Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40115.710ON42242215300.0
AFR294W5.710ON3404247722e-99
KLLA0A00440g5.710ON3553584554e-52
SAKL0E15092g5.710ON3523493734e-40
KLTH0E00858g5.710ON3242853662e-39
Kwal_55.196555.710ON3242883583e-38
ZYRO0B16500g5.710ON3423623295e-34
NCAS0G001905.710ON4432483293e-33
Smik_9.155.710ON3443323191e-32
Suva_9.345.710ON3202923129e-32
YIL154C (IMP2')5.710ON3463333131e-31
TDEL0B021005.710ON3403593112e-31
Skud_9.145.710ON3513343085e-31
KAFR0D021805.710ON3873063044e-30
NDAI0F002305.710ON4862322971e-28
CAGL0H06677g5.710ON3383322865e-28
KNAG0L021805.710ON4392502633e-24
Kpol_1043.765.710ON3723002551e-23
TPHA0E001605.710ON4403222448e-22
TBLA0E017405.710ON3752362392e-21
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4011
         (422 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON} s...   593   0.0  
AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic ho...   301   2e-99
KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON...   179   4e-52
SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some...   148   4e-40
KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}...   145   2e-39
Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}...   142   3e-38
ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} simi...   131   5e-34
NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}...   131   3e-33
Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON} Y...   127   1e-32
Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641...   124   9e-32
YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}  IM...   125   1e-31
TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {O...   124   2e-31
Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 3...   123   5e-31
KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {O...   121   4e-30
NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}...   119   1e-28
CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} simila...   114   5e-28
KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5....   105   3e-24
Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON} (1644...   102   1e-23
TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}...    99   8e-22
TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.7...    97   2e-21

>Ecym_4011 Chr4 complement(27848..29116) [1269 bp, 422 aa] {ON}
           similar to Ashbya gossypii AFR294W
          Length = 422

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/422 (72%), Positives = 306/422 (72%)

Query: 1   MDEPGRGILNRNGSSNMFVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKASNGIIQ 60
           MDEPGRGILNRNGSSNMFVM                                KASNGIIQ
Sbjct: 1   MDEPGRGILNRNGSSNMFVMPPPQQQQQHQRQNQSAAAAAGPSSEPGSANGAKASNGIIQ 60

Query: 61  TDGKGNSSSMTSPMGVTIKIEEPPEQRGRSRNKQSDAXXXXXXXXXXXXXXXXXXXXIAE 120
           TDGKGNSSSMTSPMGVTIKIEEPPEQRGRSRNKQSDA                    IAE
Sbjct: 61  TDGKGNSSSMTSPMGVTIKIEEPPEQRGRSRNKQSDATSSFSTSRSRTKLRSLSRVSIAE 120

Query: 121 HELLRWTILRHDPSERLHRDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDEE 180
           HELLRWTILRHDPSERLHRDSHAGTAARFGDISPQTTTVVP             VLSDEE
Sbjct: 121 HELLRWTILRHDPSERLHRDSHAGTAARFGDISPQTTTVVPAGAAAGIAEDIEDVLSDEE 180

Query: 181 QISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQV 240
           QISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQV
Sbjct: 181 QISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQV 240

Query: 241 DVLENCKRAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTSH 300
           DVLENCKRAIQHIAKR                         ECPQKKAFLLYLEDLNTSH
Sbjct: 241 DVLENCKRAIQHIAKRALSPAPAGAAGQAGHAPLAGSAAAHECPQKKAFLLYLEDLNTSH 300

Query: 301 SEKLYALTYTFGAVLANRDTLYIVVQCDAADVEAHLVKVREQVAFLLDATSAAXXXXXXX 360
           SEKLYALTYTFGAVLANRDTLYIVVQCDAADVEAHLVKVREQVAFLLDATSAA       
Sbjct: 301 SEKLYALTYTFGAVLANRDTLYIVVQCDAADVEAHLVKVREQVAFLLDATSAALDHLDII 360

Query: 361 XXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPTXXXXXXXXXXXXXGI 420
                 PYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPT             GI
Sbjct: 361 ILTLHHPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPTLVVRKKLKRSRRKGI 420

Query: 421 YD 422
           YD
Sbjct: 421 YD 422

>AFR294W Chr6 (968616..969638) [1023 bp, 340 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL154C (IMP2')
          Length = 340

 Score =  301 bits (772), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 193/424 (45%), Positives = 220/424 (51%), Gaps = 86/424 (20%)

Query: 1   MDEPGRGILNRNGSSNMFVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKASNGIIQ 60
           MDEP RGILNR+G+   F                                   A+ G   
Sbjct: 1   MDEPSRGILNRSGAGTTF-------------------------------GTQGANAGDAG 29

Query: 61  TDGK-GNSSSMTSPMGVTIKIEEPPEQRGRSRNKQSDAXXXXXXXXXXXXXXXXXXXXIA 119
           + GK G     +SP+GVTIKIEEPPEQRGR+RNKQS A                      
Sbjct: 30  SAGKEGAGRRTSSPIGVTIKIEEPPEQRGRTRNKQSGAAFSSSRSRTKSRSRSRVSV--T 87

Query: 120 EHELLRWTILRHDPSERLHRDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDE 179
           + E LRWTILR DPSERLH           G +  +                    LSDE
Sbjct: 88  DQEFLRWTILRADPSERLH----------LGAVEDEEDDDE---------------LSDE 122

Query: 180 EQISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQ 239
           EQ+SDVENDY+VDA LDYDLGARVLPNFA SIQQ LD Q TWLA YR      Q     +
Sbjct: 123 EQLSDVENDYDVDAELDYDLGARVLPNFAASIQQVLDVQPTWLARYR----ASQPAGAAR 178

