Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_40095.712ON1517151773600.0
AFR296C5.712ON116944216130.0
SAKL0E15136g5.712ON103744913831e-169
KLLA0A00396g5.712ON101244013721e-167
KLTH0E00814g5.712ON97447613371e-163
Kwal_55.196455.712ON97044713341e-162
NDAI0F002005.712ON110549912741e-152
NCAS0G001705.712ON103045612591e-151
TDEL0B020805.712ON102543912491e-150
CAGL0H06721g5.712ON108145112481e-149
TPHA0D046605.712ON104543612361e-147
TBLA0E017605.712ON121250012361e-146
Kpol_2001.785.712ON40340811341e-141
KNAG0L022005.712ON116148911951e-141
YIL156W (UBP7)5.712ON107149911761e-139
Smik_9.135.712ON106050411741e-138
Skud_9.125.712ON106448411741e-138
Suva_9.305.712ON106248311681e-138
Suva_11.3355.712ON72444810741e-128
Skud_11.3385.712ON71244810621e-127
Smik_11.3625.712ON72144210501e-125
YKR098C (UBP11)5.712ON71744410411e-124
KAFR0D021605.712ON8464349751e-113
KAFR0H001505.712ON6564658631e-100
CAGL0G02563gsingletonON6314648397e-97
ZYRO0B16544g5.712ON10442476571e-69
Kpol_304.65.712ON5624765301e-56
KNAG0D019308.188ON9864473394e-31
Skud_4.3238.188ON9264453261e-29
Suva_2.2288.188ON9274453109e-28
YDR069C (DOA4)8.188ON9264603091e-27
Ecym_61848.188ON8514522955e-26
KAFR0C025908.188ON9784412947e-26
SAKL0H18986g8.188ON8934592948e-26
YER144C (UBP5)8.188ON8054502751e-23
Suva_5.2728.188ON7884782732e-23
AFR007W8.188ON8484192723e-23
Skud_5.2818.188ON8234572696e-23
NCAS0A039108.188ON7954542633e-22
NDAI0C059008.188ON8264562562e-21
TDEL0B042208.188ON8252662527e-21
TBLA0F036108.188ON11442432393e-19
Kpol_1032.288.188ON8822632303e-18
TPHA0C027708.188ON9702402241e-17
ZYRO0G06798g8.188ON8772402213e-17
Smik_4.3078.188ON9292342026e-15
CAGL0G05247g8.188ON9472572001e-14
Smik_5.3098.188ON8052431991e-14
KLTH0H07678g8.188ON8612441972e-14
NDAI0A036808.188ON11162911945e-14
NCAS0B042808.188ON9222391911e-13
KLLA0E10275g8.188ON7962431864e-13
Kwal_14.20088.188ON4242461809e-13
CAGL0I06765g8.188ON8871491775e-12
KNAG0G015908.188ON6714371604e-10
ABL145W2.69ON7492841534e-09
TBLA0B097602.69ON8982891525e-09
ZYRO0B03300g7.390ON8131291419e-08
ZYRO0C17908g1.137ON12042161392e-07
Smik_2.497.390ON7451221382e-07
Skud_10.221.137ON12552221355e-07
Suva_2.507.390ON7501221345e-07
KLLA0C06974g8.742ON4464281336e-07
KNAG0C035807.390ON7761231346e-07
SAKL0C04246g1.137ON12971391347e-07
YBL067C (UBP13)7.390ON7471231311e-06
TPHA0P006807.390ON7271551311e-06
Skud_2.387.390ON7481201302e-06
Suva_6.2761.137ON12562271293e-06
YJL197W (UBP12)1.137ON12542161283e-06
Smik_10.371.137ON12472241275e-06
NCAS0E026107.390ON7171311266e-06
TDEL0C056401.137ON11782061266e-06
NCAS0A143707.390ON7291221256e-06
CAGL0L01639g1.137ON11472171257e-06
KLLA0D08459g2.69ON7502781241e-05
Kpol_1024.448.540ON4962161221e-05
NDAI0A016707.390ON8461301222e-05
NDAI0E041807.390ON8271321203e-05
KNAG0B023707.390ON7531201193e-05
NCAS0I031401.137ON12012111185e-05
TPHA0E008707.390ON715931185e-05
CAGL0A04477g7.390ON7701261185e-05
TPHA0A025401.137ON12862071185e-05
AFR627C1.137ON12871971177e-05
ZYRO0D03982g8.540ON8212211177e-05
CAGL0I05522g7.390ON7241341159e-05
NCAS0C021108.540ON4942211159e-05
KLLA0C03476g1.137ON12522151151e-04
NDAI0F034102.69ON8701371151e-04
YER098W (UBP9)7.390ON7541291141e-04
Ecym_46857.390ON7781361141e-04
TBLA0J006001.137ON14621291142e-04
Ecym_81401.137ON12642011132e-04
Suva_5.2177.390ON7541311113e-04
Smik_5.2447.390ON7491291113e-04
NDAI0B004801.137ON12532031113e-04
KAFR0F015601.137ON11712081114e-04
Kpol_2001.541.137ON12232071114e-04
KNAG0C021801.137ON12312231105e-04
Skud_5.2237.390ON7481291087e-04
ZYRO0A05962g8.742ON4651081077e-04
TBLA0D010708.742ON4834281069e-04
KLTH0F03674g1.137ON11981311060.001
NCAS0D023905.18ON12111051060.001
NCAS0D006001.369ON493951040.002
TPHA0L022905.18ON11931271050.002
TBLA0C012001.369ON503321030.003
KNAG0A019708.540ON4711621000.004
Kwal_33.136281.137ON11601291010.004
ZYRO0G01606g5.443ON1305441010.005
Kpol_534.231.369ON496861000.005
Kpol_1045.417.390ON7121311000.006
Kpol_378.4singletonON559227990.006
KNAG0E012905.18ON11961201000.007
CAGL0K10494g1.369ON495107990.007
Kpol_1018.937.390ON755127990.007
AEL242W8.540ON61387980.009
KAFR0L017307.390ON70132980.009
CAGL0M13783g5.18ON1196118970.013
YMR223W (UBP8)8.742ON471148960.014
TDEL0C015707.390ON76550970.015
TBLA0C070205.18ON1247251960.018
TPHA0A025101.369ON50594950.019
KNAG0C019401.369ON499100950.021
YMR304W (UBP15)5.18ON123094960.021
SAKL0H04994g8.742ON454137950.021
Ecym_27171.369ON48395940.024
Kpol_513.255.18ON1190125950.025
Suva_13.4955.18ON123094950.025
Skud_13.3928.742ON473263940.027
TPHA0J026205.443ON122532940.033
ZYRO0G01188g1.369ON50030930.033
KNAG0G029308.742ON459179930.033
SAKL0F12430g7.390ON754124940.034
Kwal_26.91518.742ON454104930.035
Smik_13.4318.742ON471143930.035
Skud_13.4785.18ON123194930.039
YDR420W (HKR1)5.524ON1802189930.040
SAKL0G02728g5.443ON123731930.040
Smik_13.5215.18ON123194930.041
NCAS0A038408.202ON917159930.042
YPL072W (UBP16)8.540ON499243920.046
ZYRO0C09812g2.69ON702230920.052
Suva_13.4078.742ON471117910.058
KLLA0E20351g7.390ON69749920.058
NDAI0I025305.18ON119791920.060
ZYRO0D07062g5.18ON1193119920.061
TBLA0B019308.202ON1019164910.065
Ecym_62488.742ON466105900.076
Kwal_34.162681.369ON44994900.081
NDAI0H035501.369ON50232900.084
KAFR0K018107.390ON71427900.086
TBLA0D006207.390ON1171120900.087
AGR139C8.202ON789164900.090
YFR010W (UBP6)1.369ON49943890.091
KAFR0A042108.742ON440102890.10
Suva_6.831.369ON50034890.11
Ecym_11668.540ON69687890.12
Skud_6.941.369ON49931890.12
ACL164C5.443ON138931890.12
SAKL0D10120g1.369ON49230880.13
TDEL0D024001.369ON49429880.13
Smik_7.3141.369ON49943880.13
KLTH0B09944g5.18ON1189119890.13
Ecym_56715.18ON1176105890.14
TDEL0D025805.443ON127230890.14
NDAI0C015505.443ON129531880.15
KLLA0A10791g1.369ON48430870.16
Suva_8.1765.443ON127031880.16
TDEL0B030608.540ON734217880.16
KLLA0E23387g8.540ON78292880.17
Ecym_45145.443ON124627880.17
TDEL0G004105.18ON1186119880.17
Skud_15.2865.443ON127830880.18
NCAS0H021005.443ON126929880.18
SAKL0H10076g8.540ON76781870.18
TPHA0E017105.443ON128327870.19
Kwal_26.95985.18ON1191188870.21
KAFR0D050705.443ON122732870.21
Smik_15.3015.443ON127230870.21
Kwal_55.213935.443ON123330870.23
KNAG0J008003.270ON76520860.24
TBLA0A064705.443ON132029870.24
YOR124C (UBP2)5.443ON127230870.25
AGR370W7.390ON74027860.26
Kpol_1062.235.443ON126626860.27
CAGL0M11198g8.742ON461105850.27
CAGL0K10252g5.443ON126726860.28
KNAG0B041905.443ON126230860.29
KLTH0D12760g8.742ON453130850.29
AGL357W5.18ON1166113860.31
KAFR0I026005.18ON121338860.31
KLLA0E02377g5.443ON122036860.33
KLTH0F15862g5.443ON124127860.33
NCAS0B005808.742ON466104850.33
KAFR0E009308.540ON498218840.37
KLTH0H13354g1.369ON49531840.39
KLLA0F18700g3.270ON77074840.42
TDEL0B036708.742ON463106840.43
KAFR0A069102.307ON678248840.46
KAFR0C045201.369ON49930830.56
ZYRO0F01276g3.270ON77621830.60
TDEL0D035503.270ON780174830.68
Kpol_1016.15.443ON125126830.69
SAKL0H00418g5.18ON119028830.72
Kpol_1064.488.742ON466183820.78
NDAI0E008108.742ON493113810.87
KLTH0E12540g8.540ON75287810.91
KNAG0I028706.333ON105287811.1
Skud_16.2098.540ON503121801.1
CAGL0H10186g3.270ON77821811.1
Kpol_219.1singletonON24981781.3
CAGL0H05335g8.540ON483163801.3
NCAS0I016203.270ON79520792.0
TPHA0O016402.69ON74637782.4
AFR551W8.742ON469148772.5
KLTH0C06732g7.390ON71485772.7
Klac_YGOB_Anc_5.18b5.18ON116699772.9
TDEL0G023702.307ON747199773.1
TBLA0H036008.540ON482388754.8
TBLA0E025703.270ON78521755.0
Skud_8.392.496ON92393755.4
Smik_2.1893.270ON78243746.9
Ecym_55448.202ON834161747.2
YNL186W (UBP10)2.69ON79237747.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_4009
         (1517 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...  2839   0.0  
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   625   0.0  
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   537   e-169
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   533   e-167
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   519   e-163
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   518   e-162
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     495   e-152
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     489   e-151
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   485   e-150
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   485   e-149
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   480   e-147
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   480   e-146
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   441   e-141
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   464   e-141
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   457   e-139
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   456   e-138
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   456   e-138
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   454   e-138
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   418   e-128
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   413   e-127
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   409   e-125
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   405   e-124
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   380   e-113
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   337   e-100
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   327   7e-97
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   257   1e-69
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   208   1e-56
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   135   4e-31
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   130   1e-29
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   124   9e-28
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...   123   1e-27
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   118   5e-26
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   117   7e-26
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...   117   8e-26
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   110   1e-23
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...   109   2e-23
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   109   3e-23
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...   108   6e-23
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188    105   3e-22
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...   103   2e-21
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   101   7e-21
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    97   3e-19
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    93   3e-18
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    91   1e-17
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    90   3e-17
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...    82   6e-15
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    82   1e-14
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    81   1e-14
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    80   2e-14
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              79   5e-14
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     78   1e-13
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...    76   4e-13
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    74   9e-13
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    73   5e-12
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    66   4e-10
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    64   4e-09
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    63   5e-09
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    59   9e-08
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    58   2e-07
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    58   2e-07
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    57   5e-07
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    56   5e-07
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    56   6e-07
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    56   6e-07
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    56   7e-07
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    55   1e-06
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    55   1e-06
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    55   2e-06
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    54   3e-06
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    54   3e-06
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    54   5e-06
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    53   6e-06
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    53   6e-06
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    53   6e-06
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    53   7e-06
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    52   1e-05
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    52   1e-05
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    52   2e-05
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    51   3e-05
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    50   3e-05
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    50   5e-05
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    50   5e-05
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    50   5e-05
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    50   5e-05
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    50   7e-05
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    50   7e-05
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    49   9e-05
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    49   9e-05
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    49   1e-04
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    49   1e-04
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    49   1e-04
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    49   1e-04
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    49   2e-04
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    48   2e-04
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    47   3e-04
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    47   3e-04
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    47   3e-04
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    47   4e-04
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    47   4e-04
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    47   5e-04
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    46   7e-04
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    46   7e-04
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    45   9e-04
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    45   0.001
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    45   0.001
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    45   0.002
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    45   0.002
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    44   0.003
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    43   0.004
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    44   0.004
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    44   0.005
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    43   0.005
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    43   0.006
Kpol_378.4 s378 (18665..20344) [1680 bp, 559 aa] {ON} (18665..20...    43   0.006
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    43   0.007
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    43   0.007
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    43   0.007
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    42   0.009
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    42   0.009
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    42   0.013
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    42   0.014
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    42   0.015
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    42   0.018
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    41   0.019
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    41   0.021
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    42   0.021
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    41   0.021
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    41   0.024
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    41   0.025
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    41   0.025
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    41   0.027
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    41   0.033
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    40   0.033
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    40   0.033
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    41   0.034
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    40   0.035
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    40   0.035
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    40   0.039
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...    40   0.040
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    40   0.040
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    40   0.041
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    40   0.042
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    40   0.046
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    40   0.052
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    40   0.058
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    40   0.058
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    40   0.060
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    40   0.061
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    40   0.065
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    39   0.076
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    39   0.081
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    39   0.084
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    39   0.086
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    39   0.087
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    39   0.090
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    39   0.091
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    39   0.10 
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    39   0.11 
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    39   0.12 
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    39   0.12 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    39   0.12 
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    39   0.13 
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    39   0.13 
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    39   0.13 
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    39   0.13 
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    39   0.14 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    39   0.14 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    39   0.15 
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    38   0.16 
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    39   0.16 
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    39   0.16 
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    39   0.17 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    39   0.17 
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    39   0.17 
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    39   0.18 
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    39   0.18 
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    38   0.18 
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    38   0.19 
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    38   0.21 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    38   0.21 
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    38   0.21 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    38   0.23 
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    38   0.24 
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    38   0.24 
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    38   0.25 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    38   0.26 
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    38   0.27 
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    37   0.27 
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    38   0.28 
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    38   0.29 
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    37   0.29 
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    38   0.31 
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    38   0.31 
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    38   0.33 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    38   0.33 
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       37   0.33 
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    37   0.37 
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    37   0.39 
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    37   0.42 
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    37   0.43 
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    37   0.46 
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    37   0.56 
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    37   0.60 
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    37   0.68 
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    37   0.69 
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    37   0.72 
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    36   0.78 
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    36   0.87 
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    36   0.91 
KNAG0I02870 Chr9 (558973..562131) [3159 bp, 1052 aa] {ON} Anc_6....    36   1.1  
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    35   1.1  
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    36   1.1  
Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,...    35   1.3  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    35   1.3  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    35   2.0  
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    35   2.4  
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    34   2.5  
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    34   2.7  
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    34   2.9  
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    34   3.1  
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    33   4.8  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    33   5.0  
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    33   5.4  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    33   6.9  
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    33   7.2  
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    33   7.2  

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 2839 bits (7360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1402/1517 (92%), Positives = 1402/1517 (92%)

Query: 1    MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60
            MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV
Sbjct: 1    MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60

Query: 61   EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120
            EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS
Sbjct: 61   EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120

Query: 121  VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE 180
            VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE
Sbjct: 121  VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE 180

Query: 181  QGAFGQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAA 240
            QGAFGQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAA
Sbjct: 181  QGAFGQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAA 240

Query: 241  EFSVLDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYPIC 300
            EFSVLDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYPIC
Sbjct: 241  EFSVLDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYPIC 300

Query: 301  NDGVVPCENSSIMWLYESSSIKCLDLLSKLTSSERSSMLLIDLRLPKRYEYSHILAENVI 360
            NDGVVPCENSSIMWLYESSSIKCLDLLSKLTSSERSSMLLIDLRLPKRYEYSHILAENVI
Sbjct: 301  NDGVVPCENSSIMWLYESSSIKCLDLLSKLTSSERSSMLLIDLRLPKRYEYSHILAENVI 360

Query: 361  NIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTDNYTYMQIDXXXXXXX 420
            NIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTDNYTYMQID       
Sbjct: 361  NIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTDNYTYMQIDFDFVFLL 420

Query: 421  XXXXXXGRPQLVLKTLSGGYEQWKSFLKELKRTESIILSDFLWKRPHKNEHSNDIVIASG 480
                  GRPQLVLKTLSGGYEQWKSFLKELKRTESIILSDFLWKRPHKNEHSNDIVIASG
Sbjct: 421  FRLLYLGRPQLVLKTLSGGYEQWKSFLKELKRTESIILSDFLWKRPHKNEHSNDIVIASG 480

Query: 481  EPSDSNNSKSFPPSLVENSIPAFQSDHKPIAQQSSVGIEPIHRFSSVSTYSKXXXXXXXX 540
            EPSDSNNSKSFPPSLVENSIPAFQSDHKPIAQQSSVGIEPIHRFSSVSTYSK        
Sbjct: 481  EPSDSNNSKSFPPSLVENSIPAFQSDHKPIAQQSSVGIEPIHRFSSVSTYSKPVVPPPIP 540

Query: 541  XTRPLLNPATNPLSQYCSQMLVNAVKPPSTNENSVSQSHLSTTPDAKSVSQSNLSTTPDA 600
             TRPLLNPATNPLSQYCSQMLVNAVKPPSTNENSVSQSHLSTTPDAKSVSQSNLSTTPDA
Sbjct: 541  VTRPLLNPATNPLSQYCSQMLVNAVKPPSTNENSVSQSHLSTTPDAKSVSQSNLSTTPDA 600

Query: 601  KSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVS 660
            KSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVS
Sbjct: 601  KSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVS 660

Query: 661  QSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSHL 720
            QSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSHL
Sbjct: 661  QSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSHL 720

Query: 721  SSTPDAKSVSQSNLSATPESNLSATPDANSASQSNLSNTPDAKXXXXXXXXXXXXPMXXX 780
            SSTPDAKSVSQSNLSATPESNLSATPDANSASQSNLSNTPDAK            PM   
Sbjct: 721  SSTPDAKSVSQSNLSATPESNLSATPDANSASQSNLSNTPDAKSVSHVSITTTTVPMVLP 780

Query: 781  XXXXXXXXXXXXFENNRADSSLSSTRETNETVPLPLQTVRNSGSIPFYPVVQDNKPTLSA 840
                        FENNRADSSLSSTRETNETVPLPLQTVRNSGSIPFYPVVQDNKPTLSA
Sbjct: 781  PIPVTRPLIPPPFENNRADSSLSSTRETNETVPLPLQTVRNSGSIPFYPVVQDNKPTLSA 840

Query: 841  IFSDEKLTSQSIVNHXXXXXXXXXXXXXXHKGIMPVKTVEHDCDTSXXXXXXXXXXXXVS 900
            IFSDEKLTSQSIVNH              HKGIMPVKTVEHDCDTS            VS
Sbjct: 841  IFSDEKLTSQSIVNHDDDDGTSSKSVSSSHKGIMPVKTVEHDCDTSPLPNLLPKIPKIVS 900

Query: 901  SVENINSGLXXXXXXXXXXXXXXHNIKYSKFNMSQXXXXXXXXXXXXSNTVSTFHVPLAP 960
            SVENINSGL              HNIKYSKFNMSQ            SNTVSTFHVPLAP
Sbjct: 901  SVENINSGLSQFVSASSSRPVSSHNIKYSKFNMSQPPIPITKPLLTPSNTVSTFHVPLAP 960

Query: 961  SSIPIRATTITASQSSHPNYMASQKRMELFESGSVRSVTTSKYPLPLVNPIHDPAQVAST 1020
            SSIPIRATTITASQSSHPNYMASQKRMELFESGSVRSVTTSKYPLPLVNPIHDPAQVAST
Sbjct: 961  SSIPIRATTITASQSSHPNYMASQKRMELFESGSVRSVTTSKYPLPLVNPIHDPAQVAST 1020

Query: 1021 QRTEIYDNIWRALDRRSERRNHRSNAYASAYRKNSSISHKGADRSPEETNNIKVDGHKLI 1080
            QRTEIYDNIWRALDRRSERRNHRSNAYASAYRKNSSISHKGADRSPEETNNIKVDGHKLI
Sbjct: 1021 QRTEIYDNIWRALDRRSERRNHRSNAYASAYRKNSSISHKGADRSPEETNNIKVDGHKLI 1080

Query: 1081 RNPIPHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAH 1140
            RNPIPHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAH
Sbjct: 1081 RNPIPHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAH 1140

Query: 1141 YLKSPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXX 1200
            YLKSPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQ     
Sbjct: 1141 YLKSPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLF 1200

Query: 1201 XXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQ 1260
                     SSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQ
Sbjct: 1201 LLDKLHDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQ 1260

Query: 1261 MENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQN 1320
            MENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQN
Sbjct: 1261 MENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQN 1320

Query: 1321 AWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSK 1380
            AWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSK
Sbjct: 1321 AWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSK 1380

Query: 1381 LSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVA 1440
            LSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVA
Sbjct: 1381 LSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVA 1440

Query: 1441 KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIA 1500
            KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIA
Sbjct: 1441 KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIA 1500

Query: 1501 SVSSSNVYVLFYERIFD 1517
            SVSSSNVYVLFYERIFD
Sbjct: 1501 SVSSSNVYVLFYERIFD 1517

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/442 (69%), Positives = 349/442 (78%), Gaps = 12/442 (2%)

Query: 1086 HFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSP 1145
            HFS+PTIE + NEY+ALSITGLRNMSNTCYINSMLQCLFST+ FRNLFLSNKY+ YLKS 
Sbjct: 727  HFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSS 786

Query: 1146 EMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXX 1205
             MD MSRSFYMLF+KMYMNGGCSVVPSGFLKMC+ LKPDLRIP+GQQDTQ          
Sbjct: 787  NMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLFLLDRL 846

Query: 1206 XXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQL 1265
                S + +V NDY  LLLH++  L V+D +Y  WFDQN ++NGLSPID +FQGQ+E+QL
Sbjct: 847  RDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQL 906

Query: 1266 SCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCP 1325
            SCQRC +SSY+YSTFYVLSLALPNP +KAFGK KKLRLEDCINFFTCDEVL+ QN WDCP
Sbjct: 907  SCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNPWDCP 966

Query: 1326 RCC--SPSDYMSYDHKGKR--KISTSFESLNGGNSSRS---KLFKFGYKMRSRSE----- 1373
            +C   S  D      K KR  K     E+ N  NS+R    +LFK G K RSRS      
Sbjct: 967  KCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLFKIGSKSRSRSSSPFIS 1026

Query: 1374 APKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV 1433
             PK S K  +K  N K AT+KSLNFIT+PRIL+IHLSRF+YDLTKKNN VV+YPLILNIV
Sbjct: 1027 GPKSSGKTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIV 1086

Query: 1434 LKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHG 1493
            LKN+EVAK+RLYS +NHFGTLISGHYTSLVNK+L HEI  GKQKWYYFDDEIVK D NHG
Sbjct: 1087 LKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHG 1146

