Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40105.711ON64464433210.0
AFR295W5.711ON63164327110.0
KLLA0A00418g5.711ON64259024780.0
SAKL0E15114g5.711ON64965624480.0
KLTH0E00836g5.711ON64160923650.0
Kwal_55.196495.711ON64161923110.0
KAFR0D021705.711ON66061322980.0
CAGL0H06699g5.711ON65062322830.0
TDEL0B020905.711ON64360922770.0
TPHA0E001505.711ON64658922680.0
ZYRO0B16522g5.711ON64361222370.0
NCAS0G001805.711ON65459522170.0
Kpol_1043.775.711ON65759921990.0
TBLA0E017505.711ON66562721770.0
NDAI0F002105.711ON65359721570.0
YIL155C (GUT2)5.711ON64962020880.0
Skud_9.135.711ON64960520740.0
Smik_9.145.711ON65261620670.0
KNAG0L021905.711ON64559219560.0
Suva_9.325.711ON53854219010.0
Suva_10.5264.276ON114446810.44
Skud_12.4944.276ON114846752.4
Skud_6.538.56ON49938742.5
YLR410W (VIP1)4.276ON114646742.5
CAGL0F01947g8.56ON49339742.6
Smik_6.608.56ON49938742.7
Suva_6.418.56ON49938732.8
YFL018C (LPD1)8.56ON49938732.9
KLLA0D11154g8.56ON49342723.7
Suva_10.2258.327ON292124714.6
NCAS0B016108.671ON67686725.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4010
         (644 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...  1283   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...  1048   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   959   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   947   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   915   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   894   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   889   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   884   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   881   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   878   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   866   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   858   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   851   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   843   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   835   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   808   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   803   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   800   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   758   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   736   0.0  
Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR41...    36   0.44 
Skud_12.494 Chr12 (877731..881177) [3447 bp, 1148 aa] {ON} YLR41...    33   2.4  
Skud_6.53 Chr6 complement(103908..105407) [1500 bp, 499 aa] {ON}...    33   2.5  
YLR410W Chr12 (937541..940981) [3441 bp, 1146 aa] {ON}  VIP1Inos...    33   2.5  
CAGL0F01947g Chr6 complement(189377..190858) [1482 bp, 493 aa] {...    33   2.6  
Smik_6.60 Chr6 complement(115090..116589) [1500 bp, 499 aa] {ON}...    33   2.7  
Suva_6.41 Chr6 complement(74641..76140) [1500 bp, 499 aa] {ON} Y...    33   2.8  
YFL018C Chr6 complement(101628..103127) [1500 bp, 499 aa] {ON}  ...    33   2.9  
KLLA0D11154g Chr4 (952049..953530) [1482 bp, 493 aa] {ON} highly...    32   3.7  
Suva_10.225 Chr10 complement(415805..416683) [879 bp, 292 aa] {O...    32   4.6  
NCAS0B01610 Chr2 complement(262494..264524) [2031 bp, 676 aa] {O...    32   5.0  

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score = 1283 bits (3321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/644 (97%), Positives = 630/644 (97%)

Query: 1   MFFRYTSRKVIPWXXXXXXXXXXXXXXWQFVSQQHAISNTGFVANELPAELKLEKHAPAP 60
           MFFRYTSRKVIPW              WQFVSQQHAISNTGFVANELPAELKLEKHAPAP
Sbjct: 1   MFFRYTSRKVIPWAAAAATVTGASVVSWQFVSQQHAISNTGFVANELPAELKLEKHAPAP 60

Query: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120
           PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM
Sbjct: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120

Query: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180
           AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY
Sbjct: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180

Query: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240
           VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV
Sbjct: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240

Query: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300
           TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL
Sbjct: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300

Query: 301 QMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDA 360
           QMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDA
Sbjct: 301 QMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDA 360

Query: 361 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDV 420
           ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDV
Sbjct: 361 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDV 420

Query: 421 QSAWAGIRPLVKDPRKDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQETIDEVV 480
           QSAWAGIRPLVKDPRKDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQETIDEVV
Sbjct: 421 QSAWAGIRPLVKDPRKDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQETIDEVV 480

Query: 481 KVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAICEI 540
           KVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAICEI
Sbjct: 481 KVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAICEI 540

Query: 541 FQSDKRNQLPVSLAAEKAAANVDYDAFRYPFTVGELKYNIRNEYARKPLDFLMRRTRYAF 600
           FQSDKRNQLPVSLAAEKAAANVDYDAFRYPFTVGELKYNIRNEYARKPLDFLMRRTRYAF
Sbjct: 541 FQSDKRNQLPVSLAAEKAAANVDYDAFRYPFTVGELKYNIRNEYARKPLDFLMRRTRYAF 600

Query: 601 LDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644
           LDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV
Sbjct: 601 LDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score = 1048 bits (2711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/643 (78%), Positives = 577/643 (89%), Gaps = 12/643 (1%)

Query: 2   FFRYTSRKVIPWXXXXXXXXXXXXXXWQFVSQQHAISNTGFVANELPAELKLEKHAPAPP 61
            FR+TSR+++PW                  +   A+S    V NE+P ELKLE+ APAPP
Sbjct: 1   MFRHTSRRLLPWACGAV----------AAAAAVGAVSRPSLV-NEVPTELKLERRAPAPP 49

Query: 62  SRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKMA 121
           SR++LLEKLQKT+QFDVLVIGGGASG GSALDA+TRGLNVALLEMND+ASGTSSKSTKMA
Sbjct: 50  SRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLNVALLEMNDFASGTSSKSTKMA 109

Query: 122 HGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFYV 181
           HGGVRYLEKA WELSKAQLDLVIEALNERAH+L+TAPHLCK+LPIMIPVYKWWQVPYFYV
Sbjct: 110 HGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFYV 169

Query: 182 GTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAVT 241
           GTKMYDFFAG QNLKSSYLLSA+ A +VAPMLDASKLKAGLVYHDGSFNDSRMN+T+AVT
Sbjct: 170 GTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAVT 229

Query: 242 AIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRILQ 301
           AIENGAT+LNYMEVK+L+KNPE GKVEGA+A+DRETGK+Y+V+AKVVV+ATGPFSDR+LQ
Sbjct: 230 AIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLLQ 289

Query: 302 MENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDAE 361
           M+NHP+GLPDD  L   N+ +TI T+VAVA+PKMVVPSSGVHIILPS+YCPK+MGLLDAE
Sbjct: 290 MDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDAE 349

Query: 362 TSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDVQ 421
           TSDGRVMFFLPWQGKVLAGTTDIPMKQVP NPTATEADIQDILKELQHYIKFPVKREDVQ
Sbjct: 350 TSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDVQ 409

Query: 422 SAWAGIRPLVKDPRKDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQETIDEVVK 481
           SAWAGIRPLVKDPRK+ SDTQ LVRSH +FTS +G+VTISGGKWTTYREMA+ET++EVVK
Sbjct: 410 SAWAGIRPLVKDPRKNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEETVNEVVK 469

Query: 482 VGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAICEIF 541
           VG FVNAKPCITRK+KL G+E+WD NLPA+LS QYN+PP+L+E+LS+NYGTKAA +CE+F
Sbjct: 470 VGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPLLAEHLSQNYGTKAAQVCELF 529

Query: 542 QSDKRNQLPVSLAAEKAAANVDYDAFRYPFTVGELKYNIRNEYARKPLDFLMRRTRYAFL 601
           + D+ N LPVSLAA+K  + +DY+AFRYP+T+GELK+ + +EYAR PLDFLMRRTRYAFL
Sbjct: 530 EDDRANMLPVSLAADKPTS-IDYNAFRYPYTIGELKFTMTHEYARTPLDFLMRRTRYAFL 588

Query: 602 DAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644
           DAKQA+ AV GTVK+MGD LGWDSAKR  ETKYAIE+IKTFGV
Sbjct: 589 DAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/590 (78%), Positives = 529/590 (89%), Gaps = 7/590 (1%)