Query: 240 VDVLEN-CKRAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNT 298
           VDVL++ C RA++H A+                            P  K FL YLEDLN 
Sbjct: 179 VDVLQDTCTRAVRHFARHSGA----------------------PGPAGKTFLAYLEDLNV 216

Query: 299 SHSEKLYALTYTFGAVLANRDTLYIVVQCDAADVEAHLVKVREQVAFLLDATSAAXXXXX 358
           S +EKLYALTYTFGAVLAN DTLYI V CDA DVE+HL +V EQVAFLLD ++AA     
Sbjct: 217 SAAEKLYALTYTFGAVLANHDTLYIFVLCDAVDVESHLNRVAEQVAFLLDCSAAALDDLD 276

Query: 359 XXXXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPTXXXXXXXXXXXXX 418
                    YPRHLLTE   AF+P+ LI+PLQIAT SLAGYVS VPT             
Sbjct: 277 VVVLALQHAYPRHLLTETIHAFRPAGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRARRR 336

Query: 419 GIYD 422
           GI+D
Sbjct: 337 GIFD 340

>KLLA0A00440g Chr1 complement(37134..38201) [1068 bp, 355 aa] {ON}
           similar to uniprot|Q753L8 Ashbya gossypii AFR294W
           AFR294Wp and weakly similar to YIL154C uniprot|P32351
           Saccharomyces cerevisiae YIL154C IMP2' Transcriptional
           activator involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 355

 Score =  179 bits (455), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 115/358 (32%), Positives = 172/358 (48%), Gaps = 33/358 (9%)

Query: 73  PMGVTIKIEEPPEQRGRSRNKQSDAXXXXXXXXXXXXXXXXXXXXIAEHELLRWTILRHD 132
           P   TIKIEEP EQRGRSR+K  D                     I +   L+WTIL  D
Sbjct: 23  PAFPTIKIEEP-EQRGRSRSKTRDTGISSSRSISRSASRVS----IKDQAYLKWTILNKD 77

Query: 133 PSERLHRDSHAGT---AARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDEEQISDVENDY 189
           PSERLH  +  G    +   G  +                      +S+EEQ+SDVEN+ 
Sbjct: 78  PSERLHLKAKKGNTRDSVSPGQENGGDEDEDEDEEEFIEDREDDGEVSEEEQVSDVENEI 137

Query: 190 EVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVLEN-CKR 248
           E+D  +DYDLG +VLPNF T I Q LDS   WLA    +I  + +K+ ++++ +++   R
Sbjct: 138 EIDEHIDYDLGCKVLPNFVTPITQVLDSMKPWLAK-NAEIKTEADKRDIKLEEIQHGIHR 196

Query: 249 AIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTSHSEKLYALT 308
           A+ H++K                             +  +F++YL+ ++ S +EK+YAL 
Sbjct: 197 AVYHMSKGDNITAATSE-------------------KGHSFVVYLDQMDESFAEKIYALV 237

Query: 309 YTFGAVLANRDTLYIVVQC--DAADVEAHLVKVREQVAFLLDATSAAXXXXXXXXXXXXX 366
           Y+FG+V  N DTLYI+ QC  D  D+   + ++ + + +L + T+               
Sbjct: 238 YSFGSVFTNGDTLYIINQCDDDTNDMLFQMNRICDHIDYLFECTNGVGTLDKIDVLICSM 297

Query: 367 --PYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPTXXXXXXXXXXXXXGIYD 422
             PYP+ LLTE++ + QPS++IIPLQ    SL  +++ VP              GI D
Sbjct: 298 YHPYPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFITSVPMLVIRKKLKRSKRRGIAD 355

>SAKL0E15092g Chr5 (1255185..1256243) [1059 bp, 352 aa] {ON} some
           similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage caused by bleomycin and
           other oxidants contains a C-terminal leucine-rich repeat
          Length = 352

 Score =  148 bits (373), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 112/349 (32%), Positives = 159/349 (45%), Gaps = 50/349 (14%)

Query: 80  IEEP-PEQRGRSRNKQSDAXXXXXXXXXXXXXXXXXXXXIAEHELLRWTILRHDPSERLH 138
           +E P P  RGRSR K+S +                    I +   L+WT+LR DPSERLH
Sbjct: 48  VESPLPRGRGRSREKRS-SVGGGTSNTRSLSTRSISGSRIEDESYLKWTVLRRDPSERLH 106

Query: 139 RDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDEEQISDVENDYEVDAALDYD 198
           ++                                   +SDEEQISD+END E+D+ LDYD
Sbjct: 107 KNEENDR----------------DESAIDDDDYDEDDVSDEEQISDIENDQEIDSELDYD 150

Query: 199 LGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVLENC-KRAIQHIAKRX 257
           LGARVLPNF+TSI   L+S   W   Y + +D + E+ K+++D L     RA+  + +  
Sbjct: 151 LGARVLPNFSTSISNVLESNKPWTKKYLQTVDQKAERAKIKLDSLPGGYMRAMSLVTR-- 208

Query: 258 XXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTSHSEKLYALTYTFGAVLAN 317
                                         +++LY  DL+   SE +YALTYT GAV+ +
Sbjct: 209 --------------------GKGGSSTHGSSYILY-ADLS---SESMYALTYTLGAVVNS 244

Query: 318 RDTLYIVVQCDAADVEAHLV----KVREQVAFLLDATSAAXXXXXXXXXXXXXPYPRHLL 373
            DTLY VV  +++  E  L+    K+ +Q AFLLD TS               PYP+HL+
Sbjct: 245 GDTLY-VVHVESSTTETRLLQNIDKLTQQTAFLLDCTSGVVNDLSVVLLSLSHPYPKHLV 303