Query: 1494 DYDNGIASVSSSNVYVLFYERI 1515
            +YD GI SVSSS+VY+LFYERI
Sbjct: 1147 NYDRGITSVSSSDVYLLFYERI 1168

 Score =  190 bits (482), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 98/210 (46%), Positives = 135/210 (64%), Gaps = 10/210 (4%)

Query: 1   MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60
           M  PY+PEYS EL+ FV+E Y + +++ Y +LR EKL+DLLE  A L ESY++L+  GQ 
Sbjct: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60

Query: 61  EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120
             G+ AYV+GAFYLYLIIPQSIEFHTRNLSYS+Y DL++HYE +PNM NV+ +V  KV +
Sbjct: 61  REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120

Query: 121 VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE 180
           V+ L  + E  E+   +   RKRAYS+     ++ +D+L  L+++     G     G   
Sbjct: 121 VL-LRQTPEDGERGDTKLY-RKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIP 178

Query: 181 QGAFGQQQQDDEWEDTVWSAPNLEPDDQLK 210
           + A           DT+WSAP LE +D L+
Sbjct: 179 EVAVQ--------ADTLWSAPKLEENDLLR 200

 Score =  158 bits (399), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 120/201 (59%), Gaps = 2/201 (0%)

Query: 265 DSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYPICNDGVVPCENSS-IMWLYESSSIKC 323
           ++  NK N E  ++      LDR +    +   P  N      E+ + +  LYE+SSIKC
Sbjct: 394 NAGQNKYNQE-SAVSFEQQELDRPHNSRVEPYNPFANGNAAGLESCNPLTRLYETSSIKC 452

Query: 324 LDLLSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELE 383
            DL+  L S  +  +L IDLR PKRYE +HI+A ++INIDP LLWD E+ AP++SV E E
Sbjct: 453 SDLMIILESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFE 512

Query: 384 LVIDNHLFRSRRQFATIVCYTDNYTYMQIDXXXXXXXXXXXXXGRPQLVLKTLSGGYEQW 443
             +DN LF +R QF+ +VCYTDN+T M +D             G+P+L+ K L GGY+QW
Sbjct: 513 RRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLLTKCLQGGYDQW 572

Query: 444 KSFLKELKRTESIILSDFLWK 464
           + +LK   ++    +SDF+W+
Sbjct: 573 RLYLKTNTKSIHAKISDFMWR 593

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
            {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  537 bits (1383), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 275/449 (61%), Positives = 324/449 (72%), Gaps = 14/449 (3%)

Query: 1083 PIPH--FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAH 1140
            PI H   S+PTIE S N YV+LSITGLRN+ +TCYINSMLQCLF+T  FR++FLS KY  
Sbjct: 589  PISHQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHD 648

Query: 1141 YLKSPEMD--TMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXX 1198
            Y+    +    +SRSF+MLF+KMYMNGGCSVVPSGFLK CN+++PD +IP  QQDTQ   
Sbjct: 649  YISKGYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFL 708

Query: 1199 XXXXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQ 1258
                       S  E V+NDY  LLLHD+  L VD  +Y+KWF+ +I +NGLSPID +FQ
Sbjct: 709  LFLLDQLHDELSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQ 768

Query: 1259 GQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSD 1318
            GQMEN L CQRCG+SSY YSTFYVLSLA+P P    FGKTKK+ LEDCIN FT DEVLS 
Sbjct: 769  GQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSG 828

Query: 1319 QNAWDCPRC---CSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAP 1375
            +NAWDCPRC    S S       K KRK     + +N   +SR   F+   + RS S   
Sbjct: 829  ENAWDCPRCGTSMSGSGPGEGKAKKKRKFLLPHDHVNNNRTSRFFKFRSKSRSRSSSPFN 888

Query: 1376 KFSSKL-------SDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPL 1428
              +          S+K  + K  T+K+ NFITMP ILVIHLSRF YDLTKKN+ V++YPL
Sbjct: 889  SSNGHNSGSSMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPL 948

Query: 1429 ILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKF 1488
            ILNIVLKN+EVAK+RLY IVNHFG LISGHYTSLVNK+L HEI HG+QKWYYFDDE+VK 
Sbjct: 949  ILNIVLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQ 1008

Query: 1489 DTNHGDYDNGIASVSSSNVYVLFYERIFD 1517
            D NHGD+D GIASVSSS+VYVLFYERI+D
Sbjct: 1009 DNNHGDFDAGIASVSSSDVYVLFYERIYD 1037

 Score =  262 bits (669), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 184/493 (37%), Positives = 276/493 (55%), Gaps = 41/493 (8%)

Query: 1   MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60
           ME  Y PEYS EL QFV++VY ++++  Y KL+LEKLIDLLEH  YL ESY  +L +G  
Sbjct: 1   MECSYTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQ 60

Query: 61  EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120
           E  +TA+++G+FY+YLIIPQSI+FHTRN SY IYVDL+++Y+ + +M NV+L+V  KV +
Sbjct: 61  EDALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDA 120

Query: 121 VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE 180
           +  L  S + D+    + T RKRAYS+    S  LA+ L  L++  ++T G       ++
Sbjct: 121 I--LCKSRDFDD---TKIT-RKRAYSVP---SQALANQLRSLTL--NNTDGLEQLPEVSK 169

Query: 181 QGAFGQQQQDDEWEDTVWSAPNLEPDDQLKLAVS------YSHSPSIHDTSDSKTKDSGL 234
           +        DD    T+WSAP LEPDDQLKLA++       + S       D  +K   +
Sbjct: 170 ESDTLTNYADD--YTTIWSAPKLEPDDQLKLALNPPSKSSSATSSLSSFVMDQHSKKFSI 227

Query: 235 ENNSAAEFS--------VLDEEWVSERRSGFMSQSLQVDSSD--NKNNDELPSIGD-HND 283
             +S+ EF          +D    SE        S+ V S+D      D + S+ + +  
Sbjct: 228 GESSSDEFEPIPTQEALPMDHATPSEISQRTRHHSI-VSSNDTGKSRKDSVESVANIYVQ 286

Query: 284 VLDRFYTHGQDLRYPI--CNDGVVPCEN---SSIMWLYESSSIKCLDLLSKLTSSERSSM 338
            +DR+ TH +D  + +   N+     E     ++  L +   I C +L+  L S ER+++
Sbjct: 287 NVDRYNTHRKDSYHSVYMLNEDDDTNEYDFFQNLSRLQKQYVISCEELMDILQSDERNNV 346

Query: 339 LLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNH-LFRSRRQF 397
           LL+DLR+ KR+  +HI+A N+INIDP  LWD ++  P+SS  ELE  + ++  F+SR +F
Sbjct: 347 LLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKF 406

Query: 398 ATIVCYTDNYTYMQID---XXXXXXXXXXXXXGRPQLVLKTLSGGYEQWKSFLKELKRTE 454
             IV YTD  T++ ID                 R +   K L G YEQWK+F+ +  +  
Sbjct: 407 KYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKHH 466

Query: 455 SIILSDFLWKRPH 467
            I+  D+L+ RP+
Sbjct: 467 DIVTGDYLF-RPY 478

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  533 bits (1372), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 259/440 (58%), Positives = 325/440 (73%), Gaps = 11/440 (2%)

Query: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE 1146
            FSIPTIE S NE+V+LSITGLRNM NTCYINSMLQCLF  S FR+LFL  KY  YL    
Sbjct: 570  FSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR 629

Query: 1147 MDTM-SRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXX 1205
             +T+ S+ F +LFRKMY+NGGCSVVP+GFLK C+ L+PD  IP  QQDTQ          
Sbjct: 630  SNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLLDTL 689

Query: 1206 XXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQL 1265
                S    V+NDY +LLLHD+ +L VD+ +Y+KWFD+ +  NGLSPIDD+FQGQMEN L
Sbjct: 690  HDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSL 749

Query: 1266 SCQRCGYSSYTYSTFYVLSLALPN-PVAKAFGKTKKL-RLEDCINFFTCDEVLSDQNAWD 1323
             CQRCG++SY YSTFYVLSLA+P  P  K F ++KK+ RLEDCIN +T DE+L+ +NAWD
Sbjct: 750  KCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWD 809

Query: 1324 CPRCCSPSDY----MSYDHKGKRKISTSFESLNGGNSSRSKLFKFGY-KMRSRSEAPKFS 1378
            CP+C + S+     M+ D    +K   +F S+NG + SRSK FK    +   RS +P  S
Sbjct: 810  CPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHKSRSKFFKLSSSRSGKRSLSPFKS 869

Query: 1379 SKLSDK---VSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLK 1435
            + +  +   + + K  T+K+LNFITMP ILVIHLSRF YDLTKKN  +++YPLIL++VLK
Sbjct: 870  NSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLK 929

Query: 1436 NSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDY 1495
            N+E+A++RLY I+NHFG L+SGHYTSLVNK L+HEI  G+QKWYYFDDE+VK + NHGD+
Sbjct: 930  NNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDF 989

Query: 1496 DNGIASVSSSNVYVLFYERI 1515
            D GI S+SS +VYVLFYERI
Sbjct: 990  DRGITSISSGDVYVLFYERI 1009

 Score =  197 bits (500), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 163/491 (33%), Positives = 250/491 (50%), Gaps = 54/491 (10%)

Query: 1   MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60
           M   Y PEYS EL  FV+EVY ++++  Y KL+LEKLI+LLE    L ESYRE L   + 
Sbjct: 1   MSRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKY 60

Query: 61  EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120
           E  +  YV+G+FY++LIIP S++F  RN SYSIY DLK+ Y+ + NM NV+L+V  KV S
Sbjct: 61  EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS 120

Query: 121 VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE 180
           V+   +     +        RKRA+S++      +   L  L +  +             
Sbjct: 121 VLNQNMEILAKQHLDP---SRKRAFSVEE---PIIRYQLHNLQLNNAD------------ 162

Query: 181 QGAFGQQQQDDEWED---TVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENN 237
                Q+  DD+++    T W AP L+P+D+L LA++ S +     T  S      L+ N
Sbjct: 163 -----QKSVDDDYKSFASTEWKAPQLDPNDRLHLAIASSKT-----TESSSLNSISLDEN 212

Query: 238 SAAEFSVLDE-EWVSER------------RSGFMSQSLQVDSSDNKNNDELPSIGDHN-- 282
              E    D  + VS++            R+G + +  +  S   + + +L +  D +  
Sbjct: 213 LYKEQDDTDALDSVSDKLLGSIHKPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLM 272

Query: 283 ----DVLDRFYTHGQDLRYPI-CNDGVVPCENSS--IMWLYESSSIKCLDLLSKLTSSE- 334
               D  DR  TH +D  + +   D +    N S  +    + ++I C  L S L  +E 
Sbjct: 273 LENMDSFDRSRTHRKDSYHSVYLGDELEDLNNISTGLARHQQENTIDCFALFSLLKDAES 332

Query: 335 RSSMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSR 394
           R ++LLIDLRLPKR+E +H++A N++NIDP LL+D EKG  + S + L+ ++ N +    
Sbjct: 333 RENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKI 392

Query: 395 RQFATIVCYTDNYTYMQIDXXXXXXXXXXXXXGRPQLVLKTLSGGYEQWKSFLKELKRTE 454
            Q+  IV YTD  ++M +                   + K+L GGYEQWK+FL +  R  
Sbjct: 393 SQYDNIVYYTDYKSFMHLTFNYELILFELLFKKTGTAIPKSLLGGYEQWKAFLNKQLRDS 452

Query: 455 SIILSDFLWKR 465
               S FL+++
Sbjct: 453 EFDKSLFLFRK 463

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 974

 Score =  519 bits (1337), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 263/476 (55%), Positives = 340/476 (71%), Gaps = 20/476 (4%)

Query: 1057 ISHKGADRSPEETNNIKVDGHKLIRNPIP----------HFSIPTIENSYNEYVALSITG 1106
            +  + AD  P  + N   D +++ ++ +P          H +IPTIE S NEYVALSITG
Sbjct: 498  VQAQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSITG 557

Query: 1107 LRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL--KSPEMDTMSRSFYMLFRKMYMN 1164
            LRN+  TCY+NSMLQCLF+T AFR+LFLS KY HY   K    + +S+ F +LF+KMYMN
Sbjct: 558  LRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYMN 617

Query: 1165 GGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESVSNDYSHLLL 1224
            GGCSVVP+GFLK CN L+PD RIP+ QQDTQ              S    V+NDY  LLL
Sbjct: 618  GGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGLLL 677

Query: 1225 HDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLS 1284
            HD+ +L VD  +Y+ WF+++I +NG+SPID++FQGQMEN L CQRCG+SS+ YS FYVLS
Sbjct: 678  HDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLS 737

Query: 1285 LALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRC-CSPSDYMSYDHKGKRK 1343
            LA+P+  +  F + KK+RLEDCIN FT DE L+++NAWDCP+C  S S     + K K++
Sbjct: 738  LAIPSSTS-TFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGTGPEEEKKKKR 796

Query: 1344 ISTSFESLNGGNSSRSKLFKFGYKMRSRSEAP--KFSSKLS--DKVSNGKPATVKSLNFI 1399
               + ++   GN  RS+ FK   K RSRS +P  K SS+    +K+ + K  T+K+LNFI
Sbjct: 797  FLLNPDTRASGN--RSRFFKLRSKSRSRSVSPFRKQSSQQQNLEKLKSKKLTTIKTLNFI 854

Query: 1400 TMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHY 1459
            ++P +L IHLSRF YDLTKKNN V++YPLIL+IVLKN ++ K+RLY+I NHFG LISGHY
Sbjct: 855  SLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHY 914

Query: 1460 TSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYERI 1515
            TSLVNK+L+H+++ GKQKWYYFDDE VK D NHGD D GI S+SSS+VYVLFYE+I
Sbjct: 915  TSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970

 Score =  254 bits (650), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 173/463 (37%), Positives = 239/463 (51%), Gaps = 51/463 (11%)

Query: 1   MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60
           M   Y PEYS EL QFV++VY +++   + KLRLEKLIDLLEH  YL ESYR  L   Q 
Sbjct: 1   MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA 60

Query: 61  EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120
           E  +TA+V G FY+YLIIP SI+F +R+ SY+IY DLK++Y+ + NM NV+L+V   + S
Sbjct: 61  EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES 120

Query: 121 VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE 180
           + +       DE   AR   RKRAYS+    S      L K +         T  E + E
Sbjct: 121 MSK-------DEVETARIM-RKRAYSVPYGKSPVTIQALSKANSATVEPDAPT--ETEFE 170

Query: 181 QGAFGQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHS-----------PSIHDTSDSKT 229
            G             T+W+AP LEP+D LK+++   HS           P IH+ S S  
Sbjct: 171 NGT------------TMWTAPELEPNDHLKVSLGSHHSSTSSASSNEQFPKIHNESHSFP 218

Query: 230 KDSGLENNSAAEFSVLDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHND-VLDRF 288
            +         E   L       RRS     S+   +S      +  +  D ND  ++R+
Sbjct: 219 FEE-------PELHALSLGGSRTRRS-----SVPARASRKLGTTQASNSSDFNDQKINRY 266

Query: 289 YTHGQDLRYPI--CNDGVVPCENSSIMWLYESSSIKCLDLLSKLTSSERSSMLLIDLRLP 346
            TH +D  + +   ND        ++  L + S + C  L+  L S +R ++LLIDLR  
Sbjct: 267 ATHRKDSYHSVHMSNDD-YDAFTFNLARLQKQSVVTCDQLMRILCSQDRDNLLLIDLRFS 325

Query: 347 KRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTDN 406
           KR++ +HILA N++N+DP LLW+  KG+P+ S  +LE  +DN L  +R QF  IV YTD 
Sbjct: 326 KRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFEYIVYYTDM 385

Query: 407 YTYMQIDXXXXXXXXXXXXXGRPQLVL--KTLSGGYEQWKSFL 447
            T+M++D                 L    K L GGYEQWK FL
Sbjct: 386 KTFMKLDFDYQLVFFQLIYTSNKNLKCTPKVLLGGYEQWKKFL 428

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
            (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  518 bits (1334), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 261/447 (58%), Positives = 328/447 (73%), Gaps = 12/447 (2%)

Query: 1078 KLIRNPIPHF--SIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            K+++N + H   +IPTIE S NEYVALSITGLRNM NTCYINSMLQCLF+T  FR+LFLS
Sbjct: 527  KVLQNKMHHAEGTIPTIEQSSNEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLS 586

Query: 1136 NKYAHYL--KSPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQD 1193
             KY  Y   +      +S+ F +LF+KMYMNGGCSVVP+GFLK CN L+PDL+IP+ QQD
Sbjct: 587  PKYEDYFSKRYSNPHQLSKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQD 646

Query: 1194 TQXXXXXXXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPI 1253
            TQ              S    V+NDY +LLLHD+  L VD  +Y+KWF+ NI +NG+SPI
Sbjct: 647  TQEFLLFLLSQLHDELSESNHVANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISPI 706

Query: 1254 DDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCD 1313
            D +FQGQMEN L CQRCG+SSY YS FYVLSLA+P  ++ +FG+ KK+RLEDCIN FT D
Sbjct: 707  DAIFQGQMENGLLCQRCGHSSYNYSMFYVLSLAIPASMS-SFGQKKKMRLEDCINLFTSD 765

Query: 1314 EVLSDQNAWDCPRCCSPSDYMSYD-HKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRS 1372
            E L+++NAWDCP+C S       D  K KRK  ++ ++ NG   SRS+ FK   K RSRS
Sbjct: 766  EKLTNENAWDCPKCGSAVSGNGPDGDKKKRKFLSTSDNSNG--RSRSRFFKLRSKSRSRS 823

Query: 1373 ----EAPKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPL 1428
                  P   S  S+K  + K +T+K+LNF+++P +L IHLSRF+YDLT KNN V++YPL
Sbjct: 824  VSPFHKPSSQSPASEKWKSKKLSTIKTLNFVSLPSVLTIHLSRFLYDLTNKNNKVITYPL 883

Query: 1429 ILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKF 1488
             L+IVLKN+EV  +RLY+I NHFG LISGHYTSLVNK+L+H++ +G+QKWYYFDDE+ K 
Sbjct: 884  TLSIVLKNNEVVNYRLYAIANHFGNLISGHYTSLVNKDLSHDLGNGRQKWYYFDDEVAKR 943

Query: 1489 DTNHGDYDNGIASVSSSNVYVLFYERI 1515
            D NHG+ D GI SVSSS+VYVLFYE+I
Sbjct: 944  DLNHGNIDAGITSVSSSDVYVLFYEKI 970

 Score =  253 bits (646), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 169/472 (35%), Positives = 249/472 (52%), Gaps = 35/472 (7%)

Query: 1   MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60
           M   Y PEYS EL QFV+EVY +++   Y +LRLEKLIDLLEH  YL ESYR  L   Q 
Sbjct: 1   MNHLYSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQN 60

Query: 61  EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120
              +TA+VVG FY+YLIIP SI+FH+R+ SY+IY DL+++Y+ + NM NV+L+V   + S
Sbjct: 61  SELLTAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIES 120

Query: 121 VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE 180
           V +       DE   A+   RKRAYS+      KL+D +  L++   +   T        
Sbjct: 121 VSR-------DELESAKIM-RKRAYSVP---HKKLSDKMQALTLSPETASSTN------- 162

Query: 181 QGAFGQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAA 240
                  + D+E + T+W+AP LEP+D LK+ +   +S     +S+ +    G E NS++
Sbjct: 163 ----AGPETDNENDSTMWTAPELEPNDHLKVNLGGHNSSVSSRSSNEQAFKVGNEGNSSS 218

Query: 241 --EFSVLDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYP 298
             +  +       ++R    S  ++V++  N     +  I  +   +DR+ TH +   + 
Sbjct: 219 SDDIEMAVHSTTQDQRPRRSSVPIKVEAPQNSLQSTVDDI--YCQKVDRYNTHRKGSYHS 276

Query: 299 ICNDGVVPCENSSIMW----LYESSSIKCLDLLSKLTSSERSSMLLIDLRLPKRYEYSHI 354
           +   G    E  S  +    L + S I C  LL  L S E   +LL+DLR  KR+E +HI
Sbjct: 277 VHMTG---DEYDSFTFNTARLQKQSIITCDKLLRILDSEEAERLLLVDLRFIKRFETNHI 333

Query: 355 LAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTDNYTYMQIDX 414
           +A N++N+DP  LWD  KG  +     LE++  NH  +   QF  IV YTD  T+M++D 
Sbjct: 334 VAPNLVNLDPMNLWDFAKGRAIEGDAPLEVLNKNHALKDLSQFKHIVYYTDMKTFMRLDF 393

Query: 415 XXXXXXXXXXXXG--RPQLVLKTLSGGYEQWKSFLKELKRTESIILSDFLWK 464
                          R     K L GGYEQWK FL ++ ++   I   FL++
Sbjct: 394 DYQLVFFQMLYTSNWRISCTPKVLLGGYEQWKKFLAKVPQSRVPIKEAFLFR 445

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  495 bits (1274), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 258/499 (51%), Positives = 327/499 (65%), Gaps = 20/499 (4%)

Query: 1034 DRRSERRNHRSNAYASAYRKNSSISHKGADRSPEETNNIKVDGHKLIRNPIPHFSIPTIE 1093
            D  S +     N Y ++Y+    ++     R  E       +   L+      FSIPTIE
Sbjct: 612  DLHSTKSQQHRNQYLTSYQHQVELA-----RDDETRRKYHQERESLMLTRSRKFSIPTIE 666

Query: 1094 NSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL---KSPEMDTM 1150
             S N YV+LSITGLRN+ NTCYINSMLQCLF+T  FR+LF+S+K+  ++   K P    +
Sbjct: 667  KSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFPNTPKI 726

Query: 1151 SRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXS 1210
            S SF +LF+KMY+NGGCSVVP+ FLK CN L+PDLRIP  QQDTQ              S
Sbjct: 727  SNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRLHDELS 786

Query: 1211 SIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRC 1270
            + + V N+Y +LLL+D   L V + +Y  WFD+N+  NGLSPID +F GQMEN L CQRC
Sbjct: 787  NQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSLQCQRC 846

Query: 1271 GYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCSP 1330
            G SSY YSTFYVLSLA+P P +  F ++K+++LE+CIN FT DEVLS +NAWDCP+C S 
Sbjct: 847  GNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCPKCGSS 906

Query: 1331 SDYMSYDHKGKRKISTS----FESLNGGNSSRSKLFKFGYK--------MRSRSEAPKFS 1378
            +     D +    +++S      S N  +  +SK F    +         +  S A   S
Sbjct: 907  ASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTSPAAVPS 966

Query: 1379 SKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSE 1438
            S  ++   + K  T+K+LNFI +P ILVIHLSRF YDLTKKNN V++YPLILNIVLKN+E
Sbjct: 967  STKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNE 1026

Query: 1439 VAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNG 1498
            VAK+RLY IVNH G LISGHYTSLVNKE NH++   KQ+WYYFDDE VK + NHGD D G
Sbjct: 1027 VAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKG 1086

Query: 1499 IASVSSSNVYVLFYERIFD 1517
            I  VSS +VYVLFYERI++
Sbjct: 1087 ILQVSSRDVYVLFYERIYE 1105

 Score =  113 bits (282), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 84/233 (36%), Positives = 132/233 (56%), Gaps = 29/233 (12%)

Query: 3   APYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEA 62
           +P+ PEYS EL Q V+ +Y ++++  Y +L+LEKL+DLLEH  YLLE +           
Sbjct: 7   SPFTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNK 66