Query: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120
           PSRA LL +L KTD+FDVL+IGGGA+GTG ALDA+TRGLNVAL+EMND+ASGTSSKSTKM
Sbjct: 54  PSRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFASGTSSKSTKM 113

Query: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180
           AHGGVRYLEKAFWELSKAQLDLVIEALNERAHML+TAPHLCKILPIMIPVY +WQVPYFY
Sbjct: 114 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFY 173

Query: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240
           VGTKMYD FAG QNLKSSYLLS + AS+VAPMLDASKLKAGLVYHDGSFNDSRMNS+LA+
Sbjct: 174 VGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAI 233

Query: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300
           TAIE GAT+LNY+++KQL+KN ETGKVEGAIAVDRETG +Y +KAKVVV+ATGP+SDR+L
Sbjct: 234 TAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLL 293

Query: 301 QMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDA 360
           QM+  P GLPDD  L K NE AT++TK+AV +PKMVVPS+GVHI+LPSFYCPK++GLLDA
Sbjct: 294 QMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDA 353

Query: 361 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDV 420
           +TSDGRVMFFLPWQGKVLAGTTDIPMKQ+PENPTATEADIQDILKELQHYI FPVKREDV
Sbjct: 354 QTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDV 413

Query: 421 QSAWAGIRPLVKDPRKDNS---DTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQETID 477
            SAWAGIRPLVKDPRK +S    TQ LVRSHFLFTS S LVTISGGKWTTYREMA+ETID
Sbjct: 414 LSAWAGIRPLVKDPRKADSGSGSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEETID 473

Query: 478 EVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAI 537
           EVVKVG F N+KPC+T+K+KLVG ENW+PNL A+LSQ+Y+L   +SE+L+ NYGT+A  I
Sbjct: 474 EVVKVGQF-NSKPCVTKKLKLVGGENWNPNLSALLSQKYHLSSAMSEHLANNYGTRAPLI 532

Query: 538 CEIFQSDKRNQLPVSLAAEKAAA---NVDYDAFRYPFTVGELKYNIRNEYARKPLDFLMR 594
           CE+F  D RN+LPV+LA ++  +   +VDYD+FRYP+T+GELKY+++ EYAR  LDFLMR
Sbjct: 533 CELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDFLMR 592

Query: 595 RTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644
           RTRYAFLDAKQA+ AV GTVK+MGDELGWDS KR+ E + A E+IKTFGV
Sbjct: 593 RTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/656 (71%), Positives = 547/656 (83%), Gaps = 19/656 (2%)

Query: 1   MFFRYTSRKVIPWXXXXXXXXXXXXXXWQFVSQQHAISNTGFVANELPAELKLEKHAPAP 60
           MF   T R V+P               W    QQ ++ N     N++     ++K     
Sbjct: 1   MFANATRRMVVP-AAFAAATVGGATILWHQQQQQKSVIN-----NDVTVTNPVQKSKINL 54

Query: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120
           P+R  LL KL KT+QFDVL+IGGGA+GTGSALDAATRGLNVAL+EMND+ASGTSSKSTKM
Sbjct: 55  PTRQDLLSKLSKTNQFDVLIIGGGATGTGSALDAATRGLNVALVEMNDFASGTSSKSTKM 114

Query: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180
           AHGGVRYLEKAFWELSKAQLDLV+EALNERAHML+TAPHLCKILPIMIPVY +WQ PYFY
Sbjct: 115 AHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYFY 174

Query: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240
           VG KMYD FAG QNLKSSY+L+A+ A++VAPMLDASKLKAGLVYHDGSFNDSRMN+TLAV
Sbjct: 175 VGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLAV 234

Query: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300
           TA+E GAT+LNYMEVKQL+KN +TGKVEGA+A DRETG+ + +KAKVVV+ATGPFSDRIL
Sbjct: 235 TAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRIL 294

Query: 301 QMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDA 360
           QM+   KGLPDD  L  +N  ATI++KVAVA+P+MVVPS+GVHI+LPSFYCPK++GLLDA
Sbjct: 295 QMDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLDA 354

Query: 361 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDV 420
           +TSDGRVMFFLPWQGKVLAGTTDIPMKQ+PENPTATEADIQDILKELQHYIKFPVKREDV
Sbjct: 355 KTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKREDV 414

Query: 421 QSAWAGIRPLVKDPRK---DN------SDTQDLVRSHFLFTSDSGLVTISGGKWTTYREM 471
            SAWAGIRPLVKDPRK   +N      S TQ+LVRSHFLFTSD+ LVTI+GGKWTTYREM
Sbjct: 415 LSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYREM 474

Query: 472 AQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYG 531
           ++ETI+EVVKVG F NAKPCITRK+KL G+EN+DPNLPA+L+Q+Y+L   ++EYL+ NYG
Sbjct: 475 SEETINEVVKVGKF-NAKPCITRKLKLAGAENYDPNLPAMLAQEYHLSSKMAEYLANNYG 533

Query: 532 TKAAAICEIFQSDKRNQLPVSLAAEKAA---ANVDYDAFRYPFTVGELKYNIRNEYARKP 588
           T+A  ICE+F+ D +N+LP++   ++      NVD+D+FRYPFT+GELKY+I NEY R  
Sbjct: 534 TRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTRTA 593

Query: 589 LDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644
           LDFLMRRTRYAFLDAKQA+ AV GTVK+MGDEL WDS +R+ E + A EFIKTFGV
Sbjct: 594 LDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/609 (72%), Positives = 522/609 (85%), Gaps = 10/609 (1%)

Query: 45  NELPAELKLEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALL 104
           NE+   + L+  APA PSR++LL+K+ KTDQFDVLVIGGGA+GTG A+D ATRGLNVAL+
Sbjct: 34  NEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALV 93

Query: 105 EMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKIL 164
           EMND+ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNER HML+TAPHLCK+L
Sbjct: 94  EMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVL 153

Query: 165 PIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVY 224
           PIMIPVY +WQVPYFYVG KMYD FAG QNLKSSY+++A  AS+VAPMLDAS LKAGLVY
Sbjct: 154 PIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVY 213

Query: 225 HDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVK 284
           HDGSFNDSRMN+ LAVTAIE GAT+LNYMEV +LLKN +TG+VEGA+A DRETGK++ + 
Sbjct: 214 HDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRIN 273

Query: 285 AKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGA-TITTKVAVADPKMVVPSSGVH 343
           AKVVV++TGPFSDRILQM+N   GLP +  +  ANEG  +I ++VAV++P+MVVPS+GVH
Sbjct: 274 AKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVH 333

Query: 344 IILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDI 403
           I+LP+FYCPK +GLLDA+TSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDI
Sbjct: 334 IVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDI 393

Query: 404 LKELQHYIKFPVKREDVQSAWAGIRPLVKDPR-----KDNSDTQDLVRSHFLFTSDSGLV 458
           LKELQHYIKFPVKREDV SAWAGIRPLV+DPR      D S TQ LVR+HFLFTSD+GLV
Sbjct: 394 LKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLV 453

Query: 459 TISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNL 518
           TI+GGKWTTYREMA+ETIDEVVK G+F  AKPCIT+KIKL G+E WDPN  A+L+Q+Y+L
Sbjct: 454 TIAGGKWTTYREMAEETIDEVVKQGHF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHL 512

Query: 519 PPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLAAEKAAA---NVDYDAFRYPFTVGE 575
              ++E+L+ NYGT++  ICE+F+ D++NQLPV+    +      NV++D+FRYPFT+ E
Sbjct: 513 SSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAE 572

Query: 576 LKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYA 635
           LKY+++ EY R  LDFLMRRTR+ FLDAKQA+ AV GTV IMGDELGWD  KR  E + A
Sbjct: 573 LKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQA 632