Query: 374 TEISEAFQPSALIIPLQIATGSLAGYVSFVPTXXXXXXXXXXXXXGIYD 422
            ++    +P  L++ L +   SL  YV  +PT             GIY+
Sbjct: 304 NQMIHGLKPLLLVVSLSLVLTSLQNYVCNIPTLVVRKKLKRSKRRGIYE 352

>KLTH0E00858g Chr5 complement(86253..87227) [975 bp, 324 aa] {ON}
           some similarities with uniprot|P32351 Saccharomyces
           cerevisiae YIL154C IMP2' Transcriptional activator
           involved in maintenance of ion homeostasis and
           protection against DNA damage
          Length = 324

 Score =  145 bits (366), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 140/285 (49%), Gaps = 50/285 (17%)

Query: 124 LRWTILRHDPSERLHRDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDEEQIS 183
           L+WT+L+HDPSERL   +  G  A   D                             Q+S
Sbjct: 70  LKWTVLQHDPSERLLLGTKEGAEASDDDEDVSDEE----------------------QVS 107

Query: 184 DVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVL 243
           DVEN+ ++DAAL YDLGARVLPNF +S+   + +Q  W+A + + ++ +    K++ D+ 
Sbjct: 108 DVENEIDIDAALGYDLGARVLPNFTSSLWDVVQNQKPWVAKFNKSVEGKDSGVKLE-DLQ 166

Query: 244 ENCKRAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTSHSEK 303
               RAI+ +  +                         E  + +++++YL DL     E 
Sbjct: 167 GGYARAIKIVHGK--------------------PQQGAEAREGRSYIIYL-DLTP---ES 202

Query: 304 LYALTYTFGAVLANRDTLYIV---VQCDAADVEAHLVKVREQVAFLLDATSAAXXXXXXX 360
            YAL Y FGAVLA+ DTLY+V    +     + A++ ++  + A+LLDA+SAA       
Sbjct: 203 FYALLYVFGAVLASNDTLYVVHISQRVPNEQLRANVERLEAEAAYLLDASSAALNAVNVV 262

Query: 361 XXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPT 405
                 PYP+HLL E+  A +P AL +PL +   SL  YV  +PT
Sbjct: 263 LLSVSHPYPKHLLNELVIALKPMALCVPLSLVLSSLQNYVCPIPT 307

>Kwal_55.19655 s55 complement(68638..69612) [975 bp, 324 aa] {ON}
           YIL154C (IMP2') - transcription factor [contig 159] FULL
          Length = 324

 Score =  142 bits (358), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 136/288 (47%), Gaps = 56/288 (19%)

Query: 124 LRWTILRHDPSERLHRDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDEEQIS 183
           L+WT+L HDPSERL   +  G  +   +                             Q+S
Sbjct: 70  LKWTVLHHDPSERLQLSAQDGKDSSDDEEDVSDEE----------------------QVS 107

Query: 184 DVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVL 243
           DV+N+  +DAAL YDLGARVLPNF  S+   L ++  W+A Y   +D  +    V++D L
Sbjct: 108 DVDNEINIDAALGYDLGARVLPNFTNSLWDVLQTEKPWIAKYNETVD--ENNTDVKLDEL 165

Query: 244 ENC-KRAIQ--HIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTSH 300
           +    RAIQ  H AK                          E     ++++YL DL    
Sbjct: 166 QGGYARAIQVMHSAK----------------------SQKTELKPGASYIVYL-DLT--- 199

Query: 301 SEKLYALTYTFGAVLANRDTLYIV---VQCDAADVEAHLVKVREQVAFLLDATSAAXXXX 357
            E  YAL Y FGAVL+  DTLY+V    +  +  + +++ ++R Q A+LLDA+SAA    
Sbjct: 200 PESFYALLYVFGAVLSPNDTLYVVHISPRVPSDQLRSNVARLRAQTAYLLDASSAALDSV 259

Query: 358 XXXXXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPT 405
                    PYP+HLL E+  A +P AL +PL +    L  YV  +PT
Sbjct: 260 SVVILSVSHPYPKHLLNEMVLALKPMALCVPLSLVLSVLQNYVCPIPT 307

>ZYRO0B16500g Chr2 (1338095..1339123) [1029 bp, 342 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154C IMP2'
           Transcriptional activator involved in maintenance of ion
           homeostasis and protection against DNA damage caused by
           bleomycin and other oxidants contains a C- terminal
           leucine-rich repeat
          Length = 342

 Score =  131 bits (329), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 105/362 (29%), Positives = 147/362 (40%), Gaps = 55/362 (15%)

Query: 69  SMTSPMGVTIKIEEPPEQRGRSRNKQSDAXXXXXXXXXXXXXXXXXXXXIAEHELLRWTI 128
           S+  P GV    E+   +RGRSR K +                      +   E L+WT+
Sbjct: 28  SLAEPGGVQFDSEQL--ERGRSRVKAARGIKSNSGSRSRSRNPSH----VRNGEFLKWTV 81

Query: 129 LRHDPSERLHRDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDEEQISDVEND 188
           L+ DPS RLH+  H                                ++SDEEQ+SDVEND
Sbjct: 82  LKRDPSMRLHKKPHGNGIG--------NNADDEEEEEEDEDQEDEDLVSDEEQVSDVEND 133

Query: 189 YEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVLENC-K 247
            E+D  + YD+G RVLPN+A SI + L S  +W++ Y    + Q+  + V    L     
Sbjct: 134 LEIDEQMHYDMGTRVLPNYAASINEVLASTKSWISTY----ESQETTQDVSFTKLPGGYS 189

Query: 248 RAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTSHSEKLYAL 307
           R  Q +++                              +++F+L   DL T   E  YAL
Sbjct: 190 RCCQLLSRGKGATT------------------------RRSFVL-CTDLTT---ESHYAL 221

