +  +    +++       L    +L L+ +Y  I+
Sbjct: 118 YLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNL----VLVLFIEYLKIM 173

Query: 190 HKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAP--IQLSDILDMKSLYQY 247
            ++   Y LEPAGSHGVWGLDD+  L ++ GA Q +      P  I   ++++M     +
Sbjct: 174 REIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKHLKPKSIHNEELVEM-----F 228

Query: 248 EDTNLYCNSIAFVMKVK-SGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPV 306
            D  LY   IAF+  VK S     HSPML DIS  V  WSK   G+IKMY+ EVL K P+
Sbjct: 229 ADKYLYFGCIAFINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPI 287

Query: 307 VQHFWF 312
           +QHF+F
Sbjct: 288 MQHFYF 293

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  147 bits (370), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 158/303 (52%), Gaps = 30/303 (9%)

Query: 87  RFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELRYYLGNAFGSPERLDYGTG 146
           RFG +  RD++ +V +      R+FL  E  +  +  + +L  YL  ++G+  R+DYG+G
Sbjct: 79  RFGKIEFRDFYDEVSQSS----RKFLRSEFPSLTDEQLEQLSIYLDESWGNKRRIDYGSG 134

Query: 147 HELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYSIVHKLILTYTLEPAGSHGV 206
           HEL+F+ ++  +   G++  S     L    +L ++ +Y  I+  L   Y LEPAGSHGV
Sbjct: 135 HELNFMCLLYGLYKYGVFNLSNDSTNL----ILKVFIEYLKIMRILETRYWLEPAGSHGV 190

Query: 207 WGLDDHIHLAYIIGASQWSDKDQNAPIQL--SDILDMKSLYQYEDTNLYCNSIAFVMKVK 264
           WGLDD+  L ++ GA Q +      PI +  +++++M     + +  LY   I F+ KVK
Sbjct: 191 WGLDDYHFLPFLFGAFQLTSHKHLKPISIHNNELVEM-----FANRYLYFGCIDFINKVK 245

Query: 265 S-GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPVVQHFWFGTGFFPWVDMK 323
           S      HSPML DIS  V TWSK   G+IKMY+ EVL+K P++QHF+F + F P     
Sbjct: 246 SSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF-SDFLP---CP 300

Query: 324 KGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTATGSSGKLTTSAAMPPPRMTTGYSH 383
           +G+S P   ++          D D   +    V +  G    +   +A+    M+    H
Sbjct: 301 EGVSPPRGHIHD-------GTDVDDECNFEGHVHSNWGDCCGIKLPSAIAATEMSK--KH 351

Query: 384 HTP 386
           H P
Sbjct: 352 HKP 354

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  147 bits (370), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 97/307 (31%), Positives = 163/307 (53%), Gaps = 21/307 (6%)

Query: 13  PVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVS--TNGSVSSFVSIFLDR 70
           P KR+        + +S T + L   +E+    V   E  +        + SF+ + L  
Sbjct: 3   PEKRLLTPEDLELWDKSQTKHDLLEFIEKLAKSVEGHENKQYQEPITPQIESFMGL-LKS 61

Query: 71  FLELIDETPPTTNTPR-RFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELRY 129
              +ID+ P   +    RFG +  RD++ ++  +  +L     P    +  E+ + +L  
Sbjct: 62  VNNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYP----SLTEDQLDQLYV 117

Query: 130 YLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYSIV 189
           YL  ++G+ +R+DYG+GHEL+FL ++  +    +++ S+    +    +L ++ +Y  ++
Sbjct: 118 YLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNM----VLKIFIEYLRVM 173

Query: 190 HKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQL--SDILDMKSLYQY 247
             L   Y LEPAGSHGVWGLDD+  L ++ GA Q +      P+ +   ++++M     +
Sbjct: 174 RILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLKPLSIHNEELVEM-----F 228

Query: 248 EDTNLYCNSIAFVMKVK-SGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPV 306
           +D  LY + +AF+  VK S     HSPML DIS  V  WSK   G+IKMY+ EVL+K P+
Sbjct: 229 QDKYLYFSCVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPI 287

Query: 307 VQHFWFG 313
           +QHF+FG
Sbjct: 288 MQHFYFG 294

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  146 bits (369), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 157/305 (51%), Gaps = 17/305 (5%)

Query: 12  APVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKV--STNGSVSSFVSIFLD 69
            P KRI   +    ++ S T   L + +      V   E  ++    + S++S  S+ LD
Sbjct: 2   VPEKRILTENDMEVWKNSATRKDLLNFISTLAESVEGHENSQIVEPISPSIASLSSL-LD 60