Query: 636 IEFIKTFGV 644
            +FIKTFGV
Sbjct: 633 SDFIKTFGV 641

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/619 (69%), Positives = 523/619 (84%), Gaps = 10/619 (1%)

Query: 35  HAISNTGFVANELPAELKLEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDA 94
           + + N     +E+     L+  APA P+R++LLEK+ KT+QFDVL+IGGGA+GTG A+DA
Sbjct: 24  YMVQNDKIARSEVRVTRPLKAEAPALPTRSELLEKMAKTEQFDVLIIGGGATGTGCAVDA 83

Query: 95  ATRGLNVALLEMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHML 154
           ATRGLNVAL+EMND+ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNER HML
Sbjct: 84  ATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHML 143

Query: 155 HTAPHLCKILPIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLD 214
           +TAPHLCK+LPIMIPVY +WQVPYFYVG KMYD FAG QNLKSSY++SA  AS+VAPMLD
Sbjct: 144 NTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLD 203

Query: 215 ASKLKAGLVYHDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVD 274
           AS LKAGLVYHDGSFNDSRMN+ LAVTAIE GAT+LNYMEV QL+KN ++G++EGA+  D
Sbjct: 204 ASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRD 263

Query: 275 RETGKQYSVKAKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGA-TITTKVAVADP 333
           RETG+++ +KAKVVV++TGPFSDR+LQM+    G P +  +  ANEG  +I +++AV++P
Sbjct: 264 RETGEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNP 323

Query: 334 KMVVPSSGVHIILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENP 393
           +MVVPS+GVHI+LP+FYCPK++GLLDA+TSDGRVMFFLPWQGKVLAGTTDIPMKQVPENP
Sbjct: 324 RMVVPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENP 383

Query: 394 TATEADIQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR-----KDNSDTQDLVRSH 448
           TATEADIQDILKELQHYIKFPVKR DV SAWAGIRPL++DPR      D S TQ LVR+H
Sbjct: 384 TATEADIQDILKELQHYIKFPVKRGDVLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNH 443

Query: 449 FLFTSDSGLVTISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNL 508
           FL+TSD+GLVTI+GGKWTTYREMA+ETIDEVVK G F  AKPCIT+KIKL G+E WDPN 
Sbjct: 444 FLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF-QAKPCITKKIKLAGAEGWDPNF 502

Query: 509 PAILSQQYNLPPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLAAEKAAA---NVDYD 565
            A+L+Q+Y+L   ++E+L+ NYGT++  ICE+F+ D++NQLPV+    +      NV++D
Sbjct: 503 VAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFD 562

Query: 566 AFRYPFTVGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDS 625
           +FRYPFT+GELKY+++ EY R  LDFLMRRTR+ FLDA+QA+ AV GTV +MGDELGW  
Sbjct: 563 SFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSD 622

Query: 626 AKREMETKYAIEFIKTFGV 644
            +R+ E + A EFIKTFG+
Sbjct: 623 DRRQAERQQASEFIKTFGL 641

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/613 (71%), Positives = 511/613 (83%), Gaps = 23/613 (3%)

Query: 53  LEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASG 112
           L+K +   P+R  L+ KL KT+QFDVLVIGGGA+G G ALDA TRGLNVAL+E  D+ASG
Sbjct: 50  LDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASG 109

Query: 113 TSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYK 172
           TSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAH+L+TAPHLCKILPIMIPVY 
Sbjct: 110 TSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYN 169

Query: 173 WWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDS 232
           +WQ+PYFY G KMYD FAG QNLKSSYLLS   A+ VAPMLD +KLKAGLVYHDG+FNDS
Sbjct: 170 YWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDS 229

Query: 233 RMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSAT 292
           RMNSTLAVTAIENG+T+LNYMEVKQLLK   +GK+EGAI  D ETGKQY++KAKVV++AT
Sbjct: 230 RMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINAT 289

Query: 293 GPFSDRILQMENHPKGLPDDLSLS-KANEGATITTKVAVADPKMVVPSSGVHIILPSFYC 351
           GP+SD ILQM+ +P GLPD L+++ K N    I TKV+V++PKMVVPS+GVHIILPSFYC
Sbjct: 290 GPYSDAILQMDQNPTGLPDPLNVNLKTNN--DIATKVSVSNPKMVVPSAGVHIILPSFYC 347

Query: 352 PKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYI 411
           PKD+GLLDA+TSDGRVMFFLPWQGKVLAGTTD+PMKQ+PENPTATEADIQDILKELQHYI
Sbjct: 348 PKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYI 407

Query: 412 KFPVKREDVQSAWAGIRPLVKDPR--KDNSD--TQDLVRSHFLFTSDSGLVTISGGKWTT 467
           +FPVKREDV SAWAGIRPLVKDPR    N D  TQ LVRSHF+FTSD GLVTI+GGKWTT
Sbjct: 408 RFPVKREDVLSAWAGIRPLVKDPRTLDKNGDGSTQGLVRSHFIFTSDHGLVTIAGGKWTT 467

Query: 468 YREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLS 527
           YR MA+ET+DE +KVG F N KPCITR IKL G ENW+PNL A+L+Q+Y+L   LS++L+
Sbjct: 468 YRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQHLA 527

Query: 528 ENYGTKAAAICEIFQSDKRNQLPVSLAA-----EKAAANVD-----------YDAFRYPF 571
           +NYGT+A  ICE++  D++N+LP++LAA     E    N +           ++ FRYPF
Sbjct: 528 DNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPF 587

Query: 572 TVGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREME 631
           TVGE+KY++  EYA   LDFLMRR+R+AFLDAK+AV AV GTVKIMGDEL WD ++R  E
Sbjct: 588 TVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKE 647

Query: 632 TKYAIEFIKTFGV 644
            +  I++IKTFGV
Sbjct: 648 IENTIKYIKTFGV 660

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/623 (70%), Positives = 516/623 (82%), Gaps = 14/623 (2%)

Query: 34  QHAISNTGFVANELPAELKLEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALD 93
            H  +N   ++N++     +EK     P+R +LL+KL +T+QFDVL+IGGGA+GTG ALD
Sbjct: 30  NHYNNNNKLISNDVSLISPVEKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCALD 89

Query: 94  AATRGLNVALLEMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHM 153
           AATRGLNVAL+E ND+ASGTSSKSTKMAHGGVRYLEKAFWE+SKAQLDLVIEALNERAH+
Sbjct: 90  AATRGLNVALVEKNDFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHL 149

Query: 154 LHTAPHLCKILPIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPML 213
           L+TAPHLCK+LPI+IPVY +WQVPYFY G KMYD FAG QNLK SYL+S     +VAPML
Sbjct: 150 LNTAPHLCKLLPIIIPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPML 209

Query: 214 DASKLKAGLVYHDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAV 273
           D S LKAGLVYHDGSFND+RMN+TLAVTAIEN AT+LNYMEVKQL+K+ + GKV GA+  
Sbjct: 210 DGSNLKAGLVYHDGSFNDTRMNATLAVTAIENSATVLNYMEVKQLVKDKD-GKVAGAVVE 268

Query: 274 DRETGKQYSVKAKVVVSATGPFSDRILQMENHPKGLPDDL-----SLSKANEGA-TITTK 327
           DRETGK YSV+AKVVV+ATGP+SDR+LQM+ +P GLPD++      +   N    +I ++
Sbjct: 269 DRETGKTYSVRAKVVVNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQ 328

Query: 328 VAVADPKMVVPSSGVHIILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMK 387
           VAV  P MVVPS+GVHIILPSFYCPK+MGLLDA+TSDGRVMFFLPWQGKVLAGTTDIP+K
Sbjct: 329 VAVTKPNMVVPSAGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLK 388

Query: 388 QVPENPTATEADIQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPRKD---NSDTQDL 444
           QVPENPTATEADIQDILKELQ YIKFPVKREDV SAWAGIRPLV DPRK    +  TQ L
Sbjct: 389 QVPENPTATEADIQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRKKSKADGSTQGL 448