Query: 308 TYTFGAVLANRDTLYIVVQCDAAD-------VEAHLVKVREQVAFLLDATSAAXXXXXXX 360
            Y  GA+L N DTLYI V  D          +E  +  +R+ V   LD  SA+       
Sbjct: 222 AYVIGALLNNGDTLYI-VHWDGKQPGSSKETLEQSVKSLRQHVLHKLDCASASLQDLDVV 280

Query: 361 XXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPTXXXXXXXXXXXXXGI 420
                 PYP+HLL+E+  A QP AL   L +   +L  +V  VPT             GI
Sbjct: 281 LLSLSHPYPKHLLSEMIYALQPIALCCSLSLVLTTLQNFVCSVPTLVIRKKLKRSKRKGI 340

Query: 421 YD 422
            D
Sbjct: 341 SD 342

>NCAS0G00190 Chr7 complement(27710..29041) [1332 bp, 443 aa] {ON}
           Anc_5.710 YIL154C
          Length = 443

 Score =  131 bits (329), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 116/248 (46%), Gaps = 24/248 (9%)

Query: 181 QISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQV 240
           Q+SD+END E+D A +YDLG +VLPNF +SI   LD+   W+A Y   I   +E   V++
Sbjct: 214 QVSDIENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIK-GKENDNVEI 272

Query: 241 DVLENCK-RAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTS 299
             L+    RA+Q + K                            P  + ++LY  DL+  
Sbjct: 273 GRLDGGYLRAMQLLTK-------------GKGAYLNTESTATPTPAGRCYILY-TDLS-- 316

Query: 300 HSEKLYALTYTFGAVLANRDTLYIVVQCDAADVEAHLV-----KVREQVAFLLDATSAAX 354
            SE  YALTYT GAV+ N DTLY+V   ++   +  L+     ++R+ V  + D  SA  
Sbjct: 317 -SESTYALTYTMGAVINNGDTLYVVHSENSNIFDEPLMLKNVGRIRKHVMHMFDCISAVV 375

Query: 355 XXXXXXXXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPTXXXXXXXXX 414
                       PYP+HLL E+    +P AL +PL I   SL  +V  VPT         
Sbjct: 376 DDVDVVALSLTHPYPKHLLNEMIHGLKPVALCVPLSIMLSSLQNFVCSVPTLVIRKKLKR 435

Query: 415 XXXXGIYD 422
               GI D
Sbjct: 436 AKRKGITD 443

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 14/18 (77%)

Query: 120 EHELLRWTILRHDPSERL 137
           E E L+WT+LR DPS RL
Sbjct: 135 EEEFLKWTVLRQDPSMRL 152

>Smik_9.15 Chr9 complement(31597..32631) [1035 bp, 344 aa] {ON}
           YIL154C (REAL)
          Length = 344

 Score =  127 bits (319), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 143/332 (43%), Gaps = 45/332 (13%)

Query: 79  KIEEPPEQRGRSRNKQSDAXXXXXXXXXXXXXXXXXXXXIAEHELLRWTILRHDPSERLH 138
           ++E    +RGRS+ K+ D                       E E L+WT+LR DPS RL 
Sbjct: 34  QMERGQRERGRSKKKRGDQDSSVSSLSRSRSRASSRSRV-REEEFLKWTVLRQDPSMRL- 91

Query: 139 RDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDEEQISDVENDYEVDAALDYD 198
                    R  D+  +                     SDEEQ+SDVEND E+D    YD
Sbjct: 92  ---------RVVDVDSEEEGEG-NDDDGDDGDDVDEEESDEEQVSDVENDLEIDEEFHYD 141

Query: 199 LGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVLENCK-RAIQHIAKRX 257
           LG +VLPNF TSI + L+S   W+A Y   I    E + V ++ L+    RA+Q + K  
Sbjct: 142 LGMKVLPNFCTSINEVLESSKPWIAKYEISIR-GHEDEGVSLEQLDGGYVRAMQLLTK-- 198

Query: 258 XXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTSHSEKLYALTYTFGAVLAN 317
                                   E   +++F+LY  DL+   SE  YALTY  GAV+  
Sbjct: 199 --------------------GAGAEPGNQRSFILY-TDLS---SESTYALTYLMGAVVNQ 234

Query: 318 RDTLYIV-----VQCDAADVEAHLVKVREQVAFLLDATSAAXXXXXXXXXXXXXPYPRHL 372
            DTLYIV        D A + A++ ++R+ V  L D  +               PYP+HL
Sbjct: 235 GDTLYIVHWEPSKPTDDAQMFANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKHL 294

Query: 373 LTEISEAFQPSALIIPLQIATGSLAGYVSFVP 404
           L E+    +P AL   L +   +L  +V  VP
Sbjct: 295 LNEMIHGLKPVALCCSLSVILSTLQNFVCSVP 326

>Suva_9.34 Chr9 complement(48616..49131,49133..49438,49501..49641)
           [963 bp, 320 aa] {ON} YIL154C (REAL)
          Length = 320

 Score =  124 bits (312), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 126/292 (43%), Gaps = 42/292 (14%)

Query: 120 EHELLRWTILRHDPSERLHRDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDE 179
           E + L+WT+LR DPS RL          +  +                         SDE
Sbjct: 48  EEQFLKWTVLRQDPSMRLR------VVDQDSEEDEDNDNNNNNDDDGPNDDDVDDEESDE 101

Query: 180 EQISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQ 239
           EQ+SDV+ND E+D    YDLG +VLPNF TSI   LDS   W+A Y        E   V 
Sbjct: 102 EQVSDVDNDLEIDEEFHYDLGMKVLPNFCTSINDVLDSAKPWIAKYEMG----HENDGVS 157