Query: 63  GI-TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSV 121
            + TA++VG +YL+LIIPQSI+F ++N SY IY +LK+ YE++ +M NV+L+V  ++ +V
Sbjct: 67  DVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENV 126

Query: 122 MQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQ 181
           + +  +  G +    R   R+RAYS+     ++L++ +  LSI  S  +       KTE 
Sbjct: 127 LDMDENNNGSD-LNHRIIKRQRAYSIS---INELSNQVKSLSISNSIDQEH--INNKTET 180

Query: 182 GAFGQQ----------QQDDEWEDT------------VWSAPNLEPDDQLKLA 212
               Q             D+E+ +             +W+AP+LEP DQLKLA
Sbjct: 181 SLTNQPPNHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLA 233

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  489 bits (1259), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 244/456 (53%), Positives = 310/456 (67%), Gaps = 28/456 (6%)

Query: 1079 LIRNPIPHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKY 1138
            L R P    SIPTIE S N YV+LSITGLRN+ NTCYINSMLQCLF+T  FR+LFL++KY
Sbjct: 586  LTRRP----SIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKY 641

Query: 1139 AHYL---KSPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQ 1195
            + +L   K P    +S SF +LF+KMY+NGGCSVVP+ FLK CN L+PDL+IP  QQDTQ
Sbjct: 642  SSFLNGSKFPNSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQ 701

Query: 1196 XXXXXXXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDD 1255
                          S+ + V N+Y  L+L+D   L V   +Y  WF++++  NGLSPID+
Sbjct: 702  EFLMIILDRLHDELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDE 761

Query: 1256 LFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEV 1315
            +FQGQ+EN L CQRCG+SS+ YSTFYVLSLA+P P    F ++K+++LEDCIN FT DE+
Sbjct: 762  IFQGQIENGLQCQRCGHSSFNYSTFYVLSLAIPKPSPTGFSRSKRVKLEDCINMFTNDEM 821

Query: 1316 LSDQNAWDCPRCCSPSDYMSYDHKGKRKIST--SFESLNGGNSSRSKLFKFGYKMRSRSE 1373
            LS +NAWDCP C S       + + + +++T  S +    G   R K   FG   R    
Sbjct: 822  LSGENAWDCPNCGS-------NAQDRVRVNTDQSVKKKRQGEEHRHKSRFFGLPTRPHRS 874

Query: 1374 APKFSS------------KLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNN 1421
               F              K   +    K  T+K+LNFI +P +LVIHLSRF YDLTKKN 
Sbjct: 875  LSPFRKSGSSSTNSTSKIKHEQQWKTKKLITIKTLNFIMLPPVLVIHLSRFFYDLTKKNK 934

Query: 1422 IVVSYPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYF 1481
             V++YPLILNIVLKN+EVAK++LY IVNH G LISGHYTSLVNKE  H ++H +Q+WYYF
Sbjct: 935  TVITYPLILNIVLKNNEVAKYKLYGIVNHTGNLISGHYTSLVNKEPGHNLNHNQQRWYYF 994

Query: 1482 DDEIVKFDTNHGDYDNGIASVSSSNVYVLFYERIFD 1517
            DDE+VK + NHGD DNGI+ VSS +VYVLFYER+++
Sbjct: 995  DDEVVKAEGNHGDIDNGISKVSSKDVYVLFYERLYE 1030

 Score =  196 bits (497), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 161/491 (32%), Positives = 254/491 (51%), Gaps = 39/491 (7%)

Query: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64
           + PEYS EL + ++ VY E+++  Y +L+LEKL+DLLEH  YL E +      G  +  +
Sbjct: 10  FTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDAL 69

Query: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124
           T+++VG +YL+LI+PQSI+F +RN SY IY DLK+ YE+  +M NV+L+V  ++ ++++ 
Sbjct: 70  TSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILEK 129

Query: 125 YLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRG---TTVFEGKTEQ 181
               E +E    R   R+RAYS+   DS+ L + L  LS+   + +      +     E 
Sbjct: 130 TAEREINET-NNRIV-RQRAYSVP--DSNDLTEQLHSLSVSDRNLKSPPRKILMNNSFEH 185

Query: 182 GAFGQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHS---PSIHDTSDSKTKDSGLENNS 238
                  ++++    +W+AP LEP DQLKLAV  + +   P I   +D + +   L+  S
Sbjct: 186 SDSDVINEENDMSSPLWTAPPLEPTDQLKLAVLGNETLPPPVIPYEADIQERTDLLKQPS 245

Query: 239 AAEFSVLDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHND-------VLDRFYTH 291
             E S       + +   F S    V S DN    ++P + + ++         DR  TH
Sbjct: 246 IPELSPTTTSLKNSK--DFNSPFQSVISLDN----DIPLVREPSNNRSFRETNADRSQTH 299

Query: 292 GQDLRYPI------CNDGVVPCENSS-----IMWLYESSSIKCLDLLSKLTS-SERSSML 339
            +D  + +        D +    +S+     +  L + S I   +LLS L+   ER  +L
Sbjct: 300 RKDSYHSVYMIDEESTDKLNQFYDSTDYIQDLQRLQKQSIITAQELLSILSCPPERIKLL 359

Query: 340 LIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFAT 399
           LIDLR  KR   +HI+A NV++IDP LLWD     P+ +++ LE ++DN LF  R +F  
Sbjct: 360 LIDLRWSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLEKLLDNELFNRRHEFEY 419

Query: 400 IVCYTDNYTYMQIDXXXXXXXXXXXXXGRPQLVLKT---LSGGYEQWKSFLKELKRTESI 456
           +V YTD  TYM  D                 ++  T   L GGY++WK FL    +   I
Sbjct: 420 VVYYTDMKTYMHSDFDYNFTLFYLLTTETTNILRSTPTYLLGGYDKWKVFLHHYAKEYDI 479

Query: 457 ILSDFLWKRPH 467
            + D+L+ RP+
Sbjct: 480 NIPDYLY-RPY 489

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  485 bits (1249), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 239/439 (54%), Positives = 313/439 (71%), Gaps = 12/439 (2%)

Query: 1086 HFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKS- 1144
            H+SIPTIE S N YV+LSITGLRN+ NTCYINSMLQCLF+T+ FR+LF+S K+  +    
Sbjct: 589  HYSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEFFNQN 648

Query: 1145 -PEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXX 1203
                  +S+SF +LFRKMY+NGGCSVVP+ FLK+ + L+PDLRIP  QQDTQ        
Sbjct: 649  YSNRPQLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFLMVTLD 708

Query: 1204 XXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMEN 1263
                  S+  +V+N+Y  LLL+D  ++ V+  +Y KWF++++  NGL+PID +FQGQ+EN
Sbjct: 709  RLHDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPIDHIFQGQIEN 768

Query: 1264 QLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWD 1323
             L CQRCG SS++YSTFYVLSLA+P P    F + K+++LEDCIN FT DE+LS +NAWD
Sbjct: 769  ILECQRCGNSSFSYSTFYVLSLAIPKPSTSTFSRAKRVKLEDCINMFTNDEILSGENAWD 828

Query: 1324 CPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAP-------K 1376
            CP+C S    M  +H  K K     E L     S+S  F+   K + RS++P       K
Sbjct: 829  CPKCGSAVTDMGPNHLKKSKKKKKSE-LGEERRSKSGFFRIHSKSK-RSKSPFRMLGSTK 886

Query: 1377 FSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKN 1436
            F   + D  S  + +T K+LNFI +P +L+IHLSRF YDLTKKN+ +V+YPL+LNI+LKN
Sbjct: 887  FPLAMEDWKSK-ELSTKKTLNFIFLPPVLIIHLSRFYYDLTKKNDTIVTYPLVLNIILKN 945

Query: 1437 SEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYD 1496
            +E A++RLY++VNH G LISGHYTSLVNKE  H++  G+QKWYYFDDE+VK +T HG+ D
Sbjct: 946  NETARYRLYAVVNHTGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDDEVVKEETKHGNID 1005

Query: 1497 NGIASVSSSNVYVLFYERI 1515
             GI  VSSS+VYVLFYER+
Sbjct: 1006 QGILKVSSSDVYVLFYERL 1024

 Score =  189 bits (479), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 161/493 (32%), Positives = 245/493 (49%), Gaps = 45/493 (9%)

Query: 2   EAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVE 61
           E  + PEYS EL + V+ +Y ++++  + + +LEKL+DLLEH  YL ESY + L     +
Sbjct: 5   EVSFTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQ 64

Query: 62  AGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSV 121
             +TA+++G +YLYLI+PQSIEF TRN SYSI+ DL + Y++  NM NV+L+V  +V S+
Sbjct: 65  DALTAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSI 124

Query: 122 MQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSI--ERSSTRGTTVFEGKT 179
           +        + K       R RAYS+           L  L+I  E     G      K+
Sbjct: 125 LD---RNAREFKEFEHQKARTRAYSVP---DRNFESRLTNLNIHNENPLPLGDHQAASKS 178

Query: 180 EQGAFGQQQ-QDDEWEDTVWSAPNLEPDDQLKLAVSYSH-SPSIHDTSDSKTKDSGLENN 237
           EQG       Q+DE    VW+AP LEP+DQL++A+  +  SPSI            L+  
Sbjct: 179 EQGREDMNNLQNDEDSSPVWTAPPLEPNDQLRIALDATPLSPSI----------MALDQP 228

Query: 238 SAA-EFSVLDEEWVSERRSGFMSQS----LQVDSSDNKNNDELPSIGDH----NDVLDRF 288
            A  E ++        RR+  M  +     ++D S    N     +G +    N  +DR 
Sbjct: 229 MATKELAISTSRKALSRRASAMGPTPYPIEELDISGQDGNSHYDELGFNKTLWNANVDRQ 288

Query: 289 YTHGQDLRYPI-----CNDGVVPCENS----SIMWLYESSSIKCLDLLSKLTSSERSS-M 338
            TH +D  + +      +D  +P  +      +  L + S I   +L + L+SSE S  +
Sbjct: 289 TTHRKDSYHSVYMFEGGSDDHMPSISKDFTQGLERLQKQSIITAPELFTILSSSEESEKL 348

Query: 339 LLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFA 398
           LLID RL KR + +HI+A   + IDP  LWD +   P+S+   L+ +I    F  R  + 
Sbjct: 349 LLIDFRLSKRSKVNHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEIIKKPAFLERGSYD 408

Query: 399 TIVCYTDNYTYMQIDXXXXXXXXXXXXXGRPQLVLKTLS----GGYEQWKSFLKELKRTE 454
            IV YTD  TYM ID               P + L++L     GGYE+WK  +K      
Sbjct: 409 YIVYYTDMKTYMTID-YDYMFTLFYLLTASPTVNLRSLPTHLLGGYEKWKKIMKNYSVDH 467

Query: 455 SIILSDFLWKRPH 467
            + + ++++ RP+
Sbjct: 468 GVNMDNYIY-RPY 479

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  485 bits (1248), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 242/451 (53%), Positives = 304/451 (67%), Gaps = 22/451 (4%)

Query: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSP- 1145
            FSIPTIE + N YVA S+TGLRN+ NTCYIN MLQ LF+T+  +NLF+S KY  Y   P 
Sbjct: 630  FSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPN 689

Query: 1146 --EMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXX 1203
              +   +S +F  LF KMYMNGGC+VVPSGFLK+CN L+PDLRIP  QQDTQ        
Sbjct: 690  DNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILN 749

Query: 1204 XXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMEN 1263
                  S+  +V NDY +LLL+D+ ++ VD  +Y KWFD+ +  NGLSP+D +FQGQMEN
Sbjct: 750  RLHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMEN 809

Query: 1264 QLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWD 1323
             L CQRCGY S  YSTFYVLSLALP P A AF K+ +++LEDCIN FT DEVL+ +NAWD
Sbjct: 810  ALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWD 869

Query: 1324 CPRCCSPSDYMSYDHKG-----------KRKISTSFESLNGGNSSRSK--LFKFGYKMRS 1370
            CP+C S +    +  +              K S  F    G   SRSK    K G   + 
Sbjct: 870  CPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAISRSKSPFRKLGLLEKH 929

Query: 1371 RSEAPKFSSKLSD------KVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVV 1424
              +  K      D      K+ + K  T+K++NFI++P++L+IHLSRF YDLTKKN+ VV
Sbjct: 930  EGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVV 989

Query: 1425 SYPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDE 1484
            SYPL+LNIVLKN E+ +++LYSIVNH G LISGHYTSLVNK+ +H + + +QKWYYFDDE
Sbjct: 990  SYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDE 1049

Query: 1485 IVKFDTNHGDYDNGIASVSSSNVYVLFYERI 1515
            +VK +  HG+ D GI  VSS NVYVLFYER+
Sbjct: 1050 VVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080

 Score =  128 bits (321), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 148/544 (27%), Positives = 241/544 (44%), Gaps = 93/544 (17%)

Query: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEA-- 62
           + PE+S +L   ++++YV+ +   + +L+L++L+DLLE    +LE Y   +G   V+   
Sbjct: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDY---MGCVDVDTSK 60

Query: 63  GITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVM 122
            +  ++ G FY+YL++P+S++F TR+ SYS+Y +L+  YES  NM NV+ +V  +V  + 
Sbjct: 61  AVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQ 120

Query: 123 QL---YLSGEG--DEK--------------YGARFTGRKRAYSMQS---CDSSKLADTLG 160
           +    +   EG  D K               G R   R+ AYS+ S     +  L D L 
Sbjct: 121 EQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELP 180

Query: 161 KL---------SIERSSTRGTTV------FEGKTEQGAFGQQQQDDEWEDTVWSAPNLEP 205
           +          S+ER  + G          + +T+        Q  +  D   +A N  P
Sbjct: 181 EHRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIP 240

Query: 206 DDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAAEFSV--------------------- 244
              L     +S   ++ D  +      G   +S  E+ V                     
Sbjct: 241 TLSL-----HSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLA 295

Query: 245 LDEEWVSERRSGFMSQSLQVD---SSDNKNNDELPSIGDHNDV-LDRFYTHGQDLRYPIC 300
           L  E +S    G    +L  D    + +K +D      D  D+  +R  TH +D  + I 
Sbjct: 296 LGTELLSPPVMGLDGDTLGDDIYYETVSKGDDVSYRGKDFEDLHANRLITHRKDSYHSIY 355

Query: 301 NDGVVPCENSSIMWLYESSS--IKCLDLLSK---LTSSERSSML----------LIDLRL 345
              ++  +N++    ++ S+  I+ L+ L K   +T+ E  S+L          LIDLRL
Sbjct: 356 ---MIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRL 412

Query: 346 PKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTD 405
            KR   +HI+A NV+NIDP  LWD+E  +P+     LE  ++N LF  R ++  IV Y+D
Sbjct: 413 NKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSD 472

Query: 406 NYTYMQIDXXXXXXXXXXXXXGRPQL--VLKTLSGGYEQWKSFLKELKRTESIILSDFLW 463
             TYM  +                 L  V   L GGYE+WK  +        I L D+L+
Sbjct: 473 MKTYMNFEYDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLY 532

Query: 464 KRPH 467
            RP+
Sbjct: 533 -RPY 535

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  480 bits (1236), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 243/436 (55%), Positives = 311/436 (71%), Gaps = 9/436 (2%)

Query: 1089 IPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMD 1148
            +PTIE + N YV+LSITGLRN+ NTCYI+SMLQCLF+T+  R+LF++ KY  Y+     D
Sbjct: 609  VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTD 668

Query: 1149 --TMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXX 1206
               +SRSF +LFRKMY+NGGCSVVP+ FLK CN L+PDL+IP  QQDTQ           
Sbjct: 669  KINLSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRLH 728

Query: 1207 XXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLS 1266
               S  ++V NDYS+LLL+D  R++V   QY KWF+ +    G+SPIDD+FQGQ+EN ++
Sbjct: 729  DELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQGQIENSIN 788

Query: 1267 CQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPR 1326
            CQRCGYSS+ YS+FYVLSLA+P     +F +T +++LEDCIN FT DEVLS +NAWDC R
Sbjct: 789  CQRCGYSSFNYSSFYVLSLAIPKISVMSFSRTNRVKLEDCINMFTRDEVLSGENAWDCSR 848

Query: 1327 CCSPSD-YMSYDHKGKRKISTSFESLNGGNSSRSKLFKF--GYKMRSRSEAP---KFSSK 1380
            C S SD ++   H    K  TS  + +   + +S+LF     Y   SRS +P     S K
Sbjct: 849  CGSQSDNFVKTSHNDHHKEHTSETTDDSKQNRKSRLFLLPKKYNPTSRSLSPFGRHSSHK 908

Query: 1381 LSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVA 1440
             S+K  + K  T+KSLNFI MP+ILVIHLSRF YD++KKN  VV+YPLILNIVLKN EV 
Sbjct: 909  SSEKWKSKKMETIKSLNFIKMPKILVIHLSRFFYDMSKKNETVVAYPLILNIVLKNEEVC 968

Query: 1441 KFRLYSIVNHFGTLI-SGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGI 1499
            K+RLY+IVNH G  + SGHYT+LVNK  NH++   +Q+WYYFDDE+VK + NHG+ D G+
Sbjct: 969  KYRLYAIVNHMGNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDEVVKHELNHGNIDEGV 1028

Query: 1500 ASVSSSNVYVLFYERI 1515
              VSSS+VYVLFYE+I
Sbjct: 1029 NKVSSSHVYVLFYEKI 1044

 Score =  211 bits (538), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 170/526 (32%), Positives = 258/526 (49%), Gaps = 64/526 (12%)

Query: 1   MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60
           +E+ + PEYS EL + V + Y   ++  + +LRL KLI++LEH AYLLESY +LL   + 
Sbjct: 3   VESTFTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKY 62

Query: 61  EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120
           +  ++AY+VG FYLYLIIP S +F  RN S+ IY +LK  Y++  NM NV+ +V  +V S
Sbjct: 63  DECLSAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDS 122

Query: 121 VM-QLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKT 179
           ++ +  L  EG EK       R RAYS  +   + ++    KLSI  +   G T+     
Sbjct: 123 ILDESILELEGIEK----VIKRDRAYSSPAPKVNNIS-KFSKLSINDNHHNGETISTDNK 177

Query: 180 EQGAFGQ--------------------QQQDDEWEDT--VWSAPNLEPDDQLKLAVSYSH 217
            Q  F Q                        +E EDT  +W  P+LEP+DQLKLA+    
Sbjct: 178 LQSHFPQTPNYSNSNNSTGSFNNVKSNSNSSEEAEDTAPIWHIPSLEPNDQLKLALE--- 234

Query: 218 SPSIHDTSDSKTKDSGLENNSAAEFSVLDEEWVSERRSGFMSQSLQVDSSDNKNN----- 272
            P   + SD +   S +       +S L      ++R+  +S +  V    N+N+     
Sbjct: 235 QPV--EFSDEEIDASSISEPLGRRYSPLSP--YQKKRNSSISSAFLVPFPHNENDKVHDN 290

Query: 273 ----DELP---SIGDHNDVLDRFYTHGQD------LRYPICNDGVVPCENSSIMWLYESS 319
               ++LP   S+    D     Y + QD        Y + N  +      S+  L + +
Sbjct: 291 SMLIEDLPVDRSVTHRKDSYHSVYMNNQDEESDSGAHYGLSNSYI-----QSMDRLQKQN 345

Query: 320 SIKCLDLLSKLTS-SERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSS 378
            I C +L S L+S +ER  +LL+DLR+PK    +HI+A ++I IDP LLW++E   P+ S
Sbjct: 346 VITCSELYSILSSPTERQKLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNEETQTPIYS 405

Query: 379 VKELELVIDNHLFRSRRQFATIVCYTDNYTYMQIDXXXXXXXXXXXXXGRP---QLVLKT 435
            +EL   I+N L     +F  IV Y+D  T+M  D              +    + V   
Sbjct: 406 FEELVKRINNPLISEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYLLLSTKSLNLKQVPTN 465

Query: 436 LSGGYEQWKSFLKELKRTESIILSDFLWKRPHKNEHSNDIVIASGE 481
           L GG+E+WK  LK   +   I ++ F+ K+ H  E  N   + +GE
Sbjct: 466 LLGGFEKWKKVLKTYNKEYGIDITPFI-KKLHATE-LNKNTVPTGE 509

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1212

 Score =  480 bits (1236), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 254/500 (50%), Positives = 315/500 (63%), Gaps = 50/500 (10%)

Query: 1065 SPEETNNIKVDGHKLIRNPIPHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLF 1124
            SP E     +D HK       HFSIP +E S N+YV+LSITGLRN+ NTCYINSMLQCLF
Sbjct: 713  SPLENQVHSLDTHKQNGAIHRHFSIPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLF 772

Query: 1125 STSAFRNLFLSNKYAHYLKS--PEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLK 1182
            +T+ FRN+FLS+KY  Y+    P    +S+SF MLF+KMYMNGGCSVVP+GFLK CN L+
Sbjct: 773  ATTEFRNIFLSHKYEKYMDHDIPTNQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILR 832

Query: 1183 PDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFD 1242
            PDLRIP  QQDTQ              S+   V  DY  L+ +D   + V   QY KW++
Sbjct: 833  PDLRIPDDQQDTQEFLMLILDRLHDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYN 892

Query: 1243 QNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLR 1302
            +++  NGLSPID +FQGQ E+ L CQRCG SS+TYSTFY+LSLA+P     AFGK K++ 
Sbjct: 893  ESVKSNGLSPIDHVFQGQTEDGLVCQRCGCSSFTYSTFYILSLAIPKASTNAFGKIKRVN 952

Query: 1303 LEDCINFFTCDEVLSDQNAWDCPRCCS--PSDYMSYDHKGKRKIS--------------- 1345
            LEDCI  FT DE+LSD+NAWDCPRC S  P     + H+ K+ I                
Sbjct: 953  LEDCIKMFTNDEILSDENAWDCPRCGSAAPKQEPIHRHREKKHIHDISPPPRSPSSPEPR 1012

Query: 1346 -----------------TSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDK---V 1385
                             +    L GG  S  K  +   +  SRS     S    ++    
Sbjct: 1013 SKRFFLLNAPREVVRSYSPLRILPGGRHSFDKPRELK-EHYSRSADENLSDDKENQNHTT 1071

Query: 1386 SNG----------KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLK 1435
             NG          K  T+KS+NF+  PRILVIHLSRF YDLTKKNN V++YPL LNI LK
Sbjct: 1072 PNGRAGRVRHYSGKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLK 1131

Query: 1436 NSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDY 1495
            N EVA+++LY +VNH GTL+SGHYTSLVNK+ +HE+   KQKW+YFDDEIVK + NHGD 
Sbjct: 1132 NGEVARYKLYGLVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDI 1191

Query: 1496 DNGIASVSSSNVYVLFYERI 1515
            + G+ S+SSS+VYVLFY+RI
Sbjct: 1192 EGGVTSISSSHVYVLFYQRI 1211

 Score =  116 bits (290), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 91/147 (61%), Gaps = 4/147 (2%)

Query: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64
           Y PEYS EL Q V+E+Y    +  Y +L+LEKLIDLL+H ++L E+Y + L     +  +
Sbjct: 10  YTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDAL 69

Query: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124
           +A++VG+FY+Y IIPQS +F T+N  Y +Y +LK  YE + NM NV+ +V  ++  ++  
Sbjct: 70  SAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDS 129

Query: 125 YLSGEGDEK----YGARFTGRKRAYSM 147
               + +        ++F  R+RA+S+
Sbjct: 130 NYKSQNESSNNLFVDSKFIRRERAFSV 156

 Score =  102 bits (255), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 97/183 (53%), Gaps = 16/183 (8%)

Query: 321 IKCLDLLSKLTSS-ERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSV 379
           I C +L S L+++ ER  +LLIDLR P+R+  +HI+A N++ ++P+LLWDD    PV + 
Sbjct: 494 ITCPELFSLLSNNVEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTA 553