Query: 445 VRSHFLFTSDSGLVTISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENW 504
           VRSHF+FTSD GLVTI+GGKWTTYR MA+ETIDEVVK G F +AKPCITRK+KL G+ENW
Sbjct: 449 VRSHFIFTSDHGLVTIAGGKWTTYRAMAEETIDEVVKNGKF-DAKPCITRKLKLAGAENW 507

Query: 505 DPNLPAILSQQYNLPPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLAAEKAA---AN 561
           DPNLPA+L+Q+Y+L   +S YL+ENYGT+A  ICE+F  D  N+LP+ LA ++      +
Sbjct: 508 DPNLPALLAQKYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGH 567

Query: 562 VDYDAFRYPFTVGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDEL 621
           VD+D+FRYP T+ ELKY I+ EYAR  LDFLMRRTR+AFLDAKQA+ AV GTV++MGD L
Sbjct: 568 VDFDSFRYPITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSL 627

Query: 622 GWDSAKREMETKYAIEFIKTFGV 644
           GWD  +R+ E +Y+ EFIKTFGV
Sbjct: 628 GWDEQRRQDEIRYSTEFIKTFGV 650

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/609 (70%), Positives = 512/609 (84%), Gaps = 11/609 (1%)

Query: 43  VANELPAELKLEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVA 102
           +AN++  +  ++      PSR  LL KL KTDQFDVLVIGGGA+GTG A+DAATRGLNVA
Sbjct: 39  IANDVALQSAVDTPNVKLPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLNVA 98

Query: 103 LLEMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCK 162
           L+EM+D+ASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNER HML+TAPHLCK
Sbjct: 99  LVEMHDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCK 158

Query: 163 ILPIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGL 222
           ILPIMIPVY +WQ+PYFYVG KMYD FAG QNLK+SYLL+   A+ +APMLD + LKAGL
Sbjct: 159 ILPIMIPVYTYWQIPYFYVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGL 218

Query: 223 VYHDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYS 282
           VYHDGSFNDSRMN+ LAVTAIENGAT+LNYMEVKQL+K+ ETGKV+GA+  +RETG+Q++
Sbjct: 219 VYHDGSFNDSRMNTALAVTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFT 278

Query: 283 VKAKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGV 342
           VKAKV V+ATGP+SD++LQM+ +  G PD    +K    ATI+TKVAV +PKMVVPS+GV
Sbjct: 279 VKAKVTVNATGPYSDKLLQMDENKDGKPDP---TKPLPNATISTKVAVENPKMVVPSAGV 335

Query: 343 HIILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQD 402
           HIILPSFYCP++MGLLD +TSDGRVMFFLPWQGKVLAGTTDIPMKQVP+ PTA E+DIQD
Sbjct: 336 HIILPSFYCPREMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQD 395

Query: 403 ILKELQHYIKFPVKREDVQSAWAGIRPLVKDPRKDNSD----TQDLVRSHFLFTSDSGLV 458
           IL+ELQHYIKFPVKREDV SAWAGIRPLV DPRK   +    TQ LVRSH  FT+D+G+V
Sbjct: 396 ILQELQHYIKFPVKREDVLSAWAGIRPLVIDPRKSQGNTGGSTQGLVRSHLCFTTDNGMV 455

Query: 459 TISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNL 518
           TI+GGKWTTYREMA+ETI+EVVKVG F N KPCITRK+KL G+ENW+PNL A+L+Q+Y+L
Sbjct: 456 TIAGGKWTTYREMAEETINEVVKVGKF-NVKPCITRKLKLSGAENWNPNLAALLAQKYHL 514

Query: 519 PPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLAAEKAA---ANVDYDAFRYPFTVGE 575
              +S +LSENYGT+A  ICE+FQ D+RNQLPV+    +      NV++D+FRYPFT+GE
Sbjct: 515 SGAMSNHLSENYGTRAPLICEMFQEDERNQLPVTFGGRENVTVYGNVNFDSFRYPFTIGE 574

Query: 576 LKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYA 635
           L Y++  EY R  LDFLMRRTR+AFLDA+QA+ AV GTV +MGD+L WDS +R+ E + +
Sbjct: 575 LNYSVDYEYTRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHEIEKS 634

Query: 636 IEFIKTFGV 644
            EFI+TFGV
Sbjct: 635 KEFIRTFGV 643

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/589 (72%), Positives = 505/589 (85%), Gaps = 9/589 (1%)

Query: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120
           P+R++L+  L+ TDQFDVL+IGGGA+G+GSALDAATRGLNVAL+E +D+ASGTSSKSTKM
Sbjct: 62  PTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNVALVEKDDFASGTSSKSTKM 121

Query: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180
           AHGGVRYLEKA ++LSKAQLDLVIEALNERAH+L+TAPHLCKILPIMIPVYK+WQVPYFY
Sbjct: 122 AHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYKYWQVPYFY 181

Query: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240
            G KMYD FAG QNLKSSYL+S   A ++APMLD SKLKAGLVYHDG+FNDSRMNSTLA+
Sbjct: 182 AGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLVYHDGTFNDSRMNSTLAI 241

Query: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300
           TAIENGAT+LNYMEVKQLLK+P + ++ GAI  D ETG++  + AKV+V+ATGP+SD+IL
Sbjct: 242 TAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQINAKVIVNATGPYSDKIL 301

Query: 301 QMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDA 360
           QM+N+  G PD+ + S      +I TKVAV +P MVVPS+GVHIILPSFYCP++MGLLDA
Sbjct: 302 QMDNNKNGKPDEFTQSAE---TSIATKVAVQNPHMVVPSAGVHIILPSFYCPREMGLLDA 358

Query: 361 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDV 420
            TSDGRVMFFLPWQGKVLAGTTDIPMK VPENPTATEADIQDILKELQHYIKFPVKREDV
Sbjct: 359 NTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHYIKFPVKREDV 418

Query: 421 QSAWAGIRPLVKDPRKDNSD--TQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQETIDE 478
            SAWAGIRPLV+DPRK   +  TQ+LVRSHF+FTSD GLVTI+GGKWTTYREMA+ETID 
Sbjct: 419 LSAWAGIRPLVQDPRKTPKEGATQELVRSHFIFTSDHGLVTIAGGKWTTYREMAEETIDT 478

Query: 479 VVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAIC 538
           VVK G F N KPC TRK+KL G EN+DPNL A+L+Q+Y+LP  LSE+L+ NYGT++  IC
Sbjct: 479 VVKNGKF-NVKPCSTRKLKLAGGENYDPNLAALLAQKYHLPSKLSEHLANNYGTRSPLIC 537

Query: 539 EIFQSDKRNQLPVSLAAE---KAAANVDYDAFRYPFTVGELKYNIRNEYARKPLDFLMRR 595
           ++F +D  N+LP+ LA +   K    VD+D+FRYP+++ E+KY + +EYAR  LDFLMRR
Sbjct: 538 DMFVADDHNRLPIYLAGKEENKVYGTVDFDSFRYPYSIAEVKYCVHHEYARTTLDFLMRR 597

Query: 596 TRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644
           +R+AFLDAKQA+ +V GTVKIMGDEL WD  +R+ ET Y+IE+IKTFGV
Sbjct: 598 SRFAFLDAKQALKSVEGTVKIMGDELNWDEERRKQETDYSIEYIKTFGV 646

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/612 (70%), Positives = 504/612 (82%), Gaps = 16/612 (2%)

Query: 43  VANELPAELKLEKHAPAP----PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRG 98
           ++NE+P    ++   P P    PSR  LL  LQKTD+FDVL+IGGGASG GSALDAATRG
Sbjct: 38  LSNEVPVVSPID---PRPSVNLPSREDLLSNLQKTDKFDVLIIGGGASGAGSALDAATRG 94