Query: 240 VDVLENCK-RAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNT 298
           ++ L     RA+Q + K                          E   ++ F+LY  DL+ 
Sbjct: 158 LERLAGGYVRAMQLLTK----------------------GAGAEPGAQRCFILY-TDLS- 193

Query: 299 SHSEKLYALTYTFGAVLANRDTLYIV-----VQCDAADVEAHLVKVREQVAFLLDATSAA 353
             SE  YALTY  GAVL   DTLYIV        D A + A++ ++R+ V  L D  +  
Sbjct: 194 --SESTYALTYLMGAVLNQGDTLYIVHWEPSTPVDDAQMLANVARIRKHVMHLFDCVAGV 251

Query: 354 XXXXXXXXXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPT 405
                        PYP+HLL E+    +P AL   L +  G+L  +V  VPT
Sbjct: 252 LDDLDVVVLSLTHPYPKHLLNEMIHGLKPVALCCSLSVILGTLQNFVCSVPT 303

>YIL154C Chr9 complement(53981..55021) [1041 bp, 346 aa] {ON}
           IMP2'Transcriptional activator involved in maintenance
           of ion homeostasis and protection against DNA damage
           caused by bleomycin and other oxidants, contains a
           C-terminal leucine-rich repeat
          Length = 346

 Score =  125 bits (313), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 100/333 (30%), Positives = 144/333 (43%), Gaps = 45/333 (13%)

Query: 79  KIEEPPEQRGRSRNKQSDAXXXXXXXXXXXXXXXXXXXXIAEHELLRWTILRHDPSERLH 138
           ++E    +RGRS+ K+ +                     + E E L+WT+LR DPS RL 
Sbjct: 34  QMERGHRERGRSKKKRGE-RDSNVSSLSRSRSRASSRSRVREEEFLKWTVLRQDPSMRL- 91

Query: 139 RDSHAGTAARFGDI-SPQTTTVVPXXXXXXXXXXXXXVLSDEEQISDVENDYEVDAALDY 197
                    R  D+ S +                     SDEEQ+SD+END E+D    Y
Sbjct: 92  ---------RVVDVDSEEEGEGNDEDDDDGDGDDMDEEESDEEQVSDIENDLEIDEEFHY 142

Query: 198 DLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVLENCK-RAIQHIAKR 256
           DLG +VLPNF TSI + LDS   W+A Y   I    E + V ++ L+    RA+Q + K 
Sbjct: 143 DLGMKVLPNFCTSINEVLDSSKPWIAKYEISIR-GHENEDVSLEQLDGGYVRAMQLLTK- 200

Query: 257 XXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTSHSEKLYALTYTFGAVLA 316
                                    E   +++F+LY  DL+   SE  YALTY  GA + 
Sbjct: 201 ---------------------GAGAEAGNQRSFILY-TDLS---SESTYALTYLMGAAVN 235

Query: 317 NRDTLYIV-----VQCDAADVEAHLVKVREQVAFLLDATSAAXXXXXXXXXXXXXPYPRH 371
             DT+YIV        D + + A++ ++R+ V  L D  +               PYP+H
Sbjct: 236 QGDTVYIVHWEPSKPTDDSQMFANVARIRKHVMHLFDCVAGVLDDLDVVVLSLTHPYPKH 295

Query: 372 LLTEISEAFQPSALIIPLQIATGSLAGYVSFVP 404
           LL E+    +P AL   L +   +L  +V  VP
Sbjct: 296 LLNEMIHGLKPVALCCSLSVILSTLQNFVCSVP 328

>TDEL0B02100 Chr2 complement(375013..376035) [1023 bp, 340 aa] {ON}
           Anc_5.710 YIL154C
          Length = 340

 Score =  124 bits (311), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 100/359 (27%), Positives = 153/359 (42%), Gaps = 53/359 (14%)

Query: 57  GIIQTDGKGNSSSMT----SPMGVTIKIEEPPEQRGRSRNKQSDAXXXXXXXXXXXXXXX 112
           GI+ T   G+ S +      P G  ++ +    +RGRSR K  +                
Sbjct: 8   GILLTGTDGSQSPLNVNDNEPAG-GVQFDSEQLERGRSRTKIRNNGSSQLSASSSRSRSR 66

Query: 113 XXXXXIAEHELLRWTILRHDPSERLHRDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXX 172
                  E E L+WT+LR DPS RL  +      +R      + +  +            
Sbjct: 67  ASSRIRDE-EFLKWTVLRRDPSMRLQLNQKDDKKSRDEQSDDEDSEELDLEDD------- 118

Query: 173 XXVLSDEEQISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQ 232
              +SDEEQ++DV+ND+++D    YDLG +VLPNF  S+   LDS   W+  +R +    
Sbjct: 119 ---VSDEEQVTDVDNDFDIDEEFHYDLGMKVLPNFVQSLNDVLDSSKQWIREFRANT--- 172

Query: 233 QEKKKVQVDVLENCKRAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLY 292
           QE +     +    KRA+  ++K                               ++++L 
Sbjct: 173 QEPEIPLATLAGGYKRAMLPLSKGKGSTT------------------------DRSYIL- 207

Query: 293 LEDLNTSHSEKLYALTYTFGAVLANRDTLYIV-----VQCDA-ADVEAHLVKVREQVAFL 346
             DL    SE  YALTY  GA+++N DTLY+V        DA A ++ +++ +RE V  +
Sbjct: 208 CSDLT---SESQYALTYVMGALVSNGDTLYVVHWDNQSSSDADAKLQKNILTIRENVEHM 264

Query: 347 LDATSAAXXXXXXXXXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPT 405
            D+  A              P+P+ LLTE+    QP AL   L +   +L  YV  VPT
Sbjct: 265 FDSIGAVIEDFDVVVLSLQHPFPKQLLTEMIHGLQPVALCCSLSMILSTLQNYVCSVPT 323

>Skud_9.14 Chr9 complement(30986..31686,31717..32071) [1056 bp, 351
           aa] {ON} YIL154C (REAL)
          Length = 351

 Score =  123 bits (308), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 100/334 (29%), Positives = 143/334 (42%), Gaps = 42/334 (12%)

Query: 79  KIEEPPEQRGRSRNK--QSDAXXXXXXXXXXXXXXXXXXXXIAEHELLRWTILRHDPSER 136
           ++E    +RGRS+ K  + D+                    + E E L+WT+LR DPS R
Sbjct: 34  QMERGHRERGRSKKKRDERDSYASSLSRSRSRASRASSRSRVREEEFLKWTVLRQDPSMR 93

Query: 137 LHRDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDEEQISDVENDYEVDAALD 196
           L         A       +                     SDEEQ+SDVEND E+D    
Sbjct: 94  L-------KVADADSDEEEEGEGGDDDDDDEDGDDMDEEESDEEQVSDVENDAEIDEEFH 146

Query: 197 YDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVLENCK-RAIQHIAK 255
           YDLG +VLPNF TSI + L+S   W+A Y   I    E + V ++ L+    RA+Q + K
Sbjct: 147 YDLGMKVLPNFCTSINEVLESSKPWIAKYEISIR-GHENEGVSLEQLDGGYVRAMQLLTK 205

Query: 256 RXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTSHSEKLYALTYTFGAVL 315
                                     E   +++F+LY  DL+   SE  YALTY  GAV+
Sbjct: 206 ----------------------GAGAEPGNQRSFILY-TDLS---SESTYALTYLMGAVV 239

Query: 316 ANRDTLYIV-----VQCDAADVEAHLVKVREQVAFLLDATSAAXXXXXXXXXXXXXPYPR 370
              DTLYI+        D + + A++ ++R+ V  L D  +               PYP+
Sbjct: 240 NQGDTLYILHWEPSKPTDDSQMFANVARIRKHVMHLFDCAAGVLDDLDVVVLSLTHPYPK 299

Query: 371 HLLTEISEAFQPSALIIPLQIATGSLAGYVSFVP 404
           HLL E+    +P AL   L +   +L  +V  VP
Sbjct: 300 HLLNEMIHGLKPVALCCSLSVILSTLQNFVCSVP 333

>KAFR0D02180 Chr4 complement(438301..439464) [1164 bp, 387 aa] {ON}
           Anc_5.710 YIL154C
          Length = 387

 Score =  121 bits (304), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 88/306 (28%), Positives = 137/306 (44%), Gaps = 44/306 (14%)

Query: 118 IAEHELLRWTILRHDPSERLHRDSHAGTAARFG-----------DISPQTTTVVPXXXXX 166
           + E E L+WT+LR DPS RL  +++     + G            +  +           
Sbjct: 91  VREEEFLKWTVLRQDPSMRLF-NANEKLKKKEGTYDSDEIYSSESVEDEDKGDDEDEDED 149

Query: 167 XXXXXXXXVLSDEEQISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYR 226
                     SDEEQ+SD++N+ E+D  LD+DLG +VLPNF  SI + L+S+  W+  Y 
Sbjct: 150 EESEDFEEEESDEEQVSDIDNEVEIDEKLDFDLGMKVLPNFCVSINEVLESRKPWVQQYE 209

Query: 227 RDIDPQQEKKKVQVDVLENCK-RAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQ 285
           ++I+     +  ++D +E+   RAI  + K                              
Sbjct: 210 KEIESVLPDETTKLDEIEDGYIRAIDLVTKGEGSSKNG---------------------D 248

Query: 286 KKAFLLYLEDLNTSHSEKLYALTYTFGAVLANRDTLYIV------VQCDAADVEAHLVKV 339
            ++++L++ DL+   SE +YALTY  G V+ N DTLYIV         D   +  +L +V
Sbjct: 249 GQSYILFM-DLS---SESIYALTYVMGCVINNGDTLYIVNWESTLKHIDETIIYNNLKRV 304

Query: 340 REQVAFLLDATSAAXXXXXXXXXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGY 399
           ++    L D  S               PYP+HLL+E+    +P AL   L I   +L  +
Sbjct: 305 KKMTLHLFDCISGVIDNLDVIIVSLTHPYPKHLLSEMIYGLKPMALCCSLSIMLSTLQNF 364

Query: 400 VSFVPT 405
           V  VPT
Sbjct: 365 VCSVPT 370

>NDAI0F00230 Chr6 complement(43491..44951) [1461 bp, 486 aa] {ON}
           Anc_5.710 YIL154C
          Length = 486

 Score =  119 bits (297), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/232 (33%), Positives = 111/232 (47%), Gaps = 29/232 (12%)

Query: 181 QISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQV 240
           Q+SD+END E+D A +YDLG +VLPNF +SI   LD+   W+A Y   I   +E + V  
Sbjct: 267 QVSDIENDVEIDEAFNYDLGMKVLPNFCSSINDILDTAKPWIAKYEESIK-GKENEGVNF 325

Query: 241 DVLENCK-RAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTS 299
             L+    RA+Q + K                            P  + ++LY  DL+  
Sbjct: 326 TTLDGGYIRAMQLLTKGKGASMDFDPMK----------------PAGRCYILY-TDLS-- 366

Query: 300 HSEKLYALTYTFGAVLANRDTLYIVVQCDAADV------EAHLVKVREQVAFLLDATSAA 353
            SE  YALTY  GAVL N DTLYI V  +++ V      + ++ +VR+ V  + D  SA 
Sbjct: 367 -SESTYALTYMMGAVLNNGDTLYI-VHWESSKVANEKLMQENVGRVRKHVMHMFDCVSAV 424