Query: 70  RFLELIDETPPTTNTP-RRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELR 128
              +L+D+ P        RFG +  RD++ ++ E+  SL +       D   E    +L 
Sbjct: 61  EVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLSDEQLE----QLS 116

Query: 129 YYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYSI 188
            YL  ++G+  R+DYG+GHEL+F+  +  +   GL++  +    L    +L ++ KY +I
Sbjct: 117 IYLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINL----VLVVFLKYLNI 172

Query: 189 VHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMKSLYQYE 248
           +  L   Y LEPAGSHGVWGLDD+  L ++ GA Q        P+    I + + +  ++
Sbjct: 173 MRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLVPHKHLKPMS---IHNEELVELFK 229

Query: 249 DTNLYCNSIAFVMKVKSG-PFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPVV 307
           D  LY   I+F+  VK+      HSPML DIS  V  WSK   G+IKMY  EVL K P++
Sbjct: 230 DKFLYFGCISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKLPIM 288

Query: 308 QHFWF 312
           QHF+F
Sbjct: 289 QHFYF 293

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  145 bits (367), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 106/322 (32%), Positives = 165/322 (51%), Gaps = 28/322 (8%)

Query: 64  VSIFLDRFLELID--ETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRR-FLPIERDAAY 120
           VS  L +  E+I   E     NT R FG +  RD++  + E  + L  + F  IE+    
Sbjct: 54  VSNLLSKVTEIIGKHEVIKDANTSR-FGKIEFRDFYDDISEHSNELISKIFEGIEKPDTG 112

Query: 121 ENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLY 180
           +  + ++  Y  N++G   R+DYG+GHEL+F+  +  +    +++       +    +L 
Sbjct: 113 K--LDDICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLENDSSNI----VLM 166

Query: 181 LWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAP--IQLSDI 238
           L+ KY  I+  L L Y LEPAGSHGVWGLDD+  L ++ GA Q S      P  I   ++
Sbjct: 167 LFIKYLGIMRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPKSIHNPEV 226

Query: 239 LDMKSLYQYEDTNLYCNSIAFVMKVKS-GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQ 297
           ++M     ++D  LY   IAF+ KVK+      HSPML DIS  V  WSK   G++KMY+
Sbjct: 227 VEM-----FQDRYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYK 280

Query: 298 VEVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPN---YELYSKGACKERAVDGDA--SEDS 352
            EVL K P++QHF+FG     ++   +G+S P+    + +   +C      G +  ++  
Sbjct: 281 AEVLQKLPIMQHFYFGY----FLKCPEGVSEPSARAQDHHEDDSCCTDGSHGHSTWADCC 336

Query: 353 TTAVPTATGSSGKLTTSAAMPP 374
             AVP+A  +S        + P
Sbjct: 337 GIAVPSAIAASQMANKDVRLFP 358

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  144 bits (364), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 157/300 (52%), Gaps = 23/300 (7%)

Query: 67  FLDRFLELIDETPPTTN-TPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCII 125
            L +  +LID+ P   +    RFG +  RD++  +Q   + L     P    +  ++ + 
Sbjct: 58  LLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYP----SLNKDQVE 113

Query: 126 ELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKY 185
           EL  YL  ++G+  R+DYG+GHEL+F+  +  + +  +++       L    +L ++ +Y
Sbjct: 114 ELAVYLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADL----VLKVFVEY 169

Query: 186 YSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAP--IQLSDILDMKS 243
             I+  L   Y LEPAGSHGVWGLDD+  L ++ GA Q +      P  I   ++++M  
Sbjct: 170 LRIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAHQLATHPHLRPKSIHNEEVVEM-- 227

Query: 244 LYQYEDTNLYCNSIAFVMKVKS-GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLN 302
              + D  +Y   IAF+  VKS      HSPML DIS  V TW+K   G+IKMY+ EVL+
Sbjct: 228 ---FMDKYIYFGCIAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLS 283

Query: 303 KFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTATGS 362
           K P++QHF+FG    P     +G+S P  + + +  C+E  V     +     +P+A  +
Sbjct: 284 KLPIMQHFYFGN-ILP---CPEGISPPKGD-HGRDLCEEGHVHNTWGDCCGIKIPSAVAA 338

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  144 bits (363), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 108/373 (28%), Positives = 178/373 (47%), Gaps = 28/373 (7%)

Query: 13  PVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPK--VSTNGSVSSFVSIFLDR 70
           P KR+  +     + RS T   L + L++    V  +E     +  +  V S + + L +
Sbjct: 3   PQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKENTDYTLPISQPVESMMKL-LHK 61