Query: 99  LNVALLEMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAP 158
           LNVA +E ND+ASGTSSKSTKMAHGGVRYLEKA +ELS+AQLDLVIEALNER HML TAP
Sbjct: 95  LNVACVEANDFASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAP 154

Query: 159 HLCKILPIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKL 218
           HLCKILPIMIPVY +WQVPYF+ G K+YD+FAGKQNL+SSYLLS T AS++APMLD SKL
Sbjct: 155 HLCKILPIMIPVYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKL 214

Query: 219 KAGLVYHDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETG 278
           KAGLVYHDGSFNDSRMNSTLA++AIE+GAT+LNY++V QLLK+  T KVEGAI  D+ETG
Sbjct: 215 KAGLVYHDGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETG 274

Query: 279 KQYSVKAKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVP 338
           KQY VKAKV V+ATGP+SD ILQM+ +  GLPD      AN   +I T+VAV  P MVVP
Sbjct: 275 KQYQVKAKVTVNATGPYSDLILQMDKNKNGLPDPQPPQPAN--VSIATEVAVNKPNMVVP 332

Query: 339 SSGVHIILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEA 398
           S+GVHIILPS+YCPK +GLLD +T+DGRVMFFLPWQGKVLAGTTDIPMK VP+NPTATEA
Sbjct: 333 SAGVHIILPSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEA 392

Query: 399 DIQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPRK---DNSDTQDLVRSHFLFTSDS 455
           DIQDIL+ELQHYIKFPV+REDV SAWAGIRPLV DPRK       T+ LVR+H +FTS++
Sbjct: 393 DIQDILRELQHYIKFPVRREDVLSAWAGIRPLVMDPRKRKDTGGSTEGLVRNHLIFTSET 452

Query: 456 GLVTISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQ 515
           GL+T++GGKWTTYREMA++TIDEVVK G F + KPCITRKIKL G ENW PNL A+L+Q 
Sbjct: 453 GLITLAGGKWTTYREMAEQTIDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQH 511

Query: 516 YNLPPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLAAEKAAA---NVDYDAFRYPFT 572
           Y L   +S++LS NYGT+A  ICE+F+ D+RNQLPV+    +      +V++D+FRYPFT
Sbjct: 512 YKLSQAMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFT 571

Query: 573 VGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMET 632
           +GE  Y+IR+EY+RK  DFLMRRTRYAFLDA  A+ AV GTVK+MGDEL WDSA+R+ E 
Sbjct: 572 IGEFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREI 631

Query: 633 KYAIEFIKTFGV 644
           +   EFIKTFGV
Sbjct: 632 EECTEFIKTFGV 643

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/595 (69%), Positives = 501/595 (84%), Gaps = 11/595 (1%)

Query: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120
           P+R++LL++L++  QFDVL+IGGGA+GTG A+DAATRGL VAL+E ND+ASGTSSKSTKM
Sbjct: 60  PTRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDFASGTSSKSTKM 119

Query: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180
           AHGGVRYLEKAF++LSK+QLDLVIEALNERAH+L+TAPHLCKILPI+IPVY +WQVPYFY
Sbjct: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179

Query: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240
            G K+YD FAG QNLK+SYLLS + A ++APML+A+ LKA LVYHDGSFNDSR+N+TLA+
Sbjct: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239

Query: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300
           TAIE GAT+LNY+EV++LLK+ ETG + G    D ETG    V +KVVV+ATGPFSD+IL
Sbjct: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299

Query: 301 QMENHPKGLPDDLSLS-KANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLD 359
           QM+ +P GLPDD++L+ K      I++K+AV +P MVVPSSGVHIILPS+YCPK MGLLD
Sbjct: 300 QMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359

Query: 360 AETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRED 419
             TSDGRVMFFLPWQGKV+AGTTDIPM QVPE P A EADIQDILKELQHYIKFPVKRED
Sbjct: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419

Query: 420 VQSAWAGIRPLVKDPRKDNSD-------TQDLVRSHFLFTSDSGLVTISGGKWTTYREMA 472
           V SAWAGIRPLV+DPR  + D       TQ LVRSHF+FTSD+GLVTI+GGKWTTYREMA
Sbjct: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479

Query: 473 QETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENYGT 532
           +ETIDEVVK G FV+AKPCITR++KL G+E WDPN+ A+LSQ+YNLP +++ YLS+NYGT
Sbjct: 480 EETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYNLPSMMANYLSDNYGT 539

Query: 533 KAAAICEIFQSDKRNQLPVSLAA---EKAAANVDYDAFRYPFTVGELKYNIRNEYARKPL 589
           ++  ICE+F +D+ N+LPV LA    E+   N D++ FRYP T+GELKY++R EYAR  L
Sbjct: 540 RSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTAL 599

Query: 590 DFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644
           DFLMRRTR+AFLDAK+A+ AV GTVKIMGDE  W S +R+ E +  I+FIK+FGV
Sbjct: 600 DFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/599 (71%), Positives = 504/599 (84%), Gaps = 16/599 (2%)

Query: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120
           PSR  LL KL+KT QFDVL+IGGGA+GTG A+DAATRGLNVAL+E NDYASGTSSKSTKM
Sbjct: 60  PSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRGLNVALVEKNDYASGTSSKSTKM 119

Query: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180
           AHGGVRYLEKA ++LSKAQLDLVIEALNERAH+L+TAPHLCKILPIMIPVY++WQVPYFY
Sbjct: 120 AHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQVPYFY 179

Query: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240
           VGTKMYD FAG QNLKSSYLLS + A ++APMLD+SKLKAGLVYHDGSFNDSRMN+TLA+
Sbjct: 180 VGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKAGLVYHDGSFNDSRMNATLAI 239

Query: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300
           +AIE GAT+LNYMEVKQL+K+ +T K+ GAI  D ETG+ Y +KAKV+V+ATGP+SD IL
Sbjct: 240 SAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTIL 299

Query: 301 QMENHPKGLPDDL--SLSKAN--------EGATITTKVAVADPKMVVPSSGVHIILPSFY 350
           QM+N+  GLPD     +   N           +I+ +VAV +P MVVPS+GVHIILPS+Y
Sbjct: 300 QMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGVHIILPSYY 359

Query: 351 CPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHY 410
           CP +MGLLDA T+DGRVMFFLPWQGKVLAGTTDIPMK VPENPTATEADIQDILKELQHY
Sbjct: 360 CPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHY 419

Query: 411 IKFPVKREDVQSAWAGIRPLVKDPR-KDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYR 469
           IKFPVKREDV SAWAGIRPLV+DPR +    TQ++VRSHF+FTSD+GLVTI+GGKWTTYR
Sbjct: 420 IKFPVKREDVLSAWAGIRPLVQDPRVQKGGATQEVVRSHFIFTSDNGLVTIAGGKWTTYR 479

Query: 470 EMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSEN 529
           EMA+ETIDEVVK G F NAKPCITRK+KL G+ENWD NL A+LSQ+YN+   ++E+L+ N
Sbjct: 480 EMAEETIDEVVKQGKF-NAKPCITRKLKLAGAENWDANLAALLSQKYNVSTPMAEHLANN 538

Query: 530 YGTKAAAICEIFQSDKRNQLPVSLAAEK----AAANVDYDAFRYPFTVGELKYNIRNEYA 585
           YGT++  ICE+ +    N+LPV+LA  +    + A+V YD+FRYP+T+ ELKY++  EY 
Sbjct: 539 YGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYTIAELKYSMDYEYT 598

Query: 586 RKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644
           R  LDFLMRRTRYAFLDAK+A+ AV GTVKIMGD L WD+ +RE E  YA ++IKTFGV
Sbjct: 599 RTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVYATDYIKTFGV 657

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/627 (66%), Positives = 502/627 (80%), Gaps = 23/627 (3%)

Query: 38  SNTGFVANELPAELKLEKHAPA---PPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDA 94
           S+T  +   L +E  L+K A     PPSR++LL  L+KT +FDVL+IGGGA+GTG A+DA
Sbjct: 42  SDTKPLKTSLNSEEDLQKIANGSYKPPSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDA 101