Query: 354 XXXXXXXXXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPT 405
                        PYP+HLL E+    +P ++   L I   +L  +V  VPT
Sbjct: 425 IDDLDVIILSLTHPYPKHLLNEMIHGLKPVSIACSLTIILSTLQNFVCSVPT 476

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (73%)

Query: 120 EHELLRWTILRHDPSERLH 138
           E E L+WT+LR DPS RL 
Sbjct: 178 EEEFLKWTVLRQDPSMRLQ 196

>CAGL0H06677g Chr8 (663303..664319) [1017 bp, 338 aa] {ON} similar
           to uniprot|P32351 Saccharomyces cerevisiae YIL154c IMP2
          Length = 338

 Score =  114 bits (286), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 94/332 (28%), Positives = 139/332 (41%), Gaps = 49/332 (14%)

Query: 87  RGRSRNKQSDAXXXXXXXXXXXXXXXXXXXXIAEHELLRWTILRHDPSERL-----HRDS 141
           RGRSR+K++                        E E L+WT+LR DPS RL     ++ S
Sbjct: 26  RGRSRDKRTGGNGAGRLSLSRSRSRASSRV--REEEFLKWTVLRRDPSMRLTTLKKNKKS 83

Query: 142 HAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDEEQISDVENDYEVDAALDYDLGA 201
            +GT                               SDEE++SD+END E+D    +DLG 
Sbjct: 84  GSGTGG---------DDDDDDDEDDDDEDDDDEEESDEERVSDIENDAEIDEEFHFDLGT 134

Query: 202 RVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQVDVLENC-KRAIQHIAKRXXXX 260
           +VLPNF+TSI   L++   W+  Y   +D ++E+  V  + LE    RA++ + K     
Sbjct: 135 KVLPNFSTSINDVLENSKPWIQKYLSTLDMEKERAGVNFETLEGGYSRALELVRKGKGAE 194

Query: 261 XXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTSHSEKLYALTYTFGAVLANRDT 320
                                  P+     +   DL+   SE  YALTY  G++++N DT
Sbjct: 195 AH---------------------PETSKNYILCTDLS---SESTYALTYVMGSLVSNGDT 230

Query: 321 LYIVVQCDAADVEA-------HLVKVREQVAFLLDATSAAXXXXXXXXXXXXXPYPRHLL 373
           LYI V  D     +       + ++V++ V  L+D  S               PYP+HLL
Sbjct: 231 LYI-VHWDGDSTTSTKDSFIDNALRVKKHVRHLMDCVSVIVDDLDVVIISLTHPYPKHLL 289

Query: 374 TEISEAFQPSALIIPLQIATGSLAGYVSFVPT 405
            E+    +P  L   L +   SL  +V  VPT
Sbjct: 290 NEMIHGLKPVTLACSLSLILSSLQNFVCSVPT 321

>KNAG0L02180 Chr12 (390307..391626) [1320 bp, 439 aa] {ON} Anc_5.710
           YIL154C
          Length = 439

 Score =  105 bits (263), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 104/250 (41%), Gaps = 36/250 (14%)

Query: 181 QISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKKKVQV 240
           Q+SDVEND E+D    YDLG + LPNF  SI + + S   W+  Y  D    QEK  V+ 
Sbjct: 218 QVSDVENDAEIDEKFTYDLGTKTLPNFCVSINEVISSAEPWIRQYDADHGESQEKIDVR- 276

Query: 241 DVLENCKRAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLEDLNTSH 300
           DV     RA++ + +                            PQ   +++Y  DL+   
Sbjct: 277 DVEGGYVRAVELLTRGKGAS-----------------------PQADTYIVY-SDLS--- 309

Query: 301 SEKLYALTYTFGAVLANRDTLYIV--------VQCDAADVEAHLVKVREQVAFLLDATSA 352
           SE  YAL Y  G ++ N DT+Y+V             ++V +++  +R +   L D  SA
Sbjct: 310 SESNYALLYVLGTLVGNGDTVYVVHWHSDRGGGAVTHSEVRSNVRNLRRKALHLFDCLSA 369

Query: 353 AXXXXXXXXXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVPTXXXXXXX 412
                         PYP+HLL E+  A  P AL   L I    L  +V  VPT       
Sbjct: 370 TVDDLDIVLLSTTHPYPKHLLNEMINALHPVALCCSLSIVLSLLQNFVCSVPTFVIRKKL 429

Query: 413 XXXXXXGIYD 422
                 GI D
Sbjct: 430 KRAKRKGISD 439

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 15/19 (78%)

Query: 120 EHELLRWTILRHDPSERLH 138
           E E L+WT+LR DPS RLH
Sbjct: 139 EEEFLKWTVLRQDPSMRLH 157

>Kpol_1043.76 s1043 (164489..165607) [1119 bp, 372 aa] {ON}
           (164489..165607) [1119 nt, 373 aa]
          Length = 372

 Score =  102 bits (255), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 131/300 (43%), Gaps = 38/300 (12%)

Query: 120 EHELLRWTILRHDPSERLH---RDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVL 176
           + E L+WT+LR DPS RL    + +  G   +                           +
Sbjct: 78  DEEFLKWTVLRRDPSMRLRTIRKKNQQGLNKKKHGAEEDDDEEEDEEEEEEEEDDDDDEI 137

Query: 177 SDEEQISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEKK 236
           SDEEQ+SD+EN+ ++D  + +DLG +VLPN+  SI   ++S   W++ Y     P+  + 
Sbjct: 138 SDEEQVSDIENENDIDEDITFDLGTKVLPNYCMSINDIMESSKKWISDYLS--RPENLRN 195