Query: 380 KELELVIDNHLFRSRRQFATIVCYTDNYTYMQI--DXXXXXXXXXXXXXGRPQLVLKT-L 436
           ++LE +I+N LF  R  F  +V Y+D  TYM +  D              +P   L T L
Sbjct: 554 EKLEQIINNPLFSKRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTCTSKPVKSLPTSL 613

Query: 437 SGGYEQWKSFLKELKRTESIILSDFLWKRPHKNEHSNDIVIASGEPSDSNNSKSF----P 492
            GGYE+W   +       SI ++D+++++        D   ++G P ++N         P
Sbjct: 614 LGGYEKWYKVINSYVNQYSITMNDYVYRK--------DAGASAGRPLNNNEKPKMEIWTP 665

Query: 493 PSL 495
           P L
Sbjct: 666 PQL 668

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] {ON}
            complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  441 bits (1134), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 224/408 (54%), Positives = 285/408 (69%), Gaps = 14/408 (3%)

Query: 1119 MLQCLFSTSAFRNLFLSNKYAHYLKSPEMD---TMSRSFYMLFRKMYMNGGCSVVPSGFL 1175
            M+QCLF T   R+LF+S+KY  YL S  +D    +SRSF +LF+KMY+NGGCSVVP+ FL
Sbjct: 1    MVQCLFGTKLLRDLFISSKYEKYL-SKRIDRSSNLSRSFSILFKKMYLNGGCSVVPTSFL 59

Query: 1176 KMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDA 1235
            K CN L+PDLRIP  QQDTQ              S+ E+V  DY  L+L+D  +L V++ 
Sbjct: 60   KTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVNNK 119

Query: 1236 QYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAF 1295
            +Y+KWFD+ I  NGLSPID +FQGQ+EN L+CQRCG+ SY YSTFYVLSLA+P P +  F
Sbjct: 120  EYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGTF 179

Query: 1296 GKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGN 1355
             ++K+++LEDCIN FT DEVLS +NAWDC  C S S +    +  +RK  T+        
Sbjct: 180  SRSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVH----NVEQRKDKTTGNGEEKKR 235

Query: 1356 SSRSKLFKF----GYKMRSRSEAPKFSSKL--SDKVSNGKPATVKSLNFITMPRILVIHL 1409
            S +S+LF      G   RS S   K +S     +K+ + K  T+KS+NFI++P  LVIHL
Sbjct: 236  SRKSRLFLLPNINGRSSRSISPFRKSASPRPPHEKLKHKKLVTIKSMNFISLPPTLVIHL 295

Query: 1410 SRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNH 1469
            SRF YDL+KKN  +V+YPLILNIVL N+E AK+RLY IVNH G LISGHYT+LVNKE NH
Sbjct: 296  SRFYYDLSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGNLISGHYTTLVNKEKNH 355

Query: 1470 EISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYERIFD 1517
            E+   KQKWYYFDDE+VK + NHG+ D G+  VSSS VYVLFYER+++
Sbjct: 356  ELKKDKQKWYYFDDEVVKEENNHGNIDEGVIKVSSSQVYVLFYERVYN 403

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1161

 Score =  464 bits (1195), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 237/489 (48%), Positives = 315/489 (64%), Gaps = 60/489 (12%)

Query: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLK--S 1144
            +SIPTIE + N YV+LSITGLRN+ NTCYINSM+QCLF+T +FRNLF+S KY  +LK  +
Sbjct: 673  YSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVA 732

Query: 1145 PE------MDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXX 1198
            P+         +SR+FY+LF+KMY+NGGCSVVP  FLK C+ L+PD +IP  QQDT    
Sbjct: 733  PKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFL 792

Query: 1199 XXXXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQ 1258
                       S+ ++V N+Y  L+L+D  +L V + +Y KWFD+++  NGLSPIDD+FQ
Sbjct: 793  MLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQ 852

Query: 1259 GQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSD 1318
            GQMEN L CQRCG+SS+ YSTFYVLSLA+P   +  F ++K++ LE+C+N +T DEVLS 
Sbjct: 853  GQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSG 912

Query: 1319 QNAWDCPRCCSPS-DYMSYDHKGKR----------------------------------- 1342
            +NAWDCP CC  + DY     K KR                                   
Sbjct: 913  ENAWDCPNCCKITKDYKGMVEKTKRNKAARDTLSPGSSSSSSKKGKLFSFSLHHRHHHRS 972

Query: 1343 --------KISTSFESLN--GGNSSRSKLFKFGYKMRSRSEAPKFSSKLSD------KVS 1386
                    KI+ S       GG+SS+S         R+  +A +   +L +      +  
Sbjct: 973  ELGELNVSKINRSLSPFRVLGGSSSKSVRKSEDSHSRADVDAQRDIDELREMKEEMKQWK 1032

Query: 1387 NGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYS 1446
            + K  T+K+LNFI MPR L+IHLSRF YDLTKKN+ +V+YPLILNIVLK++EV K++LY 
Sbjct: 1033 SKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYG 1092

Query: 1447 IVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSN 1506
            +VNH G LISGHYTS+V+K+L+H ++     WYYFDDE+VK +T HGD  +G+  +SSS+
Sbjct: 1093 VVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSD 1152

Query: 1507 VYVLFYERI 1515
            VYVLFYERI
Sbjct: 1153 VYVLFYERI 1161

 Score =  184 bits (466), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 155/545 (28%), Positives = 249/545 (45%), Gaps = 100/545 (18%)

Query: 4   PYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAG 63
           P+ PE S EL Q V +VY +++     +LRL++LIDLLEH  +L E Y   LG+ Q    
Sbjct: 13  PFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDA 72

Query: 64  ITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQ 123
           + +++ G FY+YL++PQSI+FHTRN ++++Y D++  YES  NM NV+L+V  +V    Q
Sbjct: 73  LGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEV----Q 128

Query: 124 LYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIER-SSTRGTTVFEGK---- 178
           + L  + D         R RAYS+   D +++   L KL+++  + TRG      K    
Sbjct: 129 VVLESQWDSASLNERIPRNRAYSVP--DEARVVQNLDKLTLQSPTETRGGRPRSQKKQLL 186

Query: 179 -----------------TEQGAFGQQQQDDEWEDT------VWSAPNLEPDDQLKLAVSY 215
                             EQG       D  W D       +W AP LEP+DQLKLA   
Sbjct: 187 QLPRPGNVPVHSDSEFIAEQG-ISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAEV 245

Query: 216 SHSPSIHDTSDSKTKDS----------------GLENNSAAEF----------------- 242
              P    +  S   +                 GL ++S A                   
Sbjct: 246 HDLPPGAISRGSDADEEEDVDDLEIGYEEMGIYGLAHHSVAPPQHAPPPVPLSSQSPITS 305

Query: 243 ----SVLDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVL-----DRFYTHGQ 293
               + +D+  +  RR+  M+Q      +       +P  G H+        DR  TH +
Sbjct: 306 GGTPAAIDDLMMRRRRTHTMTQMTPAAQT-------VPPGGAHDRSFKDFTPDRSLTHRK 358

Query: 294 DLRYPICNDGVVPCENSSIMWLYESSSIKCLDLLSK---LTSSERSSML--------LID 342
           +  + +           ++ +   ++ I+ L+ L K   +T+ E  S+L        L+ 
Sbjct: 359 NSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAPELFSILSNEQQSKQLLL 418

Query: 343 LRLPKRYEY--SHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATI 400
           + L   Y Y  S I+A N ++IDP++LW+   GAP+  + ELE  ++N LF  R +F  +
Sbjct: 419 IDLRLDYRYNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNNPLFNRRDEFDYV 478

Query: 401 VCYTDNYTYMQI--DXXXXXXXXXXXXXGRP-QLVLKTLSGGYEQWKSFLKELKRTESII 457
           V ++D  T+M++  D             G+P + V   L GGYE+WK  + E  +  +I 
Sbjct: 479 VYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVILEYGKQYNIC 538

Query: 458 LSDFL 462
           ++D+L
Sbjct: 539 VTDYL 543

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
            UBP7Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1071

 Score =  457 bits (1176), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 245/499 (49%), Positives = 319/499 (63%), Gaps = 72/499 (14%)

Query: 1080 IRNPIPHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYA 1139
            I  P   ++IPTIE S N YV+LSITGLRN+ NTCYINSM+QCLF+   FR LF+S+KY 
Sbjct: 584  ILQPQRAYNIPTIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYK 643

Query: 1140 HYLK---------SPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYG 1190
             YL+         SP++   S S  MLF KMY+NGGCSVVP+GFLK+ N L+PDL+IP  
Sbjct: 644  SYLQPIRSNGSHYSPKL---SNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDD 700

Query: 1191 QQDTQXXXXXXXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGL 1250
            QQDTQ              S  + V+NDY +LLL++   L V + +Y  WFD+N+  NG+
Sbjct: 701  QQDTQEFLMILLDRLHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGI 760

Query: 1251 SPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAK--AFGKT--KKLRLEDC 1306
            SPIDD+FQGQMEN L C+RCGY+++ YSTFYVLSLA+P    K    G++  K+++LEDC
Sbjct: 761  SPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDC 820

Query: 1307 INFFTCDEVLSDQNAWDCPRCCSPSDYMSYD-----------------------HKGKRK 1343
            IN FT DEVLS +NAWDCPR C P+  +S                         H G ++
Sbjct: 821  INMFTSDEVLSGENAWDCPR-CGPTASVSTSVSALENEPSIVKSKKKKSRFFTLHTGTKR 879

Query: 1344 ISTSF--ESLNGG---NSSRSKLFKFGYKMRSRSEAP---------------KFSSKLSD 1383
                F  + +  G   N++ + +F+     R RS +P                FS+  +D
Sbjct: 880  RHLDFFGDGITEGHNSNNNNTTIFE-----RERSRSPFRMLGGSGKRSSSSTPFSTGGND 934

Query: 1384 -----KVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSE 1438
                    N K  TVK++NF+T+P+ILVIHLSRF YDLTKKNN VV+YPLILNI+LKN++
Sbjct: 935  SNNSSDYKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNND 994

Query: 1439 VAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNG 1498
              K++L+ +VNH GTLISGHYTSLVNK+L H ++ G+ KWYYFDDE+VK D  HG   N 
Sbjct: 995  TMKYKLFGVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKN- 1053

Query: 1499 IASVSSSNVYVLFYERIFD 1517
               +SSS+VYVLFYER++D
Sbjct: 1054 -LKISSSDVYVLFYERVYD 1071

 Score =  198 bits (504), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 165/484 (34%), Positives = 256/484 (52%), Gaps = 53/484 (10%)

Query: 3   APYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEA 62
            P+ PEYS EL + V+++Y E+++  Y +L+LEKL+DLLEH  YL E Y + +   +   
Sbjct: 15  TPFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHHDRPND 74

Query: 63  GITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVM 122
            +TA+++G +Y++LIIPQS++F TRN SYSIY DLK+ YE++ NM NV+L+V  ++G V+
Sbjct: 75  ALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVL 134

Query: 123 QLYLSGEGDEKYGARFTGR---KRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKT 179
                 +   K+GA    R   KRA+S+ + D   L+  +  LS++ ++ +         
Sbjct: 135 ------DESVKHGAGIEHRITKKRAFSVPADD---LSGQVASLSLDTAAPQ--------- 176

Query: 180 EQGAFGQQQQDD-EWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNS 238
           + G  G   +DD E    VW+APNLEP+DQLKLA+     P+         ++   + + 
Sbjct: 177 DHGLKGTFTEDDAEQSSPVWTAPNLEPNDQLKLALLPEVIPT------PAFREPERKTSV 230

Query: 239 AAEFSVLDEEWVS---ERRSGFMS-----QSLQVDSSDNKNNDELPSI--GDHNDVLDRF 288
               SVL E+  S   E  + F S     + +  D S     D   S+   D  ++    
Sbjct: 231 PVRPSVLLEDVPSIYHEDDTSFASLNPPFREITADRSVTHRKDSYHSVYMVDSGNL---- 286

Query: 289 YTHGQDLRYPICNDGVVPCENSSIMWLYESSSIKCLDLLSKLTSS-ERSSMLLIDLRLPK 347
                D  + + NDG +     S+  L + S I   +L S L++  ER  +LLIDLR+P+
Sbjct: 287 -KEDNDDLFNVENDGFI----QSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQ 341

Query: 348 RYEYSHILAENVINIDPELLWDDEKGAPVSSVKELE-LVIDNHLFRSRRQFATIVCYTDN 406
           R   +HI+A N++N+DP LLWD +   P+     LE L+ +N  F +R +F  IV YTD 
Sbjct: 342 RSAINHIVAPNLVNVDPNLLWDKQTNTPIYKDDILEHLLKENENFINRNKFDYIVYYTDV 401

Query: 407 YTYMQIDXXXXXXXXXXXXXGRP---QLVLKTLSGGYEQWKSFLKELKRTESIILSDFLW 463
            T+M I+              +      V  TL GGYE+WK  L    +   I + D+L+
Sbjct: 402 KTFMTINFDYAFIFFYLMLTSQKTPLTTVPTTLLGGYEKWKKTLHSYAQEYHISIEDYLY 461

Query: 464 KRPH 467
            RP+
Sbjct: 462 -RPY 464

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (REAL)
          Length = 1060

 Score =  456 bits (1174), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 245/504 (48%), Positives = 321/504 (63%), Gaps = 73/504 (14%)

Query: 1076 GHKLIRNPIP--HFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLF 1133
            G +L++ P+P   +SIPTIE + N YV+LSITGLRN+ NTCYINSM+QCLF+   FR LF
Sbjct: 568  GQQLLQ-PLPPKDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLF 626

Query: 1134 LSNKYAHYLK---------SPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPD 1184
            +S+ Y +YL+         SP++   S S  MLF KMY+NGGCSVVP+GFLK+ N L+PD
Sbjct: 627  ISSNYKNYLEPLASNRPHHSPKL---SNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPD 683

Query: 1185 LRIPYGQQDTQXXXXXXXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQN 1244
            L+IP  QQDTQ              S+ + V+NDY +LLL++   L V + +Y  WFD+N
Sbjct: 684  LKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKN 743

Query: 1245 IDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAK--AFGKT--KK 1300
            +  NG+SPIDD+FQGQMEN L C+RCGY+++ YSTFYVLSLA+P    K    G++  K+
Sbjct: 744  VIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKR 803

Query: 1301 LRLEDCINFFTCDEVLSDQNAWDCPRC-------------------------CSPSDYMS 1335
            ++LEDCIN FT DEVLS +NAWDCPRC                            S + +
Sbjct: 804  VKLEDCINMFTSDEVLSGENAWDCPRCGPTASFTASASASALENESSILKSKKKKSRFFT 863

Query: 1336 YDHKGKRKISTSFESLN--GGNSSRSKLFKFGYKMRSRSEAP---------------KFS 1378
                 KR+    F   N  G N + + +F+     R RS +P                F+
Sbjct: 864  LHTGSKRRHLDIFGDSNGEGNNINNTMIFE-----RERSRSPFKMLGGSGKRSSSSTPFA 918

Query: 1379 SKLSD-----KVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV 1433
            +  +D        N K  TVK++NF+T+P+ILVIHLSRF YDLTKKNN V++YPLILNI+
Sbjct: 919  NGGNDSNNTGDFKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNII 978

Query: 1434 LKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHG 1493
            LKN++  K+RL+ +VNH GTLISGHYTSLVNK+L H +  G+ KWYYFDDE+VK D  HG
Sbjct: 979  LKNNDTMKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHG 1038

Query: 1494 DYDNGIASVSSSNVYVLFYERIFD 1517
               N    +SSS+VYVLFYER++D
Sbjct: 1039 SDKN--LKISSSDVYVLFYERVYD 1060

 Score =  192 bits (488), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 163/482 (33%), Positives = 248/482 (51%), Gaps = 53/482 (10%)

Query: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64
           + PEYS EL + V+++Y E+++  Y +L+LEKL+DLLEH  YL E Y + +  G+    +
Sbjct: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPNDAL 67

Query: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124
           TA+V+G +Y++LIIPQS++F TRN SYSIY DLK+ YE++ NM NV+L+V  ++G V+  
Sbjct: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127

Query: 125 YLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGAF 184
            +      ++      +KRA+S+ + D   L+  +  LS++ +  +   +    TE    
Sbjct: 128 SVKHVVGIEHR---INKKRAFSVPAND---LSGQVASLSLDTAGPQQHNIKVPLTE---- 177

Query: 185 GQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAAEFSV 244
                D +    VW+APNLEP+DQLKLA+     P +  TS     +   ++ S A  SV
Sbjct: 178 ----DDMDQSSPVWTAPNLEPNDQLKLAL----LPEVIPTSTFNEPER--KSTSPARPSV 227

Query: 245 LDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYPIC---- 300
           L E+                D+S    N     I       DR  TH +D  + +     
Sbjct: 228 LLEDVPCTYHDN--------DASTASLNPPFRDI-----TADRSVTHRKDSYHSVYMVDS 274

Query: 301 ------NDGVVPCENSSIM----WLYESSSIKCLDLLSKLTSS-ERSSMLLIDLRLPKRY 349
                 ND  +  EN   +     L + S I   +L S L++  ER  +LLIDLR+P+R 
Sbjct: 275 DNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRS 334

Query: 350 EYSHILAENVINIDPELLWDDEKGAPVSSVKELE-LVIDNHLFRSRRQFATIVCYTDNYT 408
             +HI+A N++ +DP LLWD +   PV     LE L+ +N  F +R +F  IV Y+D  T
Sbjct: 335 AVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVKT 394

Query: 409 YMQI--DXXXXXXXXXXXXXGRPQLVLKT-LSGGYEQWKSFLKELKRTESIILSDFLWKR 465
           +M I  D               P   + T L GGYE+WK  L    +   I + D+L+ R
Sbjct: 395 FMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVEDYLY-R 453

Query: 466 PH 467
           P+
Sbjct: 454 PY 455

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (REAL)
          Length = 1064

 Score =  456 bits (1174), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 241/484 (49%), Positives = 311/484 (64%), Gaps = 56/484 (11%)

Query: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE 1146
            ++IPTIE S N YV+LSITGLRN+ NTCYINSM+QCLF+   FR LF+S  Y +YL+ P+
Sbjct: 583  YNIPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPK 642

Query: 1147 ------MDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXX 1200
                     +S S  MLF KMY+NGGCSVVP+GFLK+ N L+PDL+IP  QQDTQ     
Sbjct: 643  GSRSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMI 702

Query: 1201 XXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQ 1260
                     S+ + V+NDY +LLL++   L V + +Y  WFD+N+  NG+SPIDD+FQGQ
Sbjct: 703  LLDRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQ 762

Query: 1261 MENQLSCQRCGYSSYTYSTFYVLSLALPNPVAK--AFGKT--KKLRLEDCINFFTCDEVL 1316
            MEN L C+RCGY+++ YSTFYVLSLA+P    K    G++  K+++LEDCIN FT DEVL
Sbjct: 763  MENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVL 822

Query: 1317 SDQNAWDCPRCCSPSDYMSYD--------------------------HKGKRKISTSF-- 1348
            S +NAWDCPR C P+   S                            H G ++    F  
Sbjct: 823  SGENAWDCPR-CGPTASSSSASASASAFESESPIAKSKKKKSRFFTLHTGSKRRHLDFFG 881

Query: 1349 ESLNGGNSSRSKLF-----KFGYKM------RSRSEAP----KFSSKLSDKVSNGKPATV 1393
            +++N  NSS +  F     +  +KM      RS S  P           +   N K  TV
Sbjct: 882  DNINESNSSNTVTFERERSRSPFKMLGSSGKRSNSSTPFANNNNDGNNINDFKNKKLTTV 941

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYSIVNHFGT 1453
            K++NF+T+P+ILVIHLSRF YDLTKKN+ V++YPLILNI+LKN+E  K+RL+ +VNH GT
Sbjct: 942  KTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGT 1001

Query: 1454 LISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYE 1513
            L+SGHYTSLVNK+L H +  G+ KWYYFDDE+VK D  HG   N    +SSS+VYVLFYE
Sbjct: 1002 LVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKN--LKISSSDVYVLFYE 1059

Query: 1514 RIFD 1517
            R+ D
Sbjct: 1060 RVHD 1063

 Score =  203 bits (517), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 170/484 (35%), Positives = 256/484 (52%), Gaps = 57/484 (11%)

Query: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64
           + PEYS EL + V+++Y E+++  Y +L+LEKL+DLLEH  YL E Y + +   +    +
Sbjct: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPNDAL 67

Query: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124
           TA+++G +Y++LIIPQS++F TRN SYSIY DLK+ YE++ NM NV+L+V  ++G V+  
Sbjct: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127

Query: 125 YLS-GEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGA 183
            +    G E    R T +KRA+S+ + D   L+  +  LS+E +   G       TE   
Sbjct: 128 SVKHAVGIEH---RIT-KKRAFSVPAND---LSGQVASLSLENAGPHGHGFKASFTE--- 177

Query: 184 FGQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAAEFS 243
                +D E    VW+APNLEP+DQLKLA+     P+          +SG + +S    S
Sbjct: 178 -----EDAEQSSPVWTAPNLEPNDQLKLALLPEVIPT------PIYPESGRKTSSPVRPS 226

Query: 244 VLDEEW-VSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYPIC-- 300
           VL E+   +    G  S SL             PS G+    +DR  TH +D  + I   
Sbjct: 227 VLLEDVPYNCYDGGASSASLN------------PSFGE--ITVDRSITHRKDSYHSIYMV 272

Query: 301 --------NDGVVPCEN----SSIMWLYESSSIKCLDLLSKLTSS-ERSSMLLIDLRLPK 347
                   ND ++  E      S+  L + S I   +L S L++S ER  +LLIDLR+P+
Sbjct: 273 DSDTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPR 332

Query: 348 RYEYSHILAENVINIDPELLWDDEKGAPVSSVKELE-LVIDNHLFRSRRQFATIVCYTDN 406
           R E +HI+A N++ IDP LLWD +   PV     LE L+ +N +F +R +F  +V YTD 
Sbjct: 333 RSEINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDV 392

Query: 407 YTYMQIDXXXXXXXXXXXXXGRPQL---VLKTLSGGYEQWKSFLKELKRTESIILSDFLW 463
            T+M ++              +      V   L GGYE+WK  L    +   + + D+L+
Sbjct: 393 KTFMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLY 452

Query: 464 KRPH 467
            RP+
Sbjct: 453 -RPY 455

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
            YIL156W (REAL)
          Length = 1062

 Score =  454 bits (1168), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 244/483 (50%), Positives = 309/483 (63%), Gaps = 56/483 (11%)

Query: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE 1146
            + IPTIE S N YV+LSITGLRN+ NTCYINSM+QCLF+   FR LF+S+KY  YL+   
Sbjct: 584  YHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSR 643

Query: 1147 MDTM-----SRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXX 1201
             + +     S S  MLF KMY+NGGCSVVP+GFLK+ N L+PDL+IP  QQDTQ      
Sbjct: 644  GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMIL 703

Query: 1202 XXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQM 1261
                    S+   V+NDY +LLL+D   L V + +Y  WFD+N+  NG+SPIDD+FQGQM
Sbjct: 704  LDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQM 763

Query: 1262 ENQLSCQRCGYSSYTYSTFYVLSLALPNPVAK--AFGK--TKKLRLEDCINFFTCDEVLS 1317
            EN L C+RCGY+++ YSTFYVLSLA+P    K    G+   K+++LEDCIN FT DEVLS
Sbjct: 764  ENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLS 823