Query: 95  ATRGLNVALLEMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHML 154
           +TRGLNVAL+EMND+AS TSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNER HML
Sbjct: 102 STRGLNVALMEMNDFASATSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERKHML 161

Query: 155 HTAPHLCKILPIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLD 214
            TAPHLCKILPIMIPVY +W+VPYFY G KMYDFFAG QNLKS+YLLS T A Q+APMLD
Sbjct: 162 QTAPHLCKILPIMIPVYNYWEVPYFYAGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLD 221

Query: 215 ASKLKAGLVYHDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVD 274
             KLKA LVYHDGSFND+RMN +LAVTAIENGAT+LNYMEV++L+K+P+TGK++GA   D
Sbjct: 222 VPKLKAALVYHDGSFNDARMNVSLAVTAIENGATVLNYMEVEKLIKDPKTGKIQGATVRD 281

Query: 275 RETGKQYSVKAKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGATI--------TT 326
           RET K+Y V AKVVV++TGPFSD ILQM+ +  G PD     KAN   +          +
Sbjct: 282 RETDKKYDVMAKVVVNSTGPFSDNILQMDRNKSGYPD--IFDKANIDTSKLPSIDHDNLS 339

Query: 327 KVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPM 386
           ++AV +PKMVVPS+GVHIILPS+YCPKDMG+LD +T+DGRVMFFLPWQ KVLAGTTDIPM
Sbjct: 340 RIAVDNPKMVVPSAGVHIILPSYYCPKDMGILDVKTADGRVMFFLPWQDKVLAGTTDIPM 399

Query: 387 KQVPENPTATEADIQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR------KDNSD 440
           K+VPENP ATEADI+DIL ELQHY KFPVKREDV SAWAGIRPLV+DPR      K +  
Sbjct: 400 KKVPENPVATEADIEDILSELQHYCKFPVKREDVLSAWAGIRPLVRDPRKLSPNSKGDDS 459

Query: 441 TQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVG 500
           TQ LVRSHF+FTS++ LVTI+GGKWTTYR MA+ETIDE +KVG   N KP +T+ + L G
Sbjct: 460 TQGLVRSHFIFTSENNLVTIAGGKWTTYRRMAEETIDEAIKVGQLPN-KPSVTKDLILSG 518

Query: 501 SENWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLAAE---K 557
            ENW PN  A+LSQ+Y++P  LS+YLSENYGT+A  ICE+ + DK+N+LPV+LA +   +
Sbjct: 519 GENWTPNTAALLSQKYHIPSSLSKYLSENYGTRAPIICELLKKDKKNELPVTLAGKEHNE 578

Query: 558 AAANVDYDAFRYPFTVGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIM 617
              NVD+ A RYP+TV E+KY I NEY+R  LDFL+RRTR+ FLDAK+A+ AV GTV IM
Sbjct: 579 ILGNVDFQALRYPYTVAEVKYCIDNEYSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIM 638

Query: 618 GDELGWDSAKREMETKYAIEFIKTFGV 644
           GDEL WDS KR +E K + E+IKT GV
Sbjct: 639 GDELNWDSEKRSLEIKKSKEYIKTLGV 665

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/597 (68%), Positives = 497/597 (83%), Gaps = 13/597 (2%)

Query: 61  PSRAQLLEKLQKTD-QFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTK 119
           PSR+QL  +L   D QFD+L+IGGGA+GTG ALDAATRGLNVAL+E +D+ASGTSSKSTK
Sbjct: 57  PSRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKSTK 116

Query: 120 MAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYF 179
           MAHGGVRYLEKAF + SK+QLDLVIEALNERAH+L+TAPHLCKILPI+IPVY +WQ+PYF
Sbjct: 117 MAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYF 176

Query: 180 YVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLA 239
           Y G K YDFFAG QNLKSSYL+S   A ++APMLDA+ LKA LVYHDGSFNDSR+NS++A
Sbjct: 177 YAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIA 236

Query: 240 VTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRI 299
           +TAIENGAT+LNY+EV++LLK+P + K+ G    D+ETG+  +VK+KV+V+ATGP+SD I
Sbjct: 237 ITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTI 296

Query: 300 LQMENHPKGLPDDLSLS-KANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLL 358
           LQM+ +  GLPD  ++  K  +   I++K+AV++PKMVVPSSGVHIILPS+YCPK MGLL
Sbjct: 297 LQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLL 356

Query: 359 DAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRE 418
           DA T+DGRVMFFLPWQGKV+AGTTDIPM QVP+ P A E DIQDILKELQHYIKFPV+RE
Sbjct: 357 DARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRRE 416

Query: 419 DVQSAWAGIRPLVKDPRKDNSD-------TQDLVRSHFLFTSDSGLVTISGGKWTTYREM 471
           DV SAWAGIRPLV+DPR    D       TQ LVRSHFLFTSD+GL+TI+GGKWTTYREM
Sbjct: 417 DVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREM 476

Query: 472 AQETIDEVVKVGNFVN-AKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENY 530
           A+ETIDEVVK G+F N AKPC T+ +KL+G+ENWDPNL A+LSQ++NL  ++++YLSENY
Sbjct: 477 AEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLSENY 536

Query: 531 GTKAAAICEIFQSDKRNQLPVSLAA---EKAAANVDYDAFRYPFTVGELKYNIRNEYARK 587
           GT++  IC++F+ ++ N+LPV LA    +    NVD++ FRYP T+ ELKY ++ EYAR 
Sbjct: 537 GTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEYART 596

Query: 588 PLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644
           PLDFLMRRTR+A+LDA QA+ AV GTVK+MGDE GWDS +RE E K A  FI++FGV
Sbjct: 597 PLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/620 (64%), Positives = 483/620 (77%), Gaps = 21/620 (3%)

Query: 42  FVANELPAELKLEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNV 101
            V N+    ++    AP   SR  LL++L KT QFDVL+IGGGA+GTG ALDAATRGLNV
Sbjct: 34  LVHNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNV 93

Query: 102 ALLEMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLC 161
           AL+E  D+ASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER H+++TAPHLC
Sbjct: 94  ALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLC 153

Query: 162 KILPIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAG 221
            +LPI+IP+Y  WQVPY Y+G K YDFFAG QNLK SYLLS +   + APML    LKA 
Sbjct: 154 TVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKAS 213

Query: 222 LVYHDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQY 281
           LVYHDGSFNDSR+N+TLA+TA+ENGAT+LNY+EV++L+K+P +GKV GA A D ET +  
Sbjct: 214 LVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELV 273

Query: 282 SVKAKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGATITT---KVAVADPKMVVP 338
            + AK VV+ATGP+SD ILQM+ +P GLPD    S  N+ + I +   ++AV DPKMV+P
Sbjct: 274 RINAKCVVNATGPYSDAILQMDRNPSGLPD----SPLNDNSKIKSTFNQIAVMDPKMVIP 329

Query: 339 SSGVHIILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEA 398
           S GVHI+LPSFYCPKDMGLLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEA
Sbjct: 330 SIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEA 389

Query: 399 DIQDILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR------KDNSDTQDLVRSHFLFT 452
           DIQDILKELQHYI+FPVKREDV SAWAG+RPLV+DPR      K  S TQ +VRSHFLFT
Sbjct: 390 DIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFT 449

Query: 453 SDSGLVTISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAIL 512
           SD+GL+TI+GGKWTTYR+MA+ET+D+VV+VG F N KPC TR IKL G+E W  N  A+L
Sbjct: 450 SDNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALL 509

Query: 513 SQQYNLPPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLA--------AEKAAANVDY 564
           +Q Y+L   +S YL +NYGT+++ ICE F+    N+LP+SLA        + +    V++
Sbjct: 510 AQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNF 569