Query: 71  FLELIDETPPTTNT-PRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELRY 129
              ++ + P   +    RFG +  RD++  +  +  +L +   P   D+  E    +L  
Sbjct: 62  VQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQIE----QLYV 117

Query: 130 YLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYSIV 189
           Y+  ++G+ +R+DYG+GHEL+F+  +  +    +++       L    +L ++ +Y  ++
Sbjct: 118 YVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNL----VLKVFIQYLKLM 173

Query: 190 HKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAP--IQLSDILDMKSLYQY 247
             L L Y LEPAGSHGVWGLDD+  L ++ GA Q S      P  I   D+++M     +
Sbjct: 174 RVLELQYWLEPAGSHGVWGLDDYHFLPFLFGAYQLSTHKHLKPSSIHNDDLIEM-----F 228

Query: 248 EDTNLYCNSIAFVMKVKSGP-FSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPV 306
            D  LY   I F+  VK+      HSPML DIS  V  WSK   G+ KMY+ EV+ K P+
Sbjct: 229 ADKYLYFGCIEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPI 287

Query: 307 VQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDA----SEDSTTAVPTATGS 362
           +QHF+F   F   +   + +S P   ++  G   E   +G A     +     VP+A  +
Sbjct: 288 MQHFYFNDMF---LICPENVSPPREHIHDGGEEDECLAEGHAHSTYGDCCGIKVPSAIAA 344

Query: 363 SGKLTTSAAMPPP 375
           S     +   P P
Sbjct: 345 SQINAMNKNKPLP 357

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  143 bits (360), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/370 (29%), Positives = 185/370 (50%), Gaps = 26/370 (7%)

Query: 13  PVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVST--NGSVSSFVSIFLDR 70
           P KR+  S     +  S T   L   +E     + + +  ++S   + S+++  S+  D 
Sbjct: 2   PEKRLLSSQDLTIWINSKTKQDLVDFIETLANSIVDYQNSQLSLPLSDSINNAFSLLQD- 60

Query: 71  FLELIDETPPTTN---TPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIEL 127
             ++I+  P  ++   T  RFG +  + ++  + +  + L +       +    N I EL
Sbjct: 61  IRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHF----NGLDPNQIQEL 116

Query: 128 RYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYS 187
             YL  ++G+ +R+DYG+GHEL+F+  +  +    ++   E    L    +L ++ +Y +
Sbjct: 117 SIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNL----VLKIFMEYIN 172

Query: 188 IVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMKSLYQY 247
           I+  +   Y LEPAGSHGVWGLDD+  L ++ GA Q S      PI    I + + +  +
Sbjct: 173 IMRIIETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSKHKHLKPIS---IHNEEMVEMF 229

Query: 248 EDTNLYCNSIAFVMKVKS-GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPV 306
           +D  +Y   I F+  +K+      HSPML DIS  V  WSK + G+IKMY  EVL K P+
Sbjct: 230 KDKYMYFGCIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLGKLPI 288

Query: 307 VQHFWFGTGFFPWVDMKKGMSLPNYELYSK-GACKERAVDGDASEDSTTAVPTATGSSGK 365
           +QHF+F + F P     +G+SLP+  ++ K G  +E  V     +     +P+A  +S  
Sbjct: 289 MQHFYF-SDFLP---CPQGVSLPH--IHGKDGNIEETHVHSTWGDCCGIQIPSAIAASVA 342

Query: 366 LTTSAAMPPP 375
             +S  +  P
Sbjct: 343 SKSSPKIHKP 352

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  140 bits (352), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 106/326 (32%), Positives = 163/326 (50%), Gaps = 31/326 (9%)

Query: 13  PVKRIFDSHGTHDFQRSLTMYRLQSHL----ERYLGLVHNQEVPKVSTNGSVSSFVSIFL 68
           P KR+  S     +    T  +L   +    E   GL +NQ    +    S+    S+ L
Sbjct: 3   PQKRLLTSQDIETWVDCATFDQLIEFISELAESVKGLENNQYQEPI--GASIDKCCSL-L 59

Query: 69  DRFLELIDETPPTTNTP-RRFGNMACRDWHAKVQ-EEMDSLWRRFLPIERDAAYENCIIE 126
           D    +  + P   +    RFG +  R ++  ++ +  D + + F  + +D A E     
Sbjct: 60  DEVFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQAEE----- 114