Query: 1318 DQNAWDCPRCC-------------------------SPSDYMSYDHKGKRKISTSF-ESL 1351
             +NAWDCPRC                            S + +   + KR+    F +S 
Sbjct: 824  GENAWDCPRCGPTASTSLSASASALENDSNIVKSRKKKSRFFTLHTRSKRRHLDFFGDSS 883

Query: 1352 NGGNS----------SRS--KLFKFGYKMRSRSEAPKFSSKLSD-----KVSNGKPATVK 1394
            N   S          SRS  K+   G K RS S  P F++  +D        N K  TVK
Sbjct: 884  NESTSNNPVHFERERSRSPFKMLGGGGK-RSHSNTP-FANSSNDGNNFNDFKNKKLTTVK 941

Query: 1395 SLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYSIVNHFGTL 1454
            ++NF+T+P+ILVIHLSRF YDLTKKNN V++YPLILNI+LKN++  K+RL+ +VNH GTL
Sbjct: 942  TINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTL 1001

Query: 1455 ISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYER 1514
            ISGHYTSLVNK+L H +  G+ KWYYFDDE+VK D  HG   +    +SSS+ YVLFYER
Sbjct: 1002 ISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHG--SDKSLKISSSDAYVLFYER 1059

Query: 1515 IFD 1517
            + D
Sbjct: 1060 VHD 1062

 Score =  197 bits (502), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 161/488 (32%), Positives = 252/488 (51%), Gaps = 65/488 (13%)

Query: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64
           + PEYS EL + V ++Y E+++  Y +L+LEKL+DLLEH  YL E Y + +   +    +
Sbjct: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPNDAL 67

Query: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124
           TA+V+G +Y++LIIPQS++F TRN SYSIY DLK+ YE++ NM NV+L+V  ++G V+  
Sbjct: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDD 127

Query: 125 YLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGAF 184
            +      ++  R T +KRA+S+   D   L+D L  LS++ +  RG       TE+ A 
Sbjct: 128 SVKHVVGIEH--RIT-KKRAFSVPGID---LSDQLASLSLDAAGPRGHLHKTSSTEEDA- 180

Query: 185 GQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPS-------------------IHDTS 225
                  +    VW+APNLEP+DQLKLA+     P+                   + D  
Sbjct: 181 -------DQSSPVWTAPNLEPNDQLKLALLPEVIPTPAFPESGRKTSTPVRQSVLLEDVP 233

Query: 226 DSKTKDSGLENNSAAEFS-VLDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDV 284
            +   + G   +S   F  +  +  V+ R+  + S  + VDS   K         D++D+
Sbjct: 234 YTHNDNDGTSASSDQPFGEITADRSVTHRKDSYHSVYM-VDSDTFK--------SDNDDL 284

Query: 285 LDRFYTHGQDLRYPICNDGVVPCENSSIMWLYESSSIKCLDLLSKLTS-SERSSMLLIDL 343
           LD            +  DG +     S+  L + S I   +L + L++ SE   +LLIDL
Sbjct: 285 LD------------VETDGFI----QSLEILQKQSIITAPELFTILSNQSESEKLLLIDL 328

Query: 344 RLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVID-NHLFRSRRQFATIVC 402
           R+P+R   ++I+A N++ IDP LLWD +   PV     LE +++ N  F +R +F  +VC
Sbjct: 329 RIPQRSALNNIVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVC 388

Query: 403 YTDNYTYMQID---XXXXXXXXXXXXXGRPQLVLKTLSGGYEQWKSFLKELKRTESIILS 459
           Y+D  T+M ++                 R   V   L GGYE+WK  L    +   I + 
Sbjct: 389 YSDVKTFMTMNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISID 448

Query: 460 DFLWKRPH 467
           D+L+ RP+
Sbjct: 449 DYLY-RPY 455

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
            YKR098C (REAL)
          Length = 724

 Score =  418 bits (1074), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 221/448 (49%), Positives = 286/448 (63%), Gaps = 36/448 (8%)

Query: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL---K 1143
            F +P IENS N    LSITGLRN  NTCYINSM+QCLFST+ FR+LFL+ KY  +L   K
Sbjct: 278  FKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLENEK 337

Query: 1144 SPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXX 1203
             P+   +S S Y+LF+KMY+NGG +++P+GFLK+C  L+PDL IP  QQDTQ        
Sbjct: 338  YPKGLQLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMIILA 397

Query: 1204 XXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMEN 1263
                  S+  +V+  YS L+L+D   L V+ ++Y KW ++ +  +GLSPID +FQGQMEN
Sbjct: 398  RIHEELSN-NNVTKYYSDLILNDATALQVNPSKYQKWCEETVLSDGLSPIDHIFQGQMEN 456

Query: 1264 QLSCQRCGYSSYTYSTFYVLSLALPNPVAKAF-GKTKKLRLEDCINFFTCDEVLSDQNAW 1322
             L CQRCG SSY+YSTFYVLSLA+P     +F  K+KK++LEDCINFFT DE LSD NAW
Sbjct: 457  ILKCQRCGNSSYSYSTFYVLSLAIPKASLYSFTSKSKKIKLEDCINFFTSDEELSDDNAW 516

Query: 1323 DCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRS-----EAPKF 1377
            DCP+C +    +  D              N     RS LF    + RS+S          
Sbjct: 517  DCPKCRTAEYKLKKDE-------------NLSQKKRSILFNLHSRPRSKSPRHRHHHHHH 563

Query: 1378 SSKLSDKVSNGKPA------------TVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVS 1425
              K  D   N                T+KSL+FI +P ILVIHLSRF YDLTKKNN V++
Sbjct: 564  RHKNDDAKKNDDATKNSKKWKSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNNTVIT 623

Query: 1426 YPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEI 1485
            YPLILNI+LKN++V +++LY+ VNH G LI+GHYTS+VNKE +HEI   +Q W  FDD++
Sbjct: 624  YPLILNIILKNNKVVRYKLYATVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDV 683

Query: 1486 VK-FDTNHGDYDNGIASVSSSNVYVLFY 1512
            +K    +  D++ G   +SS+ VYVLFY
Sbjct: 684  IKQHHKDRDDFETGRTEISSNEVYVLFY 711

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/136 (41%), Positives = 80/136 (58%), Gaps = 3/136 (2%)

Query: 12  ELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGITAYVVGA 71
           ++   V EVY  +++  Y +LRL+KL  LLEH AYL + Y   L   Q +  +TA++VG 
Sbjct: 7   QILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVGG 66

Query: 72  FYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQLYLSGEGD 131
           FYLYL+IP S++F TRN  YS Y  LK  Y+ +  M  V+ LV  +   ++   LS   D
Sbjct: 67  FYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQCLS---D 123

Query: 132 EKYGARFTGRKRAYSM 147
            K  +R   RKRAYS+
Sbjct: 124 SKRISRSMKRKRAYSL 139

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
            YKR098C (REAL)
          Length = 712

 Score =  413 bits (1062), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/448 (50%), Positives = 292/448 (65%), Gaps = 38/448 (8%)

Query: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKS-- 1144
            F  PTIE+S      LSITGL+N  NTCYINS++QCLF ++ FR+LFL+ KY  +LK+  
Sbjct: 274  FEPPTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEE 333

Query: 1145 -PEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXX 1203
             P+   +SRS Y LF+KMY NGG ++VP+GFLKMC  L+PDL IP  QQDTQ        
Sbjct: 334  YPKEVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILA 393

Query: 1204 XXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMEN 1263
                  S+ E+V+  Y  L+ +D   L V+  +Y KW+++ I  +GLSPID +F+GQMEN
Sbjct: 394  RIHEELSN-ENVTKYYCDLVSYDTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQMEN 452

Query: 1264 QLSCQRCGYSSYTYSTFYVLSLALPNPVAKAF-GKTKKLRLEDCINFFTCDEVLSDQNAW 1322
             L CQRCG SS++YSTFYVLSLA+P     +F  K+KK++LEDCIN FT DE L+  NAW
Sbjct: 453  ILKCQRCGNSSFSYSTFYVLSLAIPKNSVHSFTSKSKKIKLEDCINLFTSDEELTGDNAW 512

Query: 1323 DCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSS---RSKLFKFGYKMRSRSEAPKF-- 1377
            DCP C               K+ T      G NSS   RS LF F    RSRS++P    
Sbjct: 513  DCPEC----------RIDDSKLKT------GENSSQKKRSPLFSF--HSRSRSKSPHHHH 554

Query: 1378 ---------SSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPL 1428
                     ++K S+K  + +  T+KSL+FI +P ILVIHLSRF YDLTKKNN V++YPL
Sbjct: 555  HYHHHGSDNTTKNSNKWKSKRLTTIKSLDFIFLPPILVIHLSRFYYDLTKKNNAVITYPL 614

Query: 1429 ILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDE-IVK 1487
            ILNI+LKN++V +++LY  VNH G LI+GHYTS+VNKE +HEI   KQ W  FDD+ I++
Sbjct: 615  ILNIILKNNKVVRYKLYGTVNHSGNLITGHYTSVVNKERSHEIGLNKQVWVTFDDDFIIQ 674

Query: 1488 FDTNHGDYDNGIASVSSSNVYVLFYERI 1515
               +   ++ G   +SSS VYVLFYER+
Sbjct: 675  HHKDRDGFEAGKTKMSSSEVYVLFYERM 702

 Score = 89.0 bits (219), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 83/137 (60%), Gaps = 5/137 (3%)

Query: 12  ELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESY-RELLGRGQVEAGITAYVVG 70
           ++   V +VY  +++  Y +LRL+ L  L++H ++L + Y R+L    +VEA +TA+++G
Sbjct: 7   QILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEA-LTAFIIG 65

Query: 71  AFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQLYLSGEG 130
            +YLYLIIPQS++F TR+  YS Y  LK  Y+ +  M  V+ LV  +  S++  YLS   
Sbjct: 66  GYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQYLS--- 122

Query: 131 DEKYGARFTGRKRAYSM 147
           D         RKRAYS+
Sbjct: 123 DSNRITVTITRKRAYSL 139

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
            YKR098C (REAL)
          Length = 721

 Score =  409 bits (1050), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 217/442 (49%), Positives = 288/442 (65%), Gaps = 32/442 (7%)

Query: 1089 IPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL---KSP 1145
            +PTIE+S +    LSITGL+N  NTCYINS++QCLF T+ FR+LFL+ KY  +L   K P
Sbjct: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346

Query: 1146 EMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXX 1205
                +SRS Y+LF+KMY+NGG ++ P+GFLKMC  L+PDL IP  QQDTQ          
Sbjct: 347  REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406

Query: 1206 XXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQL 1265
                S+  +V+  Y  L+ +D     V+ ++Y KW++ ++  +GLSPID +F+GQMEN L
Sbjct: 407  HEELSN-GTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465

Query: 1266 SCQRCGYSSYTYSTFYVLSLALPNPVAKAF-GKTKKLRLEDCINFFTCDEVLSDQNAWDC 1324
             CQRCG SS++YSTFYVLSLA+P     +F  K+KK++LEDCIN FT DE LS  N+WDC
Sbjct: 466  KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525

Query: 1325 PRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKF------- 1377
            P C +       D K K         +N   S + K   F +  RSRS++P         
Sbjct: 526  PNCGTT------DLKTK---------INESTSQKKKSTFFSFHSRSRSKSPHHHHHHHHH 570

Query: 1378 ----SSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV 1433
                + K S K ++ K  TVKS +FI +P ILVIHLSRF YDLT+KNN V++YPLILN++
Sbjct: 571  SHDNTEKHSKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI 630

Query: 1434 LKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHG 1493
            LKN++V +++LY  VNH G L++GHYTS VNKE NHEI   +Q W  FDD+ +K   +H 
Sbjct: 631  LKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIK-QHHHD 689

Query: 1494 DYDNGIASVSSSNVYVLFYERI 1515
            D++ G   VSSS VYVLFYER+
Sbjct: 690  DFEAGKTEVSSSEVYVLFYERM 711

 Score = 92.4 bits (228), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 75/132 (56%), Gaps = 3/132 (2%)

Query: 16  FVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGITAYVVGAFYLY 75
            V  VY  +++  Y +LRL+ L  LL+H A+L E Y       Q    +TA+++G +YLY
Sbjct: 11  LVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIGGYYLY 70

Query: 76  LIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQLYLSGEGDEKYG 135
           L+IPQS++F TRN  YS Y  LK  Y+ +  M  V+ +V  +   ++  YLS   D    
Sbjct: 71  LVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLS---DSNRI 127

Query: 136 ARFTGRKRAYSM 147
           +R   RKRAYS+
Sbjct: 128 SRTITRKRAYSL 139

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
            UBP11Ubiquitin-specific protease that cleaves ubiquitin
            from ubiquitinated proteins
          Length = 717

 Score =  405 bits (1041), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/444 (48%), Positives = 293/444 (65%), Gaps = 31/444 (6%)

Query: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL---K 1143
            +++P IE+S +    LSITGL+N  NTCYINS++QCLF T+ FR+LFL+ KY  +L   K
Sbjct: 280  YNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNK 339

Query: 1144 SPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXX 1203
             P+   +SRS Y+LF+KMY+NGG +++P+ FLKMC  L+PDL IP  QQDTQ        
Sbjct: 340  YPKEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLA 399

Query: 1204 XXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMEN 1263
                  S+ E+V   Y  L+ +D   L V+ ++Y KW+++N+  +GLSPID +++GQ+EN
Sbjct: 400  RIHEELSN-ENVVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLEN 458

Query: 1264 QLSCQRCGYSSYTYSTFYVLSLALPNPVAKAF-GKTKKLRLEDCINFFTCDEVLSDQNAW 1322
             L CQRCG SSY+YSTFYVLSLA+P     +F  K++K++LEDCIN FT DE LS  NAW
Sbjct: 459  ILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAW 518

Query: 1323 DCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKF----- 1377
            DCP C         D K K++  TS          + K   FG+  RSRS++P       
Sbjct: 519  DCPNC------RITDSKSKKEEITS---------QKKKSTIFGFHSRSRSKSPHHHHHHH 563

Query: 1378 -----SSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI 1432
                 S+K + K ++ K  T+KSL+FI +P ILVIHLSRF YDLTKKN+ V++YPLILNI
Sbjct: 564  HSSDDSTKNAKKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNI 623

Query: 1433 VLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDE-IVKFDTN 1491
            +LKN +V +++LY  VNH G LI+GHYTS+VNKE +HEI   +Q W  FDD+ I +   +
Sbjct: 624  ILKNGKVIRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKD 683

Query: 1492 HGDYDNGIASVSSSNVYVLFYERI 1515
              +++ G   +SS  VYVLFYER+
Sbjct: 684  RNNFEAGKTEMSSDEVYVLFYERM 707

 Score = 89.0 bits (219), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 78/137 (56%), Gaps = 5/137 (3%)

Query: 12  ELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGITAYVVGA 71
           ++   V +VY  +++  Y +LRL+ L  LL+H A+L   Y   L   Q    +TA+++G 
Sbjct: 7   QILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIGC 66

Query: 72  FYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQLYLSGEGD 131
           +YLYLIIPQS++F TRN  YS Y  LK  Y+ +  M  V+ +V  +   ++  YL+    
Sbjct: 67  YYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLA---- 122

Query: 132 EKYG-ARFTGRKRAYSM 147
           E  G  R   RKRAYS+
Sbjct: 123 ESNGICRTIKRKRAYSL 139

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
            YIL156W
          Length = 846

 Score =  380 bits (975), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/434 (47%), Positives = 282/434 (64%), Gaps = 18/434 (4%)

Query: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE 1146
            + +P + +S N YV LSI+GLRN+ NTCYINSMLQCLF+T+AFRNLFLSN+Y  Y+ +  
Sbjct: 428  YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKV 487

Query: 1147 MDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXX-XXX 1205
               +S SF++LFRKMY+NGGC+V+P  FLK CN L+PDLRIP  QQDTQ           
Sbjct: 488  DPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQLH 547

Query: 1206 XXXXSSIESVSNDYSHLLLHDNVRLYVDDA-QYNKWFDQNIDQNGLSPIDDLFQGQMENQ 1264
                S+ + + +++  L+ +D   + V++A +Y KWF ++++  GLS I ++FQGQ+EN 
Sbjct: 548  NELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLENS 607

Query: 1265 LSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDC 1324
            L CQRC Y+S  YS F  LSL++PN   K     K + LEDCI+ F  +E+L+ +NAW+C
Sbjct: 608  LECQRCNYTSTNYSNFCTLSLSIPNKRRKF---RKLVDLEDCISLFIENEMLTGENAWNC 664

Query: 1325 PRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDK 1384
            P+C S S+  +     KRK    F+     N S + L    Y   S S+  KFS K    
Sbjct: 665  PKCSSSSNNNT----SKRKSRGFFKFSKHKNRSHNDLTFSEYNHNSSSDDVKFSKK---- 716

Query: 1385 VSNGKPATVKSLNFITMPRILVIHLSRF-IYDLTKKNNIVVSYPLILNIVLKNSEVAKFR 1443
                K  T KS +FI +P +L+IHLSRF +  L  KNN  ++YP IL I LKN E  +F+
Sbjct: 717  ----KLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRFK 772

Query: 1444 LYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVS 1503
            LY +VNHFG L +GHYTSL+NKE +H+++  +QKW+YFDDE VK   N+ D D  +  +S
Sbjct: 773  LYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRIS 832

Query: 1504 SSNVYVLFYERIFD 1517
            SS+VYVLFYE+I +
Sbjct: 833  SSDVYVLFYEKIIE 846

 Score = 62.8 bits (151), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 94/207 (45%), Gaps = 62/207 (29%)

Query: 12  ELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGITAYVVGA 71
           EL + V  +Y   ++  Y++L   + IDLLE+   L E +     +G  ++ + ++++G 
Sbjct: 15  ELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFL----KGNTDS-LDSFIIGY 69

Query: 72  FYLYLIIPQSIEF--HTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQLYLSGE 129
           FY+ L+IP S      + N   +IY DLK++YES PN+ +++ ++ ++  ++        
Sbjct: 70  FYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENI-------- 121

Query: 130 GDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGAFGQQQQ 189
                            +QS D            ++  S+                 Q +
Sbjct: 122 -----------------LQSFD------------VDAPSSHS---------------QHE 137

Query: 190 DDEWED---TVWSAPNLEPDDQLKLAV 213
           +D   D   T+W AP LEP+DQLKLA+
Sbjct: 138 EDNTADSSTTIWQAPFLEPNDQLKLAI 164

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 74/165 (44%), Gaps = 5/165 (3%)

Query: 301 NDGVVPCENSSIMWLYESSSIKCLDLLSKLTS-SERSSMLLIDLRLPKRYEYSHILAENV 359
           ND  +  E++ +  LYE   I   +L S L++ S+R  +L+IDLRL + +    I + N+
Sbjct: 195 NDKTINDEDTYLKHLYEECFITPHELFSILSNPSDRLKILIIDLRLSRYFNLQTIRSPNL 254

Query: 360 INIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTDNYTYMQIDXXXXXX 419
           I  DP  LW++    PV     L     N LF+    F+ I+ Y+DN T    +      
Sbjct: 255 IKFDPIELWNNRDQTPVLHRTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNF 311

Query: 420 XXXXXXXGRPQLVL-KTLSGGYEQWKSFLKELKRTESIILSDFLW 463
                       V    L GG+E+W+  +        I  S++++
Sbjct: 312 SFFKLLMSSSMKVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIF 356

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
            YIL156W possible pseudogene; NNN added to avoid internal
            stop codon
          Length = 656

 Score =  337 bits (863), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 201/465 (43%), Positives = 267/465 (57%), Gaps = 59/465 (12%)

Query: 1084 IPHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNK-YAHYL 1142
            I   ++P I+ + N    LS+ GLRN  NTCYINSM+QCLF T   R+LF+S   Y  ++
Sbjct: 217  IKKHTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFI 276

Query: 1143 KSPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXX 1202
            K      +S  F  L   MY NGG SV+P  FL+  + L+PDL IP  QQDTQ       
Sbjct: 277  KKDAETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILL 336

Query: 1203 XXXXXXXSSIES-VSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQM 1261
                      +  +SN+Y    + D++ L     +Y  W   N+  NG SPID +FQGQ+
Sbjct: 337  DILHDELVYTDDLISNNY----VSDDINL---GKEYMPWLQNNLKANGKSPIDLIFQGQI 389

Query: 1262 ENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNA 1321
            EN L CQRCG +SY YS FY+LSLA+P  +AK   K + ++LEDCINFFT DE+L+ +NA
Sbjct: 390  ENCLQCQRCGNTSYNYSMFYMLSLAIPK-IAKENSKNR-VKLEDCINFFTSDEILTGENA 447

Query: 1322 WDCPRCCSPSDYMSYDHKG------KRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEA- 1374
            W+CP+CC P+   +YD          R  + S   LN         FK  +K+ S S   
Sbjct: 448  WNCPKCC-PTTIETYDEADSPATVENRVKNKSINPLN--------FFKL-HKVLSPSSGN 497

Query: 1375 ----------PKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVV 1424
                       K   K  +K  N K  T+K LNFI +P ILVIHLSRF Y+ TKKNN V+
Sbjct: 498  HHRHHHHHHHHKSDGKNKNKYKNEKLITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVI 557

Query: 1425 SYPLILNIVLKNS-EVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDD 1483
            +YPLILNI++KN+ +V K++LY ++NH G L  GHYTS+VNK+LNH +   +Q+WY FDD
Sbjct: 558  TYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDD 617

Query: 1484 EIVK-------------FDTNHGDYDNGIASVSSSNVYVLFYERI 1515
            E++K             F+    ++D       SS VYVLFYERI
Sbjct: 618  EVIKKLNSNNTINKKESFNIEKDEFD-------SSKVYVLFYERI 655

 Score = 89.0 bits (219), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 88/159 (55%), Gaps = 15/159 (9%)

Query: 12  ELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLG-RGQVEAGITAYVVG 70
           +L   V+ ++  +++D Y KLRLE+L DLL+H  YLL+ ++     + +      A+V G
Sbjct: 29  DLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQATLAFVNG 88

Query: 71  AFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQLYLSGEG 130
           +FYL+LIIP  ++F T+N  ++ Y DLK  YE   +M N++  V  K  S+++  LSG  
Sbjct: 89  SFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLSGIN 148

Query: 131 DEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSST 169
                 R   +KRAY+  S  S         LS +RSST
Sbjct: 149 ------RRILKKRAYTEPSIRSG--------LSRDRSST 173

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
            weakly similar to uniprot|P36026 Saccharomyces cerevisiae
            YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  327 bits (839), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 180/464 (38%), Positives = 266/464 (57%), Gaps = 40/464 (8%)

Query: 1079 LIRNPI------PHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNL 1132
            L ++PI        +++P I N+  E   LS+ G+RNM NTCY+NSMLQCLF ++ FR+L
Sbjct: 181  LAKSPIDIDHDSKQYTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDL 240

Query: 1133 FLSNKYAHYLKSPEMDTMS--RSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYG 1190
            FL++K+  +      +++S      +LF+KMY NGGC+++P  F++ C  L+PD +IP+ 
Sbjct: 241  FLTDKFEMFKAETNSESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHC 300

Query: 1191 QQDTQXXXXXXXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGL 1250
            QQDTQ              ++  +   D S +    N R    +  Y +W+++ I +N L
Sbjct: 301  QQDTQEFLMFVLERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNL 360

Query: 1251 SPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFF 1310
            SPID LF+G +E++L C+ C  S+ T+S+FY+LSL +P   +  F K+K +RLEDCIN F
Sbjct: 361  SPIDLLFRGDVESKLICKHCNESASTFSSFYILSLNIPKEKSSLFFKSKTIRLEDCINLF 420