Query: 565 DAFRYPFTVGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWD 624
           D FRYPFT+GELKY+++ EY R PLDFL+RRTR+AFLDAK+A+ AV  TVK+MGDE  W 
Sbjct: 570 DTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWS 629

Query: 625 SAKREMETKYAIEFIKTFGV 644
             KR+ E +  + FIKTFGV
Sbjct: 630 EKKRQWELEKTVNFIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/605 (65%), Positives = 476/605 (78%), Gaps = 21/605 (3%)

Query: 57  APAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSK 116
           AP   SR  LL++L KT QFDVL+IGGGA+GTG ALDAATRGLNVAL+E  D+ASGTSSK
Sbjct: 49  APPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSK 108

Query: 117 STKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQV 176
           STKM HGGVRYLEKAFWE SKAQLDLVIEALNER H+++TAPHLC +LPI+IP+Y  WQV
Sbjct: 109 STKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQV 168

Query: 177 PYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNS 236
           PY Y+G K YDFFAG QNLK SYLLS +   + APML    LKA LVYHDGSFNDSR+N+
Sbjct: 169 PYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNA 228

Query: 237 TLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFS 296
           TLA+TA+ENGAT+LNY+EV++L+K+P +GKV GA A D ET +   + AK VV+ATGP+S
Sbjct: 229 TLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYS 288

Query: 297 DRILQMENHPKGLPDDLSLSKANEGATITT---KVAVADPKMVVPSSGVHIILPSFYCPK 353
           D ILQM+ +P G P+    S  N+ + I +   ++AV DPKMV+PS GVHI+LPSFYCPK
Sbjct: 289 DAILQMDRNPSGQPN----SPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPK 344

Query: 354 DMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKF 413
           DMGLLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQDILKELQHYI+F
Sbjct: 345 DMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEF 404

Query: 414 PVKREDVQSAWAGIRPLVKDPR------KDNSDTQDLVRSHFLFTSDSGLVTISGGKWTT 467
           PVKREDV SAWAG+RPLV+DPR      K  S TQ +VRSHFLFTSD+GL+TI+GGKWTT
Sbjct: 405 PVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTT 464

Query: 468 YREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLS 527
           YR+MA+ET+D+VV+VG F N KPC TR IKL G+E W  N  A+L+Q Y+L   +S YL 
Sbjct: 465 YRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLV 524

Query: 528 ENYGTKAAAICEIFQSDKRNQLPVSLA--------AEKAAANVDYDAFRYPFTVGELKYN 579
           +NYGT+++ ICE F+    N+LP+SLA        + +    V++D FRYPFT+GELKY+
Sbjct: 525 QNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFRYPFTIGELKYS 584

Query: 580 IRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFI 639
           ++ EY R PLDFL+RRTR+AFLDAK+A+ +   TVK+MGDE  W   KR+ E +  I FI
Sbjct: 585 MQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFI 644

Query: 640 KTFGV 644
           KTFGV
Sbjct: 645 KTFGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/616 (64%), Positives = 479/616 (77%), Gaps = 15/616 (2%)

Query: 43  VANELPAELKLEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVA 102
           V N+    ++    AP   SR  LLE+L KT QFDVL+IGGGA+GTG ALDAATRGLNVA
Sbjct: 38  VHNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIGGGATGTGCALDAATRGLNVA 97

Query: 103 LLEMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCK 162
           L+E  D+ASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER H+++TAPHLC 
Sbjct: 98  LVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCT 157

Query: 163 ILPIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGL 222
           +LPI+IP+Y   QVPY Y+G K YDFFAG QNLK SYLLS +   + APML    LKA L
Sbjct: 158 VLPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASL 217

Query: 223 VYHDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYS 282
           VYHDGSFNDSR+N+TLA+TA+ENGAT+LNY+EV++L+K+P +GKV GA A D ET +   
Sbjct: 218 VYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIR 277

Query: 283 VKAKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGV 342
           +KAK VV+ATGP+SD ILQM+ +P G PD   L+  ++  +   ++AV DPKMV+PS GV
Sbjct: 278 IKAKCVVNATGPYSDAILQMDRNPSGQPDS-PLNDNSKAKSAFNQIAVMDPKMVIPSIGV 336

Query: 343 HIILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQD 402
           HI+LPSFYCPKDMGLLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQD
Sbjct: 337 HIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQD 396

Query: 403 ILKELQHYIKFPVKREDVQSAWAGIRPLVKDPR------KDNSDTQDLVRSHFLFTSDSG 456
           ILKELQHYI+FPVKREDV SAWAG+RPLV+DPR      K  S TQ +VRSHFLFTSD+ 
Sbjct: 397 ILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDND 456

Query: 457 LVTISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQY 516
           L+TI+GGKWTTYR+MA+ETID+VV+VG F N  PC TR IKL G+E W  N  A+L+Q Y
Sbjct: 457 LITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNY 516

Query: 517 NLPPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLA--------AEKAAANVDYDAFR 568
           +L   +S YL +NYGT+++ ICE F+    N+LP+SLA        + +    V++D FR
Sbjct: 517 HLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFR 576

Query: 569 YPFTVGELKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKR 628
           YPFT+GELKY+++ EY R PLDFL+RRTR+AFLDAK+A+ +V  TVK+MGDE  W   KR
Sbjct: 577 YPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKR 636

Query: 629 EMETKYAIEFIKTFGV 644
           + E +  + FIKTFGV
Sbjct: 637 QWELEKTVNFIKTFGV 652

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/592 (63%), Positives = 469/592 (79%), Gaps = 13/592 (2%)

Query: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120
           P RA++L++LQ T +FDVLV+GGGA+GTG ALDA+ RGL VAL+E  D+A+GTSSKSTK+
Sbjct: 59  PDRAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKL 117

Query: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180
           AHGGVRYLEKA +ELSK QLDLV+EALNERAH+L+ APHL KILPI+IPVY++W+VPYFY
Sbjct: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177

Query: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240
            G KMYDFFAG QNLKSSYLLS    S +APMLD  KLK GLVYHDG FNDSR+ +TLA+
Sbjct: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237

Query: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300
           +A+E GAT+ NY+ V+QL+K+  TG + GA   D+ETG  ++V AK+VV+ATGP+SD+IL
Sbjct: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297

Query: 301 QMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDA 360
           QM+ +P+GLP+        E A I    AV +PKMVVPS GVHI LPSFYCP +MGLLDA
Sbjct: 298 QMDANPQGLPEKEPEKATPENALI----AVRNPKMVVPSRGVHITLPSFYCPSEMGLLDA 353

Query: 361 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDV 420
            TSDGRVMFFLPWQGKV+AGTTDIP+KQVP +P+ TEADIQDIL+ELQHYI+FPV+REDV
Sbjct: 354 STSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDV 413

Query: 421 QSAWAGIRPLVKDPR-----KDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQET 475
            SAWAGIRPLV+DPR       +  T+ LVRSHF+FTS + LVTI+GGKWTTYREMA+ET
Sbjct: 414 LSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEET 473

Query: 476 IDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYN-LPPVLSEYLSENYGTKA 534
           +DEV+KVG F   KPC TRK KL+G+++W+ N  A L Q+Y  L   L+E+L+ NYG +A
Sbjct: 474 VDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRA 533

Query: 535 AAICEIFQSDKRNQLPVSL--AAEKAAANVDYDAFRYPFTVGELKYNIRNEYARKPLDFL 592
             ICE+F++DK ++LPV L    +    N+D +AF YPFT+ ELKY IR EY R  LDFL
Sbjct: 534 PIICEMFEADKSSKLPVGLYGDGDDKVKNMDANAFDYPFTIAELKYCIRFEYVRTALDFL 593

Query: 593 MRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644
           +RR+R+AFLDA++A+ AV  TV ++GDELGWD+ KR  E+     +IKTFGV
Sbjct: 594 LRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/542 (64%), Positives = 424/542 (78%), Gaps = 21/542 (3%)