Query: 237 -KVQVDVLE-NCKRAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLE 294
             V ++ +E    +A++ I+K+                            +  +++LY  
Sbjct: 196 DNVHIEKMEGGFVKAMELISKKEDSSTSISSSG----------------KEGDSYILY-T 238

Query: 295 DLNTSHSEKLYALTYTFGAVLANRDTLYIVVQCDAADVEA--------HLVKVREQVAFL 346
           DL    SE  YAL Y  GA++ N DTLY VV  +  +           ++ ++R+ V  L
Sbjct: 239 DLT---SESTYALAYVLGALVNNGDTLY-VVHWEGNNTHGVTDTRIYDNIFRIRKHVMHL 294

Query: 347 LDATSAAXXXXXXXXXXXXXPYPRHLLTEISEAFQPSALIIPLQI--ATGSLAGYVSFVP 404
           LD +SA              PYP+HLL E+    +P  L   L +  +   L  YVS +P
Sbjct: 295 LDCSSAVIDRIDILLISLTHPYPKHLLNEMIHGLKPKTLCCSLSVVLSPSGLQNYVSSIP 354

>TPHA0E00160 Chr5 complement(14950..16272) [1323 bp, 440 aa] {ON}
           Anc_5.710 YIL154C
          Length = 440

 Score = 98.6 bits (244), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 88/322 (27%), Positives = 126/322 (39%), Gaps = 48/322 (14%)

Query: 120 EHELLRWTILRHDPSERLHRDSHAGTAARFGDISPQTTTVVPXXXXXXXXXXXXXVLSDE 179
           + E L+WT+LR DPS RL        A R        +                  +SDE
Sbjct: 112 DEEFLKWTVLRKDPSMRLKFRRANDGAHR------DHSNEDLEDDDDEYFDEDDDEISDE 165

Query: 180 EQISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRD-----IDP--- 231
           EQ+SD+EN+ E+D    +DLG +VLPN+  SI + L+    W +AY  D     IDP   
Sbjct: 166 EQVSDLENELEIDD-FTFDLGMKVLPNYCISINEVLERSKPWKSAYNEDLVKNKIDPNAN 224

Query: 232 ------------------QQEKKKVQVDVLENCKRAIQHIAKRXXXXXXXXXXXXXXXXX 273
                             +  K    +D       +   + K+                 
Sbjct: 225 VLINELEGGFVKAMELISKNNKYDDDIDSGSGSFSSNSELNKQDSEHHASTSATIASSNT 284

Query: 274 XXXXXXXXECPQKKAFLLYLEDLNTSHSEKLYALTYTFGAVLANRDTLYIV-------VQ 326
                         +F+LY  DL+   SE  YALTY  G ++ N DTLYIV         
Sbjct: 285 NNTTSSSGSSDSGDSFILYT-DLS---SESTYALTYVMGTLVKNNDTLYIVHWEGSTTSN 340

Query: 327 CDA--ADVEAHLVKVREQVAFLLDATSAAXXXXXXXXXXXXXPYPRHLLTEISEAFQPSA 384
            DA    + ++L K+RE V +L D  ++              PYP+H L E+    +P +
Sbjct: 341 NDAMKKKMTSNLQKIRENVMYLNDCNNSIIDRLDVVVISMTHPYPKHFLNEMIYGLKPKS 400

Query: 385 LIIPLQI--ATGSLAGYVSFVP 404
           LI  L I  +   L  YV  +P
Sbjct: 401 LICSLNIMLSPSGLQNYVCSIP 422

>TBLA0E01740 Chr5 (424870..425997) [1128 bp, 375 aa] {ON} Anc_5.710
           YIL154C
          Length = 375

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 104/236 (44%), Gaps = 35/236 (14%)

Query: 176 LSDEEQISDVENDYEVDAALDYDLGARVLPNFATSIQQTLDSQATWLAAYRRDIDPQQEK 235
           +SDEEQ+SD+EN+ E+D    ++ G ++LPNF T I  TL+    W+  Y   +   +E 
Sbjct: 154 ISDEEQVSDIENEAELDEEFQFEQGNKILPNFCTYINLTLEGGKKWIRNYESQV-KGKEN 212

Query: 236 KKVQVDVLENC-KRAIQHIAKRXXXXXXXXXXXXXXXXXXXXXXXXXECPQKKAFLLYLE 294
           + + +  L+N   RAI+  +K                               K++LLY  
Sbjct: 213 EGINLIKLDNGYARAIEGYSKGKGC-----------------------SADGKSYLLY-S 248

Query: 295 DLNTSHSEKLYALTYTFGAVLANRDTLYIV------VQCDAADVEAHLVKVREQVAFLLD 348
           DL+   SE  YAL Y  G+++ N D +Y+V       +     +  ++ ++R  V  LLD
Sbjct: 249 DLS---SESTYALAYLIGSIIKNGDMIYLVHWEGNNKKIPEKQLSDNVFRMRRHVLHLLD 305

Query: 349 ATSAAXXXXXXXXXXXXXPYPRHLLTEISEAFQPSALIIPLQIATGSLAGYVSFVP 404
           A S               PYP+H L E+      S L   L +    L  +VS +P
Sbjct: 306 AASTIIDDAEIMMVSLTHPYPKHFLNELIHGLDISMLCCSLTMILSGLQNFVSSIP 361

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,444,677
Number of extensions: 913927
Number of successful extensions: 2215
Number of sequences better than 10.0: 20
Number of HSP's gapped: 2219
Number of HSP's successfully gapped: 41
Length of query: 422
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 310
Effective length of database: 40,638,807
Effective search space: 12598030170
Effective search space used: 12598030170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)