Query: 127 LRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYY 186
           L  Y   ++G  ER+DYG+GHEL+F+  +  +   GL+E S     L    +L ++  Y 
Sbjct: 115 LVAYFVESWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNL----VLKVFIHYL 170

Query: 187 SIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAP--IQLSDILDMKSL 244
            ++  L  TY LEPAGSHGVWGLDD+  L ++ GASQ +      P  I  ++++DM   
Sbjct: 171 ELMRVLETTYWLEPAGSHGVWGLDDYHFLPFLFGASQLAPHKHLKPKSIHNNELVDM--- 227

Query: 245 YQYEDTNLYCNSIAFVMKVK-SGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNK 303
             +    LY   I F+ +VK +     HSPML DIS    +WSK   G+IKMY+ EVL K
Sbjct: 228 --FASRYLYFGCIDFINRVKTTASLRWHSPMLDDIS-GAKSWSKVAEGMIKMYRKEVLAK 284

Query: 304 FPVVQHFWFGTGFFPWVDMKKGMSLP 329
            P++QHF FG+    ++   +G+S P
Sbjct: 285 LPIMQHFLFGS----FLKCPEGVSPP 306

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  139 bits (350), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 159/311 (51%), Gaps = 25/311 (8%)

Query: 11  SAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPK--VSTNGSVSSFVSIFL 68
           + P KR+        ++ S T   L   +E+    V  +E  +  +  + SV + + + L
Sbjct: 4   AMPCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENEQYDLPISASVEALMGL-L 62

Query: 69  DRFLELIDETP-PTTNTP-RRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIE 126
            +   +I+  P    + P  RFG +  RD++ +++ E  SL     P       +N + +
Sbjct: 63  QQVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFP----QLTQNQVRQ 118

Query: 127 LRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTD----LLYLW 182
           L+ YL  ++G   R+DYG+GHEL+F+  +  +    +++       L GTD    +L  +
Sbjct: 119 LQTYLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVFD-------LGGTDRANLVLKPF 171

Query: 183 NKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMK 242
            +Y  I+  L   Y LEPAGSHGVWGLDD+  L ++ GA Q S      P+    I + +
Sbjct: 172 IEYLKIMRVLETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPLS---IHNEE 228

Query: 243 SLYQYEDTNLYCNSIAFVMKVKS-GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVL 301
            +  + D  LY   I F+  VK+      HSPML DIS  V  WSK   G++KMYQ EVL
Sbjct: 229 VVELFADKYLYFGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVL 287

Query: 302 NKFPVVQHFWF 312
           +K P++QHF+F
Sbjct: 288 SKLPIMQHFYF 298

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  138 bits (348), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 92/256 (35%), Positives = 134/256 (52%), Gaps = 20/256 (7%)

Query: 67  FLDRFLELIDETPPTTNT-PRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCII 125
            LD   +++D+ P   +    RFG +  RD++ +V+E    L         D   E    
Sbjct: 58  LLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISSLSSELTDEQVE---- 113

Query: 126 ELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKY 185
           EL  Y   ++G  +R+DYG+GHEL+F+       + GL   S          +L ++ KY
Sbjct: 114 ELAVYFTESWGDRKRIDYGSGHELNFICF-----LYGLTHYSVLSDADKVNLVLKVFIKY 168

Query: 186 YSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAP--IQLSDILDMKS 243
             ++  L   Y LEPAGSHGVWGLDD+  L ++ GA Q +      P  I   +I+++  
Sbjct: 169 LDVMRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPKSIHNPEIVEV-- 226

Query: 244 LYQYEDTNLYCNSIAFVMKVKS-GPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLN 302
              +E   +Y   +AF+ KVK+      HSPML DIS  V TWSK   G++KMY+ EVL 
Sbjct: 227 ---FEKRYMYFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEVLG 282

Query: 303 KFPVVQHFWFGTGFFP 318
           K P++QHF+F T F P
Sbjct: 283 KLPIMQHFFFST-FLP 297

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  137 bits (346), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/324 (31%), Positives = 160/324 (49%), Gaps = 25/324 (7%)

Query: 12  APVKRIFDSHGTHDFQRSLTMYRLQSHL----ERYLGLVHNQEVPKVSTNGSVSSFVSIF 67
           AP KR+   H    +  S T   L   +    E   G  + Q V  +S+  S+    S+ 
Sbjct: 2   APQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISS--SIDELCSL- 58

Query: 68  LDRFLELIDETPPTTN-TPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIE 126
           LD+  +++   P   +    RFG +  RD++    +++ S     +    D      + E
Sbjct: 59  LDKVNKVVSSHPVIQDANTSRFGKVEFRDFY----DDLSSRSSEMISSLSDKLSTPQVDE 114