Query: 1311 TCDEVLSDQNAWDCPRCCSPSDY------MSYDHK----GKR-KISTSFESLNGGNSSRS 1359
            T  E+L+ +N+W CP C + + Y       +Y  K    GK  K    F  +  G + R+
Sbjct: 421  TRKEILTGENSWACPSCETKARYNVIDNDKTYQQKHTNIGKHSKFPRFFSHIEAGKTERN 480

Query: 1360 KLFKFGYKMRSRSEAPKFSSKLSDKVSN-------GKPATVKSLNFITMPRILVIHLSRF 1412
                        S A KFS    D + N        K  T+ S++F+++P ILVIHLSRF
Sbjct: 481  ------------SGANKFSQLKYDNLENEQRHRQQKKSETILSVSFVSLPPILVIHLSRF 528

Query: 1413 IYDLTKKNNIVVSYPLILNI-VLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEI 1471
             YD++KKN   +SYP+ L +  L NS V  +RLY  +NH G+   GHYT+LVNKE NH  
Sbjct: 529  CYDISKKNTSNISYPMSLTVETLDNSSVT-YRLYGTINHIGSPRGGHYTALVNKEKNHFT 587

Query: 1472 SHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYERI 1515
                QKW  FDD++V   T+       I S+++++ YVLFYERI
Sbjct: 588  DLELQKWVEFDDDLVFNRTDFFKSKTEINSITNNDAYVLFYERI 631

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%)

Query: 13  LQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGITAYVVGAF 72
           L+  V +V+  +++  Y  L L K+  LL   A  L+    L     +E+    Y  G F
Sbjct: 13  LKSLVSQVFETSIKKQYWVLTLCKVSQLLGQAAKYLDKTETLGQEKLLESSYMNYAAGCF 72

Query: 73  YLYLIIPQSIEFHTRNLSYSIYVDLKRHY 101
           Y+YL++P + +F   +  Y  Y+ LK +Y
Sbjct: 73  YIYLLVPNANQFQLEDTEYGTYLQLKNNY 101

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
            {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156W UBP7 Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1044

 Score =  257 bits (657), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 168/247 (68%), Gaps = 6/247 (2%)

Query: 1086 HFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSP 1145
             FS+PTIE S N+YVALSITGLRN+  TCYINSMLQCLF+T+ FR+LF  + Y  +  +P
Sbjct: 580  QFSVPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFF-NP 638

Query: 1146 EMD---TMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXX 1202
            E++    +S+SF +L RKMYMNGGCSVVP+ FLK+CN L+PD  IP  QQD Q       
Sbjct: 639  ELEDTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTI 698

Query: 1203 XXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQME 1262
                   S+   V N +  LLL+D     V   +Y +WF+ ++     SPID +FQGQ+E
Sbjct: 699  DRLHDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLE 758

Query: 1263 NQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKK--LRLEDCINFFTCDEVLSDQN 1320
            N L C++CGYSSY+YSTFY+LSLA+P P +     +K   + LEDCIN FT DEV+S +N
Sbjct: 759  NGLHCKKCGYSSYSYSTFYILSLAIPKPSSSFLSSSKGNWVNLEDCINMFTSDEVMSREN 818

Query: 1321 AWDCPRC 1327
            AWDCP+C
Sbjct: 819  AWDCPKC 825

 Score =  199 bits (507), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 152/489 (31%), Positives = 253/489 (51%), Gaps = 44/489 (8%)

Query: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64
           + PEYS EL + VE++Y ++++  Y  L+LE L DL++H  YL ES+ + +     +  +
Sbjct: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67

Query: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124
           TAY++G ++LYLIIPQS +F  RN ++ ++  LK+ YE+  NM NV+L+V  +V SV+  
Sbjct: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127

Query: 125 YLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGAF 184
                 D         RKRA+S  S D+  L   + +L++   +  G+T+     ++  F
Sbjct: 128 DFRKLKD-------VERKRAFS--SPDNG-LDSEISRLTL---AGNGSTL-PKMHKKWDF 173

Query: 185 GQQQQDDEWEDT----VWSAPNLEPDDQLKLAVSYSHSPSIH-DTSDSKTKDSGL----- 234
            +   +    DT    +W APNLEP+DQLKLA+  +   S+  DT   +  +  L     
Sbjct: 174 IRSDSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGY 233

Query: 235 -ENNSAAEFSVLDEEWVSE---RRSGFMSQSLQVDSSDNKNN------DELPSIGDHNDV 284
            ++ S +E +V ++E   +      G   ++ Q+   D++ +      D   ++    D 
Sbjct: 234 PKHKSKSELTVEEKEHPQQDHRHHHGVQQETHQLGKDDDEQHFWDAKVDR--AVAHRKDS 291

Query: 285 LDRFYTHGQDLRYPICNDGVVP-CENSSIMWLYESSSIKCLDLLSKLTS-SERSSMLLID 342
               Y    D  +        P  E  ++  L + S I   +L S L++  ER+ +LLID
Sbjct: 292 YHSVYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLID 351

Query: 343 LRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVC 402
           LRL  RY++++ILA N++ IDP +LWD     PV+ +  L+  + N +F  R  F  IV 
Sbjct: 352 LRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVY 411

Query: 403 YTDNYTYMQIDXXXXXXXXXXXXXGRPQLVLKTLS----GGYEQWKSFLKELKRTESIIL 458
           YTD  TYM++D              + ++ L++L     GGYE+WK+ LK+      I +
Sbjct: 412 YTDMKTYMEMDFDYLFVFYNLVVASQ-EVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRV 470

Query: 459 SDFLWKRPH 467
            D+L+ RP+
Sbjct: 471 DDYLY-RPY 478

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  208 bits (530), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 154/476 (32%), Positives = 246/476 (51%), Gaps = 40/476 (8%)

Query: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64
           + PEYS ELQ+ V+++Y  +++    +LRL KLIDLLEH AYLLE++   L  G+ +  +
Sbjct: 11  FTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDAL 70

Query: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124
           +AY+VG +YLYLIIPQS +F T+N SYS+Y D K  Y+++ NM NV  +V  +V S++  
Sbjct: 71  SAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILD- 129

Query: 125 YLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGAF 184
                 + +   R   R RA+S++  D+ K  +T+     ER S+             + 
Sbjct: 130 --KSYQEPEPTKRVIPRGRAFSVKD-DTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSL 186

Query: 185 GQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAAEFSV 244
             +  D      +W+AP+L P+DQLKLA+     P +  T D +  D    N       +
Sbjct: 187 PMELDDST---PLWTAPSLNPNDQLKLALE---QPEL--TLDEQLSDKTQHN-------L 231

Query: 245 LDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYPICND-- 302
           +D+++ +          L V  +D  ++ ++  I      +DR  TH +D  + +  D  
Sbjct: 232 IDDKYNNFTIPLPHQIPLPVKVTDFNHDKKIQKIYP----VDRSETHRKDSYHSVYMDND 287

Query: 303 ---GVVPCENS------SIMWLYESSSIKCLDLLSKLTS-SERSSMLLIDLRLPKRYEYS 352
              G V   +       ++  L + + I C +L S L+  + +  +LLI L LP+R + +
Sbjct: 288 NSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSN 347

Query: 353 HILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTDNYTYMQI 412
           +I+A+N INIDP +LWD E   P+S   +LE ++++ LF  R+ FA +V YTD  TYM+I
Sbjct: 348 YIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMKI 407

Query: 413 DXXXXXXXXXXXXXGRPQLVLKT----LSGGYEQWKSFLKELKRTESIILSDFLWK 464
           +              R   VLKT    L GG E+WK  ++       I   ++L K
Sbjct: 408 NFDYNFTLFYLLTSSRTS-VLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHK 462

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
            YDR069C
          Length = 986

 Score =  135 bits (339), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 122/447 (27%), Positives = 174/447 (38%), Gaps = 117/447 (26%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFR 1159
            + GL NM N+CY+N ++QCL   +    +FL N +  Y+    K      ++R F  L  
Sbjct: 619  MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYVNLNSKLGSKGVLARYFSRLIH 678

Query: 1160 KMYMN------GG--CSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSS 1211
             MY N      GG    V P+ F   C ++    +    QQD Q              + 
Sbjct: 679  TMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHEDLNQ 737

Query: 1212 IESVSNDYSHLLLHDNVR--LYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQR 1269
                          +N+R  L +  A   +W  +       S I DLFQGQ  ++L C+ 
Sbjct: 738  CGGNKRLAELTEEAENLREKLSLRIASSIEW--ERFLTTDFSVIGDLFQGQYASRLQCKT 795

Query: 1270 CGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCS 1329
            CG +S TY  F VLS+ +P+          K  + DC + FT  E L     W CP    
Sbjct: 796  CGKTSTTYQPFSVLSIPVPS------KHISKCSIIDCFDEFTKVENLEVDEQWSCP---- 845

Query: 1330 PSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKVSNGK 1389
                                                   R +S+ P              
Sbjct: 846  ---------------------------------------RCKSKQP-------------- 852

Query: 1390 PATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV------------LKNS 1437
              + K L    +PR L+IHL RF   L K NNI+V YP  L++             L  S
Sbjct: 853  --STKKLTITRLPRNLIIHLKRFDNRLNK-NNILVQYPFTLDLTTFWANDFDGKLPLNVS 909

Query: 1438 EVA--------KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFD 1489
            E+          ++LY +  HFG+L  GHYT+ V+K +       K  WYYFD      D
Sbjct: 910  ELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKGI-------KNGWYYFD------D 956

Query: 1490 TNHGDYDNGIASVSSSNVYVLFYERIF 1516
            T+     N +  ++SS  YVLFY+RI+
Sbjct: 957  TSCRPIKNSMEPITSS-AYVLFYKRIY 982

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 12/90 (13%)

Query: 324 LDLLSK-LTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELL------WDDEKGAPV 376
           LD L + L   + S +L ID+R    +   H    N+I I+P          D EK + +
Sbjct: 179 LDQLDEILRDHDSSQVLFIDVRTRLDFNKGHFKVPNIICIEPVSFKSSYSDHDLEKKSMI 238

Query: 377 SSVKELELVIDNHLFRSRRQFATIVCYTDN 406
           +S  + E+V    LF  R++FA IV Y+++
Sbjct: 239 TSTND-EIV----LFHRRQEFAFIVLYSND 263

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
            YDR069C (REAL)
          Length = 926

 Score =  130 bits (326), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 174/445 (39%), Gaps = 115/445 (25%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRK 1160
             GL N+ N+CY+N ++QC+  T     +FL + YA ++    K      +++ F  L   
Sbjct: 562  VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 1161 MY-----MNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESV 1215
            MY      +   S+ P  F   C ++    +    QQD Q              +   S 
Sbjct: 622  MYKEQVDASKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 680

Query: 1216 S--NDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYS 1273
                + S        +L +  A   +W  +       S I DLFQGQ  ++L C+ CG++
Sbjct: 681  PPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKICGHT 738

Query: 1274 SYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCSPSDY 1333
            S TY  F VLS+ +P  V +      ++ +EDC   FT  E L     W CP C      
Sbjct: 739  STTYQPFTVLSIPIPRKVPQ-----NEITIEDCFKEFTKCENLEVDEQWLCPHC------ 787

Query: 1334 MSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKVSNGKPATV 1393
                   KR+ ST                                          K  TV
Sbjct: 788  ------KKRQPST------------------------------------------KQLTV 799

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV--------------LKNSEV 1439
              L     PR L+IHL RF  +L  KNN  V YP +L++               + + E+
Sbjct: 800  TRL-----PRNLIIHLKRF-DNLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDDEL 853

Query: 1440 A--------KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTN 1491
                     K+ LY +  HFGTL  GHYT+ V K L       ++ W YFDD   K   N
Sbjct: 854  PVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------RKGWLYFDDTKFKPVKN 906

Query: 1492 HGDYDNGIASVSSSNVYVLFYERIF 1516
              D       V++SN YVLFY R++
Sbjct: 907  KTD-------VTNSNAYVLFYHRVY 924

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 11/77 (14%)

Query: 339 LLIDLRLPKRYEYSHILAENVINIDP---ELLWDD---EKGAPVSSVKELELVIDNHLFR 392
           LLID+R    ++ SHI ++N+I ++P   ++ + D   EK + ++S        +  LF+
Sbjct: 210 LLIDIRSRLEFDKSHIASKNIICLEPISFKISYSDHDLEKKSLITSPNN-----EIKLFQ 264

Query: 393 SRRQFATIVCYTDNYTY 409
           SR  F  I+ YTD+  Y
Sbjct: 265 SRNLFKFIILYTDSNEY 281

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
            YDR069C (REAL)
          Length = 927

 Score =  124 bits (310), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 170/445 (38%), Gaps = 115/445 (25%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRK 1160
             GL N+ N+CY+N ++QC+  T     +FL + YA ++    K      +++ F  L   
Sbjct: 563  VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 622

Query: 1161 MYM-----NGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESV 1215
            MY      +   S+ P  F   C ++    +    QQD Q              +   S 
Sbjct: 623  MYKKQVDSSKKDSISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 681

Query: 1216 S--NDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYS 1273
                + S        RL +  A   +W  +       S I DLFQGQ  ++L C+ C ++
Sbjct: 682  PPLKELSQEAETRRERLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKTCNHT 739

Query: 1274 SYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCSPSDY 1333
            S TY  F VLS+ +P   ++      K+ +EDC   FT  E L     W CP        
Sbjct: 740  STTYQPFTVLSIPIPKKNSQ-----NKITIEDCFKEFTKCENLEIDEQWLCP-------- 786

Query: 1334 MSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKVSNGKPATV 1393
                H  KR+ ST                                               
Sbjct: 787  ----HCEKRQPST----------------------------------------------- 795

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV--------------LKNSEV 1439
            K L    +PR L+IHL RF  +L  KNN  V YP +L++               + + E+
Sbjct: 796  KQLTITRLPRNLIIHLKRF-DNLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDDEL 854

Query: 1440 A--------KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTN 1491
                     K+ LY +  HFGTL  GHYTS V K L    S G   W YFDD   +   N
Sbjct: 855  PIRGQIPPFKYELYGVACHFGTLYGGHYTSYVKKGL----SRG---WLYFDDTKYRPAKN 907

Query: 1492 HGDYDNGIASVSSSNVYVLFYERIF 1516
              D  N       SN YVLFY R++
Sbjct: 908  QTDAIN-------SNAYVLFYHRVY 925

 Score = 33.1 bits (74), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 11/78 (14%)

Query: 338 MLLIDLRLPKRYEYSHILAENVINIDPELL------WDDEKGAPVSSVKELELVIDNHLF 391
            LLID+R    ++ SHI  +N+I ++P          D EK + ++S  +     +  LF
Sbjct: 209 TLLIDIRSRLEFKKSHIDFKNIICLEPISFKTSYSDRDLEKKSLITSPND-----EIKLF 263

Query: 392 RSRRQFATIVCYTDNYTY 409
           +SR  F  I+ YTD+  Y
Sbjct: 264 QSRNLFKFIILYTDSNDY 281

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
            DOA4Ubiquitin isopeptidase, required for recycling
            ubiquitin from proteasome-bound ubiquitinated
            intermediates, acts at the late endosome/prevacuolar
            compartment to recover ubiquitin from ubiquitinated
            membrane proteins en route to the vacuole
          Length = 926

 Score =  123 bits (309), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 122/460 (26%), Positives = 179/460 (38%), Gaps = 118/460 (25%)

Query: 1090 PTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSP 1145
            PT  ++Y+   A+   GL N+ N+CY+N ++QC+  T     +FL + YA ++    K  
Sbjct: 550  PTSSHNYDLDFAV---GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLG 606

Query: 1146 EMDTMSRSFYMLFRKMY---MNGG--CSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXX 1200
                +++ F  L   MY   ++G    S+ P  F   C ++    +    QQD Q     
Sbjct: 607  SKGILAKYFARLVHMMYKEQVDGSKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQF 665

Query: 1201 XXXXXXXXXSSIESVS--NDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQ 1258
                     +   S     + S        +L +  A   +W  +       S I DLFQ
Sbjct: 666  LLDGLHEDLNQCGSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQ 723

Query: 1259 GQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSD 1318
            GQ  ++L C+ C ++S TY  F VLS+ +P   ++       + +EDC   FT  E L  
Sbjct: 724  GQYASRLKCKVCSHTSTTYQPFTVLSIPIPKKNSR-----NNITIEDCFREFTKCENLEV 778

Query: 1319 QNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFS 1378
               W CP            H  KR+ ST                                
Sbjct: 779  DEQWLCP------------HCEKRQPST-------------------------------- 794

Query: 1379 SKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV----- 1433
                           K L    +PR L++HL RF  +L  KNN  V YP +L++      
Sbjct: 795  ---------------KQLTITRLPRNLIVHLKRF-DNLLNKNNDFVIYPFLLDLTPFWAN 838

Query: 1434 ---------LKNSEVA--------KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQ 1476
                     + + E+         K+ LY +  HFGTL  GHYT+ V K L       K+
Sbjct: 839  DFDGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KK 891

Query: 1477 KWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
             W YFDD   K   N  D  N       SN YVLFY R++
Sbjct: 892  GWLYFDDTKYKPVKNKADAIN-------SNAYVLFYHRVY 924

 Score = 32.7 bits (73), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 11/78 (14%)

Query: 338 MLLIDLRLPKRYEYSHILAENVINIDP---ELLWDD---EKGAPVSSVKELELVIDNHLF 391
           +LLID+R    +  SHI  +N+I ++P   ++ + D   EK + ++S        +  +F
Sbjct: 209 ILLIDIRSRLEFNKSHIDTKNIICLEPISFKMSYSDHDLEKKSLITSPNS-----EIKMF 263

Query: 392 RSRRQFATIVCYTDNYTY 409
           +SR  F  I+ YTD   Y
Sbjct: 264 QSRNLFKFIILYTDANEY 281

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
            Ashbya gossypii AFR007W
          Length = 851

 Score =  118 bits (295), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 115/452 (25%), Positives = 174/452 (38%), Gaps = 130/452 (28%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRK 1160
             GL N  N+CY++ ++QCL  T     +FL+N Y +++    +      ++R F  L  +
Sbjct: 486  VGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGVLARYFSQLIHQ 545

Query: 1161 MYMNGG----------CSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXS 1210
            MY  G            +V+P+ F   C ++    R    QQD Q              +
Sbjct: 546  MYQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFR-DRSQQDCQEFCQFLLDGLHEDLN 604

Query: 1211 S------IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQ 1264
                   ++ +S     +     +R+     ++ ++   +      S I DLFQGQ  +Q
Sbjct: 605  QCGNNPPLKELSEKAEKMREMMPMRI-ASSIEWERYLTTD-----FSVIVDLFQGQYASQ 658

Query: 1265 LSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDC 1324
            L C+ CG +S TY  F VLS+ +P+        +++  + DC   FT  E L     W C
Sbjct: 659  LRCKVCGRTSTTYQPFSVLSVPVPS--------SRQCTIIDCFTEFTKVETLDLDEQWSC 710

Query: 1325 PRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDK 1384
            P C             KR+ ST                                      
Sbjct: 711  PDC------------KKRQPST-------------------------------------- 720

Query: 1385 VSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI-----------V 1433
                K  T+  L     PR L+IHL RF  ++  KNN+ VSY  +LN+           V
Sbjct: 721  ----KKITITRL-----PRNLIIHLKRFD-NMLNKNNVFVSYSAVLNLTSFWANDYDKKV 770

Query: 1434 LKNSEVA----------KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDD 1483
            + N+ V            ++LY +  H GTL  GHYT+ VNK            W Y+DD
Sbjct: 771  MNNNNVELPSRGQVPPFNYQLYGVACHTGTLYGGHYTAYVNK-------GATLGWCYYDD 823

Query: 1484 EIVKFDTNHGDYDNGIASVSSSNVYVLFYERI 1515
               +   +  +Y        S N YVLFY RI
Sbjct: 824  TNWRQIRSSNEY-------ISQNAYVLFYHRI 848

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 59/136 (43%), Gaps = 9/136 (6%)

Query: 318 SSSIKCLDLLSKLTS-SERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPV 376
            SSI  L L + +T+ +  +S+LLID+R    +   HI  E++I I+P    D      +
Sbjct: 156 GSSISSLMLHNLITTPATATSVLLIDIRPRVDFVNFHIKFESLICIEPVSFKDSHSDIDI 215

Query: 377 SSVKELELVIDNH--LFRSRRQFATIVCYT-----DNYTYMQIDXXXXXXXXXXXXXGRP 429
           +  K +    DN   LF+ R +F  I+ YT     ++Y   Q +                
Sbjct: 216 AK-KSMITSPDNEIALFQERDKFEYIILYTQGSEKNDYNIHQQEVLVDLLINRSFQKSLY 274

Query: 430 QLVLKTLSGGYEQWKS 445
              + TL GG+  W +
Sbjct: 275 NTKILTLDGGFSSWST 290

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
            Anc_8.188 YDR069C
          Length = 978

 Score =  117 bits (294), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 114/441 (25%), Positives = 178/441 (40%), Gaps = 97/441 (21%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFR 1159
            I GL NM N+CY+N ++QC+  T     +FL+N Y  ++    +      ++++F  L  
Sbjct: 604  IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLSSRLGSKGVLAKNFARLIH 663

Query: 1160 KMYMNGGCSVV------------PSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXX 1207
             MYM+   S +            P  F   C ++    R    QQD+Q            
Sbjct: 664  TMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFR-DSQQQDSQEFCQFLLDGLHE 722

Query: 1208 XXSS------IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQM 1261
              +       ++ +S +   L  + ++R+     ++ ++   +      S I DLFQGQ 
Sbjct: 723  DLNQCGGNPPLKELSLEAERLRENLSLRI-ASSIEWERYLTTD-----FSVIVDLFQGQY 776

Query: 1262 ENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFG-KTKKLRLEDCINFFTCDEVLSDQN 1320
             ++L C+ C ++S TY +F VLS+ LP    K F  +T+K+ L DC N FT  E L    
Sbjct: 777  ASRLECKVCHHTSTTYQSFSVLSVPLP----KKFDPQTRKIDLIDCFNEFTKIENLEVDE 832

Query: 1321 AWDCPRCCS--PSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKM-RSRSEAPKF 1377
             W CP C    PS       +  R +    +  +   +  +    + + +  +   A  F
Sbjct: 833  QWSCPTCKKKQPSTKKLTITRLPRNLIIHLKRFDNMLNKNNSFIDYPFNLDLTEFWADDF 892

Query: 1378 SSKLSDKVSNGKPA--TVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLK 1435
               L   VSN  PA   +K  N+                                     
Sbjct: 893  DGNLPPGVSNELPARGQIKPFNY------------------------------------- 915

Query: 1436 NSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDY 1495
                   RLY +  HFG+L  GHYT+ V+K     I +G   WYYFD      DT +   
Sbjct: 916  -------RLYGVACHFGSLYGGHYTAYVDK----GIGNG---WYYFD------DTTYRPL 955

Query: 1496 DNGIASVSSSNVYVLFYERIF 1516
             N    +SSS  YVLFY R++
Sbjct: 956  KNDKEPISSS-AYVLFYTRVY 975

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 13/86 (15%)

Query: 327 LSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWD-------DEKGAPVSSV 379
           L++L  +   S+L+ID+R    +  SHI ++N+I I+P    D       + K    S  
Sbjct: 191 LNELMRNFNDSLLIIDIRSRSEFIKSHIKSKNIICIEPISFKDSYSDYELERKSIITSPN 250

Query: 380 KELELVIDNHLFRSRRQFATIVCYTD 405
            E+       LF +R+ F  IV YT+
Sbjct: 251 NEIR------LFNNRQSFKFIVLYTE 270

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
            to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
            Ubiquitin hydrolase required for recycling ubiquitin from
            proteasome-bound ubiquitinated intermediates acts at the
            late endosome/prevacuolar compartment to recover
            ubiquitin from ubiquitinated membrane proteins en route
            to the vacuole
          Length = 893

 Score =  117 bits (294), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 119/459 (25%), Positives = 175/459 (38%), Gaps = 137/459 (29%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRK 1160
             GL N+ N+CY+N ++QCL  T     +FL++ Y +++    K      +++ F  L   
Sbjct: 523  VGLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHINFNSKLGSKGVLAKYFSQLVHN 582

Query: 1161 MYMNGG----------------CSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXX 1204
            MY                     +V P  F   C T+    R    QQD Q         
Sbjct: 583  MYRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTINSLFR-DCSQQDCQEFCQFLLDG 641

Query: 1205 XXXXXSS------IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQ 1258
                 +       ++ +S +   +    ++R+     ++ ++   +      S I DLFQ
Sbjct: 642  LHEDLNQCGGNPRLKELSEEAEKIREKLSMRI-ASSIEWERYLTTD-----FSVIVDLFQ 695

Query: 1259 GQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSD 1318
            GQ  +QL CQ CG +S TY  F VLS+ LP+         K   + DC   FT  E L  
Sbjct: 696  GQYASQLKCQVCGRTSTTYQPFSVLSVPLPS--------LKSCNILDCFQEFTKVETLEK 747

Query: 1319 QNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFS 1378
               W CP C             KR+ ST                                
Sbjct: 748  DEQWSCPDC------------KKRQPST-------------------------------- 763

Query: 1379 SKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI------ 1432
                      K  T+  L     PR L+IHL RF  ++  KNN+ VSYP  L++      
Sbjct: 764  ----------KKITITRL-----PRNLIIHLKRFD-NMMNKNNVFVSYPHTLDLTPFWAN 807

Query: 1433 ------------VLKNSEVAKF--RLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQK- 1477
                        +    +V  F  +LY++ +H GTL  GHYT+ V+K        G Q+ 
Sbjct: 808  DFDGRLPPGVTELPTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHK--------GSQRG 859

Query: 1478 WYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
            W YFDD     +      DN      +SN YVLFY R++
Sbjct: 860  WCYFDDT----NWRRSRSDN---ECITSNAYVLFYHRVY 891

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 57/128 (44%), Gaps = 13/128 (10%)

Query: 336 SSMLLIDLRLPKRYEYSHILAENVINIDPELLWD---DEKGAPVSSVKELELVIDNHLFR 392
           SS+LLIDLR    +  SHI + +VI I+P    D   D   A  S +      I+  LF 
Sbjct: 174 SSVLLIDLRPRMEFIKSHIKSPSVICIEPISFKDTYSDLDLAKKSMITSPNCEIE--LFS 231

Query: 393 SRRQFATIVCYT--DNYT-YMQIDXXXXXXXXXXXXXGRP--QLVLKTLSGGYEQWKSFL 447
            R  F  IV YT  D  T Y +                +P  ++ +  L GG+E+W   L
Sbjct: 232 KRDTFQFIVLYTHEDGRTQYYKQQQLKLLDLLLSRSFDKPLDKVKVLILEGGFEEW---L 288

Query: 448 KELKRTES 455
           +E+   E+
Sbjct: 289 REIGDCET 296

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
            UBP5Putative ubiquitin-specific protease, closest paralog
            of Doa4p but has no functional overlap; concentrates at
            the bud neck
          Length = 805

 Score =  110 bits (275), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 111/450 (24%), Positives = 177/450 (39%), Gaps = 126/450 (28%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLK----SPEMDTMSRSFYMLFR 1159
            I GL N+ N CY+N +LQCL  T     +FL N Y +++           ++++F +L  
Sbjct: 445  IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSKGLLAKNFAILVN 504

Query: 1160 KMYMNGGCS--------VVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXX------XXX 1205
             M+ +G  +        V    F K+C  + P +     QQD Q                
Sbjct: 505  NMHRHGAFTPPNVRTIPVQTIQFKKICGHINP-MYSDSMQQDCQEFCQFLLDGLHEDLNQ 563

Query: 1206 XXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQL 1265
                  ++ +S++   +      ++ +  A   +W  +       S I DLFQGQ  ++L
Sbjct: 564  NGSKKHLKQLSDEEERM----REKMSIRKASALEW--ERFLLTDFSAIIDLFQGQYASRL 617

Query: 1266 SCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCP 1325
             CQ C ++S TY TF VLS+ +P             R++ C             N  DC 
Sbjct: 618  QCQVCEHTSTTYQTFSVLSVPVP-------------RVKTC-------------NILDCF 651

Query: 1326 RCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKV 1385
            R  +  + +  D +                                   PK   K     
Sbjct: 652  REFTKCERLGVDEQW--------------------------------SCPKCLKK----- 674

Query: 1386 SNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI-----------VL 1434
               +P+T K L    +P+ L+I+L RF   + K NN+ V YP  L++            +
Sbjct: 675  ---QPST-KQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYSLDLTPYWARDFNHEAI 729

Query: 1435 KNSEVA--------KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
             N ++         ++RLY +  H G+L  GHYTS V K         K+ WY+FDD + 
Sbjct: 730  VNEDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYK-------GPKKGWYFFDDSLY 782

Query: 1487 KFDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
            +  T   ++        + + YVLFYERIF
Sbjct: 783  RPITFSTEF-------ITPSAYVLFYERIF 805

 Score = 38.9 bits (89), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 7/83 (8%)

Query: 327 LSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVI 386
           LS +      ++LLID+R    +  +HI  +N+I IDP    D      + SV    L+ 
Sbjct: 152 LSSMLHFHGDALLLIDVRPRSEFVRAHIKCKNIICIDPASFKDSFTDQQIESV---SLIT 208

Query: 387 DNH----LFRSRRQFATIVCYTD 405
             H     F +R +F  I+ YTD
Sbjct: 209 SPHSDITFFSNRDKFKFIILYTD 231

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
            YER144C (REAL)
          Length = 788

 Score =  109 bits (273), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 125/478 (26%), Positives = 184/478 (38%), Gaps = 136/478 (28%)

Query: 1083 PIPH----FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKY 1138
            P+P      S P I+NS   +    I GL NM N CY+N +LQCL  T     +FL N Y
Sbjct: 403  PLPQQNLLVSKPPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTY 462

Query: 1139 AHYLKSPEM----DTMSRSFYMLFRKMYMNGGCSVVPS--------GFLKMC---NTLKP 1183
             +++    M      ++++F  L   M+ +G    + S         F K C   N++  
Sbjct: 463  LNFINFDNMRGSKGLLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHINSIYS 522

Query: 1184 DLRIPYGQQDTQXXXXXXXXXXXXXXSSIESVSNDYSHLLLHDNVR----LYVDDAQYNK 1239
            D      QQD Q              +  ++    +   L  +  R    + +  A   +
Sbjct: 523  DSM----QQDCQEFCQFLLDGLHEDLN--QNGGKKHLKQLSEEEERTRENMSIRKASALE 576

Query: 1240 WFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTK 1299
            W  +       S + DLFQGQ  ++L CQ C ++S TY TF VL  ++P P         
Sbjct: 577  W--ERFLLTDFSAVIDLFQGQYASRLQCQACEHTSTTYQTFSVL--SVPVP--------- 623

Query: 1300 KLRLEDCINFFTCDEVLSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNS-SR 1358
              R+  C             N  DC R                   T  E L  G   S 
Sbjct: 624  --RIMTC-------------NVLDCFR-----------------EFTKCEKLGIGEQWSC 651

Query: 1359 SKLFKFGYKMRSRSEAPKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTK 1418
            S+  K                         K  + K L    +P+ L+I+L RF   +  
Sbjct: 652  SRCLK-------------------------KQPSTKQLKITRLPKKLIINLKRFDNQM-H 685

Query: 1419 KNNIVVSYPLILNI-----------VLKNSEVA--------KFRLYSIVNHFGTLISGHY 1459
            KNN+ V YP  L++            + + ++         ++RLY +  H G+L  GHY
Sbjct: 686  KNNVFVQYPCFLDLTPYWARDFNHEAIIDEDIPTRGQIPPFRYRLYGVACHSGSLYGGHY 745

Query: 1460 TSLVNKELNHEISHGKQK-WYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
            TS V K        G QK WY+FDD I +    + ++        + N YVLFYERIF
Sbjct: 746  TSYVYK--------GPQKGWYFFDDTIYRLIRFNNEF-------ITPNAYVLFYERIF 788

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 49/121 (40%), Gaps = 8/121 (6%)

Query: 327 LSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWD---DEKGAPVSSVKELE 383
           LS L      + LL+D+R    +  +HI  ++++ IDP    D   D     VS     +
Sbjct: 154 LSSLLHFHDDAFLLVDVRPRPEFIKAHIKCKHIMCIDPASFKDSYTDTLVERVSLAASPQ 213

Query: 384 LVIDNHLFRSRRQFATIVCYTDNYTYMQIDXXXXXXXXXXXXXGRPQLV-LKTLSGGYEQ 442
           L I+  LF  R  F  IV YTD  T +Q D              R  +  +  L  G+  
Sbjct: 214 LEIE--LFSKRNTFKNIVLYTD--TQLQGDFQQRQTRILANILTRHSVAKVSILENGFSN 269

Query: 443 W 443
           W
Sbjct: 270 W 270

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YDR069C (DOA4) and YER144C
            (UBP5)
          Length = 848

 Score =  109 bits (272), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 106/419 (25%), Positives = 162/419 (38%), Gaps = 122/419 (29%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRK 1160
             GL N  N+CY++ ++QCL  T     +FL+N Y +++    +      ++R F  L  +
Sbjct: 488  VGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQLIHQ 547

Query: 1161 MYMNGG----------CSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXS 1210
            MY  G            +V+P+ F   C ++    +    QQD Q              +
Sbjct: 548  MYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHEDLN 606

Query: 1211 S------IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQ 1264
                   ++ +S +   +     +RL     ++ ++   +      S I DLFQGQ  +Q
Sbjct: 607  QCGNNPPLKELSEEAEKMREMMPMRL-ASAIEWERYLTTD-----FSVIVDLFQGQYASQ 660

Query: 1265 LSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDC 1324
            L C+ C  +S TY  F VLS+ +P+        T+   L DC   FT  E L  +  W C
Sbjct: 661  LQCKVCQRTSTTYQPFSVLSVPVPS--------TRTCTLTDCFTEFTKIETLEQEEQWSC 712

Query: 1325 PRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDK 1384
            P C             KR+ ST                                      
Sbjct: 713  PSC------------KKRQPST-------------------------------------- 722

Query: 1385 VSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV----------L 1434
                K  T+  L     PR L+IHL RF  ++  KNN+ VSYP +L++           +
Sbjct: 723  ----KKITITRL-----PRNLIIHLKRFD-NMLNKNNVFVSYPSVLDLTAFWANDYDKKV 772

Query: 1435 KNSEVA----------KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDD 1483
             N+ V            ++LY I  H GTL +GHYT+ VNK            W Y+DD
Sbjct: 773  TNNNVELPSRGQVPPFNYQLYGIACHDGTLRAGHYTAYVNK-------GAVLGWCYYDD 824

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
            YER144C (REAL)
          Length = 823

 Score =  108 bits (269), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 118/457 (25%), Positives = 176/457 (38%), Gaps = 140/457 (30%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLK----SPEMDTMSRSFYMLFR 1159
            I GL NM N CY+N +LQCL  T     +FL N Y +++           +++++  L  
Sbjct: 463  IVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFGNTRGSKGLLAKNYATLVH 522

Query: 1160 KMYMNGG--------CSVVPSGFLKMC---NTLKPDLRIPYGQQDTQXXXXXXXXXXXXX 1208
             M+ +G           V    F K+C   N++  D      QQD Q             
Sbjct: 523  NMHRHGAFKPPHSRTTPVQTLQFKKVCGHINSIYSDSM----QQDCQEFCQFLLDGLHED 578

Query: 1209 XSS------IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQME 1262
             +       ++ +S     +    ++R     A   +W  +       S I DLFQGQ  
Sbjct: 579  LNQNGGKKHLKQLSEQEERMRESMSIR----KASALEW--ERFLLTDFSAIIDLFQGQYA 632

Query: 1263 NQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAW 1322
            ++L CQ C ++S TY TF VLS+ +P             R+  C             N  
Sbjct: 633  SRLQCQACEHTSTTYQTFSVLSVPVP-------------RIRTC-------------NIL 666

Query: 1323 DCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLS 1382
            DC R  +  + +  D +                 S SK  K                   
Sbjct: 667  DCFREFTKCEKLGVDEQW----------------SCSKCLK------------------- 691

Query: 1383 DKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV--------- 1433
                  K  + K L    +P+ L+I+L RF   + K NN+ V YP  L++          
Sbjct: 692  ------KQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPCFLDLTPYWARDFNH 744

Query: 1434 --LKNSEVA--------KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQK-WYYFD 1482
              + N ++         ++RLY +  H G+L  GHYTS V K        G QK WY+FD
Sbjct: 745  ESIVNEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYK--------GPQKGWYFFD 796

Query: 1483 DEI---VKFDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
            D +   ++F+      D  I    + N YVLFYERIF
Sbjct: 797  DSVYCPIRFN------DEFI----TPNAYVLFYERIF 823

 Score = 39.7 bits (91), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 8/88 (9%)

Query: 328 SKLTSSER---SSMLLIDLRLPKRYEYSHILAENVINIDPELLWD---DEKGAPVSSVKE 381
           SKL+S  R    S+L+ID+R    +  +HI  +N+I I+P    D   D++   +S    
Sbjct: 166 SKLSSMLRFHGGSILVIDIRPRSEFIKAHIKCKNIICIEPVSFKDSFTDQQVGKISLATS 225

Query: 382 LELVIDNHLFRSRRQFATIVCYTDNYTY 409
            +  ID  LF +R  F  IV YTD   Y
Sbjct: 226 PQSEID--LFSNRDTFKYIVLYTDTQLY 251

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score =  105 bits (263), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 119/454 (26%), Positives = 173/454 (38%), Gaps = 126/454 (27%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFR 1159
            I GL NMSN+CY+N ++QCL S      + L+N +  ++    K      + + F  L +
Sbjct: 428  IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 1160 KMY---MNGGCSVV--PSGFLKMCNTLKPDLRIPYG--QQDTQXXXXXXXXXXXXXXSSI 1212
             M+   +  G S+   P   +   N       I  G  QQD Q              +  
Sbjct: 488  DMHSQQVKTGRSLFSYPVKTIDFKNACASVSSIYSGSQQQDCQEFCEFLLDGLHEDLN-- 545

Query: 1213 ESVSNDYSHLLLHDNVRL----YVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQ 1268
            +   N  +  L     RL     +  A    W  +N   N  S I DLF GQ  +QL C 
Sbjct: 546  QCGGNPPARELTDQEERLREGLCMRVASSMAW--ENFLHNNFSLIIDLFAGQYGSQLRCC 603

Query: 1269 RCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCC 1328
             C Y+S TY  F +LS+ +P        +  +  + DC   FT  E L     W CP+C 
Sbjct: 604  VCQYTSTTYQPFTLLSVPVP-----LSSRVSRCSIIDCFQEFTKCERLDKDEEWFCPQC- 657

Query: 1329 SPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKVSNG 1388
                        KRK                                             
Sbjct: 658  ------------KRK--------------------------------------------- 660

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI---------------- 1432
            +P+T K L    +P+ L+IH  RF  ++  KNNI + YP  L++                
Sbjct: 661  QPST-KQLKITRLPKNLIIHFKRFD-NMMNKNNIFIQYPYELDLTPFWVNDFNGELPLGM 718

Query: 1433 ----VLKNSEVA--KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDD--- 1483
                + K  +V   K++L ++  H GTL SGHYT+ VNK  +         WYYFDD   
Sbjct: 719  TNSLLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVNKGPD-------VGWYYFDDSSH 771

Query: 1484 EIVKFDTNHGDYDNGIASVSSSNVYVLFYERIFD 1517
             IVK  T + + D           Y+LFY R+++
Sbjct: 772  RIVKIATEYMNPD----------AYLLFYHRVYN 795

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 18/98 (18%)

Query: 327 LSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVI 386
           L  + S ++ S+LLID+R    +E+SHI +  V+ +DP          P  ++ +LE + 
Sbjct: 165 LQTILSDQKISVLLIDVRKRYEFEFSHINSVAVLPLDPISF------KPTYTIDQLEKIS 218

Query: 387 -------DNHLFRSRRQFATIVCYT-DN----YTYMQI 412
                  +  LF+ R ++  IV YT DN    Y Y Q+
Sbjct: 219 FINSPMHELQLFQKRNEYDVIVLYTKDNDITAYYYKQM 256

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] {ON}
            Anc_8.188 YDR069C
          Length = 826

 Score =  103 bits (256), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 109/456 (23%), Positives = 174/456 (38%), Gaps = 130/456 (28%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRK 1160
            TGL N+ N+CY+N ++QCL ST     L+L+N +   +    K      +S++F  L + 
Sbjct: 458  TGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLTQINVENKLGSKGFLSKNFANLIQT 517

Query: 1161 MYMNGGCS---------VVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSS 1211
            MY               V P  F   C  +   +     +QD Q              + 
Sbjct: 518  MYKKSAFQPYNPNFLHPVAPLEFKNACGMMN-SIYAESTEQDCQEFCEFLLDGLHEDLNQ 576

Query: 1212 I------ESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQL 1265
                   + +S + + L    ++R+   + ++  +   N      SPI +LFQGQ  ++L
Sbjct: 577  CSGNPRPKELSANEAELRESLSMRI-ASEIEWESFLTTN-----FSPIINLFQGQYASRL 630

Query: 1266 SCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCP 1325
             C  C ++S TY  F +LS+ +P+ V   F   +   + DC   FT  E L +   W CP
Sbjct: 631  QCLICQHTSTTYQPFSLLSIPVPSMV---FSNGQTCNILDCFKEFTKCERLDNDEKWFCP 687

Query: 1326 RCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKV 1385
            +C             +++IST                                       
Sbjct: 688  KC------------RRKQIST--------------------------------------- 696

Query: 1386 SNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV------------ 1433
                    K L    +P+ L+IH  RF  +   KNNI V YP  L++             
Sbjct: 697  --------KQLKITRLPKNLIIHFKRFD-NFMNKNNIFVQYPYQLDLTSLWVNDYDGKLP 747

Query: 1434 ---------LKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDD- 1483
                        +   K++L ++  H G L SGHYT+ V+K L        + W+ FDD 
Sbjct: 748  PNFNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKGL-------YRGWFRFDDA 800

Query: 1484 --EIVKFDTNHGDYDNGIASVSSSNVYVLFYERIFD 1517
                VKF T             + + Y+LFY+RI++
Sbjct: 801  SYRPVKFGT----------EFLTPDAYLLFYQRIYE 826

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 49/125 (39%), Gaps = 8/125 (6%)

Query: 327 LSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVI 386
           L  L SS + ++LLID+R  K ++  HI A  ++ I P           +     L    
Sbjct: 174 LHDLLSSHKRNLLLIDVRTRKEFDTLHIDAPIILPIGPLSFKSTFTDLQIEQTSLLTSTF 233

Query: 387 -DNHLFRSRRQFATIVCYT--DN---YTYMQIDXXXXXXXXXXXXXGRPQLV--LKTLSG 438
            + + F+ R QF  IV YT  DN   Y Y Q+                 Q+   +  L G
Sbjct: 234 QERNYFKKRNQFRYIVLYTKDDNDTTYYYTQVISLFNILTIAASKRNIDQICPSIFILKG 293

Query: 439 GYEQW 443
           G   W
Sbjct: 294 GITSW 298

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
            YDR069C
          Length = 825

 Score =  101 bits (252), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 80/266 (30%), Positives = 113/266 (42%), Gaps = 37/266 (13%)

Query: 1083 PIPHF----SIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKY 1138
            P+P F    S P +  S N+Y      GL NM N+CYIN ++QCL  T    N+FL+  Y
Sbjct: 438  PLPKFPSRESSPAL-GSANKYDLDFAVGLENMGNSCYINCIVQCLLGTHELTNIFLNKSY 496

Query: 1139 AHYL----KSPEMDTMSRSFYMLFRKMYMNG-------GCSVVPSGFLKMCNTLKPDLRI 1187
              ++    +      +++ F  L   MY N        G  V P  F   C T+    R 
Sbjct: 497  ERHINMNSRLGSKGVLAKYFAKLTHSMYQNASHKLNEKGKPVQPMEFKMACGTINSLFR- 555

Query: 1188 PYGQQDTQXXXXXXXXXXXXXXSS------IESVSNDYSHLLLHDNVRLYVDDAQYNKWF 1241
              GQQD Q              +       ++ +S++   +    ++R+    A   +W 
Sbjct: 556  ESGQQDCQEFCQFLLDGLHEDLNQCGGNPPLKELSDEAEKMREKLSLRI----ASSIEW- 610

Query: 1242 DQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKL 1301
             +       S I DLFQGQ  +QL CQ CG +S TY  F VLS+ +P+         K  
Sbjct: 611  -ERFLTTDFSVIVDLFQGQYASQLRCQVCGLTSTTYQPFSVLSVPVPH--------AKSC 661

Query: 1302 RLEDCINFFTCDEVLSDQNAWDCPRC 1327
             + DC   FT  E L     W CPRC
Sbjct: 662  NIIDCFKEFTKVEKLETDEQWSCPRC 687

 Score = 69.7 bits (169), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 66/149 (44%), Gaps = 36/149 (24%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV--------------- 1433
            K  + K L    +PR L+IHL RF  ++  KNN+ V YP  L++                
Sbjct: 690  KQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFTLDLTPYWANDFDGRLPPGV 748

Query: 1434 ------LKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVK 1487
                     S    ++LY I +H G+L  GHYTS V+K         K+ W YFD     
Sbjct: 749  TEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDK-------GPKRGWCYFD----- 796

Query: 1488 FDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
             DT+     N    + + N YVLFY R++
Sbjct: 797  -DTSFRPVRNATECI-TPNAYVLFYHRVY 823

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 44/84 (52%), Gaps = 11/84 (13%)

Query: 327 LSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDP---ELLWDD---EKGAPVSSVK 380
           L +L  S   S LLIDLR    +   HI A+NVI I+P   +  + D   EK + ++S K
Sbjct: 167 LQQLIDSHNDSTLLIDLRQRGEFSKLHINAKNVICIEPISFKAQYTDLEIEKKSLITSPK 226

Query: 381 ELELVIDNHLFRSRRQFATIVCYT 404
           E     +  LFR+R  F  IV YT
Sbjct: 227 E-----EIGLFRARDTFKFIVLYT 245

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
            YDR069C
          Length = 1144

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 103/243 (42%), Gaps = 36/243 (14%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRKM 1161
            GL NM N+CY+N ++QCL +      +FL+N Y  ++    K      +++SF  L   M
Sbjct: 736  GLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHININSKLGSKGILAKSFARLVHSM 795

Query: 1162 YMNGGCS-----------VVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXS 1210
            Y NG  S           V P  F   C ++   L     QQD Q              +
Sbjct: 796  YQNGTLSIKNHSNKKNPPVQPITFKTACGSIN-SLFKGSNQQDCQEFCQFLLDGLHEDLN 854

Query: 1211 S------IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQ 1264
                   ++ +S +   +    ++R+    A   +W  +       S I DL+QGQ  +Q
Sbjct: 855  QCGANPPLKELSTEAERMREKLSLRI----ASSIEW--ERFLTTDFSVIIDLYQGQYASQ 908

Query: 1265 LSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDC 1324
            L CQ CG +S TY TF VLS+ +P        K K + L DC N FT  E L     W C
Sbjct: 909  LKCQVCGTTSTTYQTFSVLSVPVP--------KNKSIHLLDCFNEFTKTEFLGKDELWSC 960

Query: 1325 PRC 1327
              C
Sbjct: 961  TEC 963

 Score = 35.0 bits (79), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 47/88 (53%), Gaps = 13/88 (14%)

Query: 326 LLSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELL------WDDEKGAPVSSV 379
           +L+ +  ++  S LLID+R    +E +HI + ++I I+P          D E+ + ++S 
Sbjct: 184 VLATILQTDPDSTLLIDVRTRHDFELNHIKSNSIICIEPISFKNNYSDVDIERKSLITSP 243

Query: 380 K-ELELVIDNHLFRSRRQFATIVCYTDN 406
             E+E      +F++R  +  I+ YTD+
Sbjct: 244 NSEIE------IFKNRENYKFIILYTDD 265

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
            complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 110/263 (41%), Gaps = 34/263 (12%)

Query: 1084 IPHFSIPTIENSYNEYVALSIT-GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL 1142
            +PH    T +N     + L  T GL NM N+CY+N ++QCL ST     +FL+N Y  ++
Sbjct: 497  LPHHMTGTYQNLNQPKLDLDFTVGLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHI 556

Query: 1143 ----KSPEMDTMSRSFYMLFRKMYMNGGCS--------VVPSGFLKMCNTLKPDLRIPYG 1190
                K      +++ F  L   MY  G           + P  F   C ++   L     
Sbjct: 557  NLNSKLGSKGVLAKYFARLVHTMYREGSFKRPLEKNKPIQPIQFKMACGSIN-SLFKDNT 615

Query: 1191 QQDTQXXXXXXXXXXXXXXSS------IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQN 1244
            QQD+Q              +       ++ +S D   +    ++R+    A   +W  + 
Sbjct: 616  QQDSQEFCQFLLDGLHEDLNQCGANPPLKELSEDAEKMREKLSMRI----ASSIEW--ER 669

Query: 1245 IDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLE 1304
                  S I DLFQGQ  +QL C+ CG +S TY TF VLS+ +P+             + 
Sbjct: 670  FLTTDFSVIVDLFQGQYASQLKCKVCGCTSTTYQTFSVLSVPVPH--------VSSCHIL 721

Query: 1305 DCINFFTCDEVLSDQNAWDCPRC 1327
            DC N FT  E L     W CP C
Sbjct: 722  DCFNEFTKVEKLGTDELWSCPTC 744

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 72/149 (48%), Gaps = 36/149 (24%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI---------------- 1432
            K  + K L    +PR L+IHL RF  ++  KNN+ V YP +L++                
Sbjct: 747  KQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPGV 805

Query: 1433 ---VLKNSEVAKFR--LYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVK 1487
               +    +V  FR  L ++ +H G+L  GHYT+ VNK +N       + W+YFD     
Sbjct: 806  TDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKGIN-------RGWHYFD----- 853

Query: 1488 FDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
             DT++    N    + + N YVLFY R++
Sbjct: 854  -DTSYRPIKNETECI-TPNAYVLFYHRVY 880

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 13/85 (15%)

Query: 327 LSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDP-------ELLWDDEKGAPVSSV 379
           L+ L     SS+LLID+R    ++  HI A++VI ++P         L  ++K    S  
Sbjct: 175 LNHLIQMYDSSLLLIDVRPRAEFDSKHIKAKSVICVEPVSFKNSFTDLEVEKKSLITSPQ 234

Query: 380 KELELVIDNHLFRSRRQFATIVCYT 404
           KE+       LF++R ++  IV YT
Sbjct: 235 KEIA------LFQARDKYNYIVIYT 253

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
            YDR069C
          Length = 970

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 104/240 (43%), Gaps = 33/240 (13%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRKM 1161
            GL NM N+CY+N ++QCL S+  F  +FL+N Y  ++    K      ++R+F  L   M
Sbjct: 609  GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFARLINTM 668

Query: 1162 YMNG--------GCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSS-- 1211
            Y  G           V P+ F   C ++    R    QQD+Q              +   
Sbjct: 669  YTEGSEQSKNDRNGPVKPAQFKLACGSINSIFRSDL-QQDSQEFCQFLLDGLHEDLNQCG 727

Query: 1212 ----IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSC 1267
                ++ +S +   +    ++R+     ++ ++   +      S I D FQGQ  +QL C
Sbjct: 728  ANPPLKELSPNAEKMREKLSLRI-ASSIEWERYLTTD-----FSVIVDQFQGQYASQLRC 781

Query: 1268 QRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRC 1327
            + CG +S TY  F VLS+ +P        + K   + DC N FT  E L     W CP C
Sbjct: 782  KVCGGTSTTYQAFSVLSVPVP--------RGKSCNIIDCFNEFTKVENLETDELWACPHC 833

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 70/149 (46%), Gaps = 37/149 (24%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI---------------- 1432
            K  + K L    +PR L+IHL RF  ++  KNNI V YP +L++                
Sbjct: 836  KQPSTKKLTITRLPRNLIIHLKRFD-NMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPGV 894

Query: 1433 ---VLKNSEVAKF--RLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVK 1487
               +    ++  F  +L ++  HFG+L  GHYTS V+K        GK  W YFDD  ++
Sbjct: 895  TEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDK--------GKFGWRYFDDTKIR 946

Query: 1488 FDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
               N  +         +SN YVLFY R++
Sbjct: 947  PLKNSYE-------CITSNAYVLFYHRVY 968

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
            similarities with uniprot|P32571 Saccharomyces cerevisiae
            YDR069C DOA4 Ubiquitin hydrolase required for recycling
            ubiquitin from proteasome-bound ubiquitinated
            intermediates acts at the late endosome/prevacuolar
            compartment to recover ubiquitin from ubiquitinated
            membrane proteins en route to the vacuole
          Length = 877

 Score = 89.7 bits (221), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 104/240 (43%), Gaps = 32/240 (13%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRK 1160
             GL NM N+CYIN ++QCL  T    N+FL+N Y  ++    K      +++ F  L  +
Sbjct: 515  VGLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQ 574

Query: 1161 MYMNGGC-------SVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSS-- 1211
            M+ +          +V P  F   C ++    R   GQQD+Q              +   
Sbjct: 575  MHQSAAFKKSDKNKAVRPYEFKMACGSINSLFR-ESGQQDSQEFCQFLLDGLHEDLNQCG 633

Query: 1212 ----IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSC 1267
                ++ +S +   +    ++R+     ++ ++  ++      S I DLFQGQ  +QL C
Sbjct: 634  GNPPLKELSEEAEKMRERLSMRI-ASSIEWERYLTRD-----FSVIVDLFQGQYASQLRC 687

Query: 1268 QRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRC 1327
            + C ++S TY  F +L+  +P+         K   L DC   FT  E L     W CP C
Sbjct: 688  KVCNHTSTTYQPFSILAAPVPH--------AKSCYLLDCFKEFTKLEQLEKDEEWLCPYC 739

 Score = 78.6 bits (192), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 75/149 (50%), Gaps = 36/149 (24%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI---------------- 1432
            K  + K L    +PR L+IHL RF  +L  KNN++V+YP  L++                
Sbjct: 742  KQPSTKKLTITRLPRNLIIHLKRFD-NLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPGV 800

Query: 1433 ---VLKNSEVA--KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVK 1487
               +    +VA  K++LY++ +H G+L  GHYT+ V+K LN       + WYYFD     
Sbjct: 801  TDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLN-------KGWYYFD----- 848

Query: 1488 FDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
             DT +         + +SN YVLFY R++
Sbjct: 849  -DTGYRPMRTPTECI-TSNAYVLFYHRVY 875

 Score = 40.0 bits (92), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%), Gaps = 5/82 (6%)

Query: 327 LSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELL---WDDEKGAPVSSVKELE 383
           L  L  S+  ++LL+D+R    +E +HI A NVI I+P      + D +    S +    
Sbjct: 159 LEFLLKSDDRNILLVDVRQRSEFEETHIKASNVICIEPISFKSSYTDLELEKKSMITSPN 218

Query: 384 LVIDNHLFRSRRQFATIVCYTD 405
           + ID  +F+ R +F  ++ YTD
Sbjct: 219 VEID--IFKRRNEFTFVILYTD 238

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
            YDR069C (REAL)
          Length = 929

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 99/234 (42%), Gaps = 19/234 (8%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRK 1160
             GL N+ N+CY+N ++QC+  T     +FL + YA ++    K      +++ F  L   
Sbjct: 565  VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 624

Query: 1161 MYM-----NGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESV 1215
            MY      +   S+ P  F   C ++    +    QQD Q              +   S 
Sbjct: 625  MYKEQVDSSKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 683

Query: 1216 S--NDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYS 1273
                + S        +L +  A   +W  +       S I DLFQGQ  ++L C+ C ++
Sbjct: 684  PPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLRCKVCNHT 741

Query: 1274 SYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRC 1327
            S TY  F VLS+ +P   ++      K+ +EDC   FT  E L  +  W CP C
Sbjct: 742  STTYQPFTVLSIPIPKKNSQ-----NKITIEDCFKEFTKCENLEVEEQWLCPHC 790

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 70/150 (46%), Gaps = 38/150 (25%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV--------------L 1434
            +P+T K L    +PR L++HL RF  +   KNN  V YP +L++               +
Sbjct: 794  QPST-KQLTVTRLPRNLIVHLKRF-DNFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGV 851

Query: 1435 KNSEVA--------KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
             + E+         K+ LY +  HFGTL  GHYT+ V K L       K+ W YFDD   
Sbjct: 852  NDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTKY 904

Query: 1487 KFDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
            K   N  D  N       SN YVLFY R++
Sbjct: 905  KPVKNQTDAIN-------SNAYVLFYHRVY 927

 Score = 35.4 bits (80), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 11/85 (12%)

Query: 331 TSSERSSMLLIDLRLPKRYEYSHILAENVINIDP---ELLWDD---EKGAPVSSVKELEL 384
           ++S +   LLID+R    +  SHI ++N+I ++P   ++ + D   E+ + ++S  +   
Sbjct: 202 STSSQMETLLIDIRSRLEFNKSHIDSKNIICLEPISFKMSYSDHDLERKSLITSPND--- 258

Query: 385 VIDNHLFRSRRQFATIVCYTDNYTY 409
             +  LF+SR  F  IV YTD+  Y
Sbjct: 259 --EIKLFQSRNLFKFIVLYTDSNEY 281

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
            similar to uniprot|P32571 Saccharomyces cerevisiae
            YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 105/257 (40%), Gaps = 29/257 (11%)

Query: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL---- 1142
            F+   + N+  +Y      GL NM N+CY+N +LQC+  T+    +FL+N Y  ++    
Sbjct: 565  FNHSVLPNTKKDYDLNFTVGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHININS 624

Query: 1143 KSPEMDTMSRSFYMLFRKMYMNG------GCSVVPSGFLKMCNTLKPDLRIPYGQQDTQX 1196
            K      ++R F  L   M+            V P+ F     ++    R    QQD Q 
Sbjct: 625  KLGSKGVLARYFARLAHIMHQTSYDQEKKAAIVRPTQFRMAIASINSMFR-NTNQQDCQE 683

Query: 1197 XXXXXXXXXXXXXSS------IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGL 1250
                         +       ++ +S +        ++R+     ++ ++   N      
Sbjct: 684  FCQFLLDGLHEDLNQCGNNPPLKELSEEAEKKRELLSLRI-ASSIEWERFLTTN-----F 737

Query: 1251 SPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFF 1310
            S I DLFQGQ  ++L C  C  +S TY  F VLS+ LP       G    + L DC N F
Sbjct: 738  SVIIDLFQGQYASRLKCSVCSNTSTTYQPFSVLSVPLPT------GTKSSVNLMDCFNEF 791

Query: 1311 TCDEVLSDQNAWDCPRC 1327
            T  E L     W+CP C
Sbjct: 792  TKCEKLEHDEYWNCPTC 808

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 70/149 (46%), Gaps = 37/149 (24%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI---------------- 1432
            K  + K L    +PR L+IHL RF   +  KN  ++ YP  L++                
Sbjct: 811  KQPSTKQLTITRLPRNLIIHLKRFDNRMN-KNTKLIDYPFNLDLTSFWANDKDDRLPPGV 869

Query: 1433 ----VLKNSEVAKFR--LYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
                +    ++  F+  LY++ NHFG+L  GHYTS VNK L+       + WYYFDD+  
Sbjct: 870  SIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGLS-------RGWYYFDDQNY 922

Query: 1487 KFDTNHGDYDNGIASVSSSNVYVLFYERI 1515
            +            + V +SN YVLFY R+
Sbjct: 923  RLVKK-------TSEVVNSNAYVLFYRRV 944

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
            YER144C (REAL)
          Length = 805

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 100/243 (41%), Gaps = 35/243 (14%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLK----SPEMDTMSRSFYMLFR 1159
            I GL N  N CY+N +LQCL  T     +FL N Y +++           ++++F  L R
Sbjct: 445  IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSKGSKGLLAKNFATLVR 504

Query: 1160 KMYMNGGCSVVPS--------GFLKMC---NTLKPDLRIPYGQQDTQXXXXXXXXXXXXX 1208
             M+ N     V S         F K+C   N++  D      QQD Q             
Sbjct: 505  NMHRNSAFMPVNSRTTPVQTIQFKKICGHINSIYSD----SMQQDCQEFCQFLLDGLHED 560

Query: 1209 XSSIESVSNDYSHLLLHD----NVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQ 1264
             +  ++   ++   L  +      ++ +  A   +W  +       S I DLFQGQ  ++
Sbjct: 561  LN--QNGGKEHLKQLTEEEEQKREKMTIRKASALEW--ERFLLTDFSAIIDLFQGQYASR 616

Query: 1265 LSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDC 1324
            L CQ C  +S TY TF VLS+ +P        +     + DC   FT  E L     W C
Sbjct: 617  LQCQACDRTSTTYQTFSVLSVPVP--------RITTCNILDCFREFTKCEKLGIDELWSC 668

Query: 1325 PRC 1327
            PRC
Sbjct: 669  PRC 671

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 72/150 (48%), Gaps = 40/150 (26%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI-----------VLKNS 1437
            K  + K L    +P+ L+I+L RF   + K NN+ V YP  L++            + N 
Sbjct: 674  KQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYFLDLTPYWARDFNHEAIVNE 732

Query: 1438 EVA--------KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEI---V 1486
            ++         ++RLY +  H G+L  GHYTS V K         K+ WY+FDD I   +
Sbjct: 733  DIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYK-------GPKKGWYFFDDSIYRPI 785

Query: 1487 KFDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
            +F+      D  I    + N YVLFYERIF
Sbjct: 786  RFN------DEFI----TPNAYVLFYERIF 805

 Score = 37.0 bits (84), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 327 LSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWD---DEKGAPVSSVKELE 383
           LS +      ++LLID+R    +  +HI  +N+I I+P    D   D +   VS +   +
Sbjct: 152 LSSMLHFHGDTLLLIDVRPRSDFTKAHIKCKNIICIEPVSFKDSFTDRQLENVSLITSSQ 211

Query: 384 LVIDNHLFRSRRQFATIVCYTD 405
             ID  LF +R  F  IV YTD
Sbjct: 212 SDID--LFSNRNMFKYIVLYTD 231

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar to
            uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
            Ubiquitin hydrolase required for recycling ubiquitin from
            proteasome-bound ubiquitinated intermediates acts at the
            late endosome/prevacuolar compartment to recover
            ubiquitin from ubiquitinated membrane proteins en route
            to the vacuole
          Length = 861

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 99/244 (40%), Gaps = 36/244 (14%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRK 1160
             GL N+ N+CY+N ++QCL  T     +FL + Y +++    K      +++ F  L   
Sbjct: 495  VGLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSKLGSKGVLAKYFSQLIHT 554

Query: 1161 MYMNGG-----------CSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXX------XXXX 1203
            M                 +V P  F   C ++    R    QQD Q              
Sbjct: 555  MQQQAASASTKQNSGDKTAVQPLHFKVACGSINSLFR-SSSQQDCQEFCQFLLDGLHEDL 613

Query: 1204 XXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMEN 1263
                   +++ +S +   +     +R+     ++ ++   +      S I DLFQGQ  +
Sbjct: 614  NQCGGNPALKELSEEAEGIREKLCMRI-ASSIEWERYLTTD-----FSVIVDLFQGQYAS 667

Query: 1264 QLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWD 1323
            QL+C+ CG +S TY  F VLS+ +P+          K  + DC   FT  E L     W 
Sbjct: 668  QLTCKVCGRTSTTYQPFSVLSVPVPS--------GSKCDIIDCFKEFTKVETLEKDEQWS 719

Query: 1324 CPRC 1327
            CPRC
Sbjct: 720  CPRC 723

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 68/149 (45%), Gaps = 35/149 (23%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI---------------- 1432
            K  + K +    +PR LVIHL RF  +L  KNNI VSYP  L++                
Sbjct: 726  KQPSTKKITITRLPRNLVIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGV 784

Query: 1433 --VLKNSEVAKFR--LYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKF 1488
              +    +V  F   LY++  HFGTL  GHYTS V+K         K  W YFDD   + 
Sbjct: 785  AELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDK-------GDKAGWCYFDDTSWRK 837

Query: 1489 DTNHGDYDNGIASVSSSNVYVLFYERIFD 1517
              + G+         + + YVLFY R ++
Sbjct: 838  AKSQGE-------CITLSAYVLFYHRKYN 859

 Score = 36.2 bits (82), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 48/114 (42%), Gaps = 12/114 (10%)

Query: 339 LLIDLRLPKRYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVI----DNHLFRSR 394
           LLIDLR   ++  SHI  + ++ I+P    D       + +    L+     +  LF+ R
Sbjct: 179 LLIDLRPRIKFVESHIKTDKIMCIEPISFKDSYSD---TEITRRSLITSPNEEVQLFQER 235

Query: 395 RQFATIVCYTDNYTYMQI---DXXXXXXXXXXXXXGRP--QLVLKTLSGGYEQW 443
            +F  IV YTD +   Q                   +P  + ++ TL GG+E W
Sbjct: 236 DKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKPLQRTIILTLQGGFENW 289

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 79.3 bits (194), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 72/291 (24%), Positives = 117/291 (40%), Gaps = 40/291 (13%)

Query: 1063 DRSPEETNNIKVDGHKLIRNPIPHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQC 1122
            ++SP     +++       + IPH     +     EY    I GL+NM N+CY+N ++QC
Sbjct: 706  EKSPYNIQKLQIQNTAGSNDLIPHHH-NNVTTHEKEYDLDFIIGLQNMGNSCYLNCIIQC 764

Query: 1123 LFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRKMY--------------MN 1164
            L  T     +FL+  +  Y+    K      ++++   L   MY               +
Sbjct: 765  LLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIHLMYNHSTLKNNGDKTKKKS 824

Query: 1165 GGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSS------IESVSND 1218
            G   + P  F   C ++  +L     QQD Q              +       ++ +S  
Sbjct: 825  GNNFIKPIQFRMACGSIN-NLFKNCSQQDCQEFCQFLLDALHEDLNQCGSNPPLKELSTK 883

Query: 1219 YSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYS 1278
               +    ++R+     ++ ++   +      S I DLFQGQ  ++L C+ C ++S TY 
Sbjct: 884  AESMREKLSLRI-ASSIEWERYLTTD-----FSVIVDLFQGQYASRLQCKTCIHTSTTYQ 937

Query: 1279 TFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCS 1329
             F VLS+ +P        K K L L DC   FT  E L     W CP C S
Sbjct: 938  PFSVLSVPIP--------KKKNLNLLDCFKDFTKIENLEVDEQWFCPNCKS 980

 Score = 72.0 bits (175), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 72/149 (48%), Gaps = 36/149 (24%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI---------------- 1432
            K  + K L    +PR L+IHL RF  +   KNN ++ YP IL++                
Sbjct: 981  KQPSTKKLTITRLPRNLIIHLKRFD-NNLNKNNNLIDYPFILDLTQFWADDFDGELPPGV 1039

Query: 1433 ---VLKNSEVA--KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVK 1487
               + K  ++   K+RLY    HFG+L  GHYT+ VNK +       +  WYYFD     
Sbjct: 1040 TDELPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNKGI-------RNGWYYFD----- 1087

Query: 1488 FDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
             DTN+    N    + SSN YVLFY RI+
Sbjct: 1088 -DTNYRPIKNEREPI-SSNAYVLFYHRIY 1114

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 102/239 (42%), Gaps = 27/239 (11%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFR 1159
            I GL+N+ N+CY+N ++QCL  T     +FL+N Y  ++    K      +++ F  L  
Sbjct: 558  IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFARLIH 617

Query: 1160 KMYMNGGCS-----VVPSGFLKMC----NTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXS 1210
             M+ +         V P+ F KM     NTL  +      QQD Q              +
Sbjct: 618  LMHNHANPKLKNNYVRPAQF-KMAVGSVNTLFKNC----SQQDCQEFCQFLLDGLHEDLN 672

Query: 1211 SIESVS--NDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQ 1268
               S     + S     +  +L +  A   +W  +       S I DLFQGQ  ++L C+
Sbjct: 673  QCGSNPPLKELSSAAEKNREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLQCE 730

Query: 1269 RCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRC 1327
             C ++S TY  F VLS+ +P        K  K+ + DC   FT  E+L     W CP C
Sbjct: 731  VCKHTSTTYQPFSVLSVPIPR-----VPKGVKVNILDCFKDFTKLELLDTDEQWLCPTC 784

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 74/150 (49%), Gaps = 36/150 (24%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI---------------- 1432
            K  + K L    +PR L+IHL RF  +L K NN +  YP IL++                
Sbjct: 787  KQRSTKKLTITRLPRNLIIHLKRFDNNLNKNNNFI-DYPFILDLTQFWVDDFDGKLPPGV 845

Query: 1433 ---VLKNSEVA--KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVK 1487
               + K  ++   K++LY + +HFG+L  GHYT+ V+K   H        WYYFD     
Sbjct: 846  RDELPKRGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKH-------GWYYFD----- 893

Query: 1488 FDTNHGDYDNGIASVSSSNVYVLFYERIFD 1517
             DTN+    N    ++SS  Y+LFY RI+D
Sbjct: 894  -DTNYRSIKNKNEPITSS-AYLLFYHRIYD 921

 Score = 37.4 bits (85), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 333 SERSSMLLIDLRLPKRYEYSHILAENVINIDPELLWD---DEKGAPVSSVKELELVIDNH 389
           ++ +S+LLID+R    +  SHI  E +I ++P    D   DE+ A  S +      ID  
Sbjct: 178 NDNTSVLLIDIRPRLEFSKSHIKHEEIICVEPISFKDSYSDEEVAKKSLITSPNEEID-- 235

Query: 390 LFRSRRQFATIVCYTDN 406
           LF  R +F  I+ YT++
Sbjct: 236 LFNKRNEFEFIILYTND 252

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar to
            uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
            Putative ubiquitin-specific protease that does not
            associate with the proteasome
          Length = 796

 Score = 76.3 bits (186), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 100/243 (41%), Gaps = 36/243 (14%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRKM 1161
            GL N+ N+CY+N ++QCL        +FL+N Y  ++    +      ++  F  L +KM
Sbjct: 433  GLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLGSKGLLANYFSQLVQKM 492

Query: 1162 YMNG-----------GCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXS 1210
            Y  G             +V P+ F   C ++    +    QQD Q              +
Sbjct: 493  YQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFK-GKQQQDCQEFCQFLLDGLHEDLN 551

Query: 1211 S------IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQ 1264
                   ++ +S +   +     +R+     ++ ++   +      S I DLFQGQ  +Q
Sbjct: 552  QCGTNPPLKELSPEAEKMRETMPMRI-ASAIEWERYLTTD-----FSVIVDLFQGQYASQ 605

Query: 1265 LSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDC 1