Query: 120 MAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYF 179
           M HGGVRYLEKAFWE SKAQLDLVIEALNER H+++TAPHLC +LPI+IP+Y  WQVPY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 180 YVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLA 239
           Y G K YDFFAGKQNLKSSYLLS +   + APML    LKA LVYHDGSFNDSR+N+TLA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 240 VTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRI 299
           +TA+ENGAT+LNY+EV++L+K+P +GKV GA A D ET +   + AK VV+ATGP+SD I
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 300 LQMENHPKGLPDDLSLSKANEGATITT---KVAVADPKMVVPSSGVHIILPSFYCPKDMG 356
           LQM+ +  G P+    S  N+ + I +   +VAV DP+MV+PS GVHI+LPSFYCPKD+G
Sbjct: 181 LQMDRNASGQPN----SPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIG 236

Query: 357 LLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVK 416
           LLD  TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQDILKELQHYI+FPVK
Sbjct: 237 LLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVK 296

Query: 417 REDVQSAWAGIRPLVKDPR------KDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYRE 470
           REDV SAWAG+RPLV+DPR      K  S TQ +VRSHFLFTSD+GL+TI+GGKWTTYR+
Sbjct: 297 REDVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQ 356

Query: 471 MAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNLPPVLSEYLSENY 530
           MA+ETID+VV+VG F N KPC TR IKL G+E W  N  A+L+Q Y+L   +S YL ENY
Sbjct: 357 MAEETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENY 416

Query: 531 GTKAAAICEIFQSDKRNQLPVSLA--------AEKAAANVDYDAFRYPFTVGELKYNIRN 582
           GT+++ ICE F+    N+LP+SLA        + +    V++D FRYPFT+GELKY+++ 
Sbjct: 417 GTRSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQY 476

Query: 583 EYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTF 642
           EY R PLDFL+RRTR+AFLDAK+A+ +V  TVK+MGDE  W   KR+ E +  + FIKTF
Sbjct: 477 EYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTF 536

Query: 643 GV 644
           GV
Sbjct: 537 GV 538

>Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR410W
           (REAL)
          Length = 1144

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 345 ILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVP 390
           +L  F CPK+ G+LDAE  D  ++  LP   ++L    D+  ++ P
Sbjct: 935 VLFDFICPKEYGILDAEKLDIGLLTSLPLAKQILNDIGDMKNRETP 980

>Skud_12.494 Chr12 (877731..881177) [3447 bp, 1148 aa] {ON} YLR410W
           (REAL)
          Length = 1148

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 345 ILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVP 390
           +L  F CPK+ G+ DAE  D  ++  LP   ++L    D+  ++ P
Sbjct: 938 VLFDFICPKEYGISDAEKLDIGLLTSLPLAKQILNDIGDMKNRETP 983

>Skud_6.53 Chr6 complement(103908..105407) [1500 bp, 499 aa] {ON}
           YFL018C (REAL)
          Length = 499

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 77  DVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTS 114
           DV++IGGG +G  +A+ AA  G N A +E      GT 
Sbjct: 28  DVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTC 65

>YLR410W Chr12 (937541..940981) [3441 bp, 1146 aa] {ON}
           VIP1Inositol hexakisphosphate (IP6) and inositol
           heptakisphosphate (IP7) kinase; IP7 production is
           important for phosphate signaling; involved in cortical
           actin cytoskeleton function, and invasive pseudohyphal
           growth analogous to S. pombe asp1
          Length = 1146

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 345 ILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVP 390
           +L  F CPK+ G+ DAE  D  ++  LP   ++L    D+  ++ P
Sbjct: 937 VLFDFICPKEYGISDAEKLDIGLLTSLPLAKQILNDIGDMKNRETP 982

>CAGL0F01947g Chr6 complement(189377..190858) [1482 bp, 493 aa] {ON}
           highly similar to uniprot|P09624 Saccharomyces
           cerevisiae YFL018c LPD1 dihydrolipoamide dehydrogenase
           precursor
          Length = 493

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 75  QFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGT 113
           Q D+++IGGG  G  +A+ AA  GL+ A +E      GT
Sbjct: 22  QHDLVIIGGGPGGYVAAIKAAQLGLDTACIEKRGSLGGT 60

>Smik_6.60 Chr6 complement(115090..116589) [1500 bp, 499 aa] {ON}
           YFL018C (REAL)
          Length = 499

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 77  DVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTS 114
           DV++IGGG +G  +A+ AA  G N A +E      GT 
Sbjct: 28  DVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTC 65

>Suva_6.41 Chr6 complement(74641..76140) [1500 bp, 499 aa] {ON}
           YFL018C (REAL)
          Length = 499

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 77  DVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTS 114
           DV++IGGG +G  +A+ AA  G N A +E      GT 
Sbjct: 28  DVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTC 65

>YFL018C Chr6 complement(101628..103127) [1500 bp, 499 aa] {ON}
           LPD1Dihydrolipoamide dehydrogenase, the lipoamide
           dehydrogenase component (E3) of the pyruvate
           dehydrogenase and 2-oxoglutarate dehydrogenase
           multi-enzyme complexes
          Length = 499

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 77  DVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTS 114
           DV++IGGG +G  +A+ AA  G N A +E      GT 
Sbjct: 28  DVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGTC 65

>KLLA0D11154g Chr4 (952049..953530) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P09624 Saccharomyces cerevisiae
           YFL018C LPD1 Dihydrolipoamide dehydrogenase the
           lipoamide dehydrogenase component (E3) of the pyruvate
           dehydrogenase and 2-oxoglutarate dehydrogenase multi-
           enzyme complexes
          Length = 493

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 73  TDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTS 114
           T + D++VIGGG  G  +A+ AA  G +VA +E      GT 
Sbjct: 20  TKKHDLVVIGGGPGGYVAAIKAAQLGYDVACVEKRGRLGGTC 61

>Suva_10.225 Chr10 complement(415805..416683) [879 bp, 292 aa] {ON}
           YLR132C (REAL)
          Length = 292

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 53/124 (42%), Gaps = 12/124 (9%)

Query: 177 PYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLV-YHDGSFNDSRMN 235
           P  Y+  K    F G   L  S   S+T  S   P+++ +  K+G++ Y     + S  +
Sbjct: 177 PKLYMSEKANALFLG---LPISECSSSTHLSSFTPIIENALQKSGILNYEQLIVSPSSFH 233

Query: 236 STLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPF 295
            ++A+T+  + ATL NY ++ ++         E  + ++ E   Q  V    +       
Sbjct: 234 MSIAMTSHPSRATLQNYQQLNEV--------TEAIMLINNELTYQPPVLINSIYCDENRH 285

Query: 296 SDRI 299
           S RI
Sbjct: 286 STRI 289

>NCAS0B01610 Chr2 complement(262494..264524) [2031 bp, 676 aa] {ON}
           Anc_8.671 YOR243C
          Length = 676

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 3/86 (3%)

Query: 503 NWDPNLPAILSQQYNLPPVLSEYLSENYGTKAAAICEI---FQSDKRNQLPVSLAAEKAA 559
           NW+  +  ILS Q N+ P+  E       TK AA+       QS   N +  SL+ +K  
Sbjct: 365 NWEKAVELILSDQENVLPISKEARQIWAQTKDAALALKKMPRQSIAENSILHSLSNQKKE 424

Query: 560 ANVDYDAFRYPFTVGELKYNIRNEYA 585
            + +Y +F Y   + ++  N+R  Y 
Sbjct: 425 DDGNYSSFAYYSAIMQIPRNLRTMYV 450

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,271,217
Number of extensions: 2716498
Number of successful extensions: 8061
Number of sequences better than 10.0: 59
Number of HSP's gapped: 8209
Number of HSP's successfully gapped: 59
Length of query: 644
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 528
Effective length of database: 40,180,143
Effective search space: 21215115504
Effective search space used: 21215115504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)