Query: 127 LRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYY 186
           L  Y   ++G+  R+DYG+GHEL+F+  +  ++    ++  +    +    +L ++ KY 
Sbjct: 115 LAAYFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNV----VLRVFIKYL 170

Query: 187 SIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMKSLYQ 246
            ++  L   Y LEPAGSHGVWGLDD+  L ++ GA Q +      P     I + + +  
Sbjct: 171 DVMRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLKP---KSIHNKEFVEM 227

Query: 247 YEDTNLYCNSIAFVMKVKSG-PFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFP 305
           +E   LY   I F+  VK+      HSPML DIS  V TWSK   G++KMY+ EVL K P
Sbjct: 228 FEKRYLYFGCIGFINSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLP 286

Query: 306 VVQHFWFGTGFFPWVDMKKGMSLP 329
           ++QHF+FG     ++   KG+S P
Sbjct: 287 IMQHFYFGD----FLVCPKGVSEP 306

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  137 bits (344), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 98/311 (31%), Positives = 147/311 (47%), Gaps = 21/311 (6%)

Query: 13  PVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVS--TNGSVSSFVSIFLDR 70
           P KR+        +Q   T   L   L      V   E  + S    GS+ S V   ++ 
Sbjct: 4   PEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAVKGLENSQYSQPIGGSIQS-VEALIEC 62

Query: 71  FLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELRYY 130
             + I+  P  +  P RFG    RD +  +      L +       D      + +L  Y
Sbjct: 63  VDQCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQ----VAQLSVY 118

Query: 131 LGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLWNKYYSIVH 190
              ++G   R+DYG+GHEL+FL  +  +   G+++ ++    L    +L ++ KY   + 
Sbjct: 119 FNESWGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNL----VLIVFMKYLKTMR 174

Query: 191 KLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAP--IQLSDILDMKSLYQYE 248
            +   Y LEPAGSHGVWGLDD+  L ++ GASQ S      P  I   ++++M     + 
Sbjct: 175 VIETVYWLEPAGSHGVWGLDDYHFLPFLFGASQLSTHRHLKPKSIHNPEVVEM-----FS 229

Query: 249 DTNLYCNSIAFVMKVK-SGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPVV 307
           +  LY   I F+  VK +     HSPML DIS  V  W+K   G++KMY  EVL K P++
Sbjct: 230 EKYLYFGCIDFINSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCKLPIM 288

Query: 308 QHFWFGTGFFP 318
           QHF+F + F P
Sbjct: 289 QHFYF-SEFLP 298

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  130 bits (328), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 20/245 (8%)

Query: 73  ELIDETPPTTNTP-RRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENCIIELRYYL 131
           ++ID+ P   +    RFG    R ++ ++ E  + L     P       E    +L  YL
Sbjct: 64  KIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTHEQLE----QLTIYL 119

Query: 132 GNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDL-LYLWNKYYSIVH 190
             ++G+ +R+DYG+GHEL+F+       + GL++       +   ++ L ++ KY  I+ 
Sbjct: 120 DESWGNKQRIDYGSGHELNFMCF-----LFGLYKYDVLKLDIDARNMVLIIFIKYLDIMR 174

Query: 191 KLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQL--SDILDMKSLYQYE 248
            L   Y LEPAGSHGVWGLDD+  L ++ GA Q +      P+ +   ++++M     + 
Sbjct: 175 SLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQLATHKHLKPLSIHNEELVEM-----FA 229

Query: 249 DTNLYCNSIAFVMKVK-SGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLNKFPVV 307
              LY   IAF+  VK +     HSPML DIS  V  WSK   G++KMY  EVL+K P++
Sbjct: 230 KKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLPIM 288

Query: 308 QHFWF 312
           QHF+F
Sbjct: 289 QHFYF 293

>TBLA0H02510 Chr8 complement(593502..594998) [1497 bp, 498 aa] {ON}
           Anc_5.165 YJL019W
          Length = 498

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 9   KFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVS 55
           +F   +KRI  S  TH+  + L M  LQ  L+++  +V N+++ + S
Sbjct: 120 QFETQIKRIVPSKDTHELDQQLDMIDLQ--LQKFNRMVENEDITQFS 164

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,252,110
Number of extensions: 2054164
Number of successful extensions: 6883
Number of sequences better than 10.0: 47
Number of HSP's gapped: 6889
Number of HSP's successfully gapped: 47
Length of query: 395
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 283
Effective length of database: 40,638,807
Effective search space: 11500782381
Effective search space used: 11500782381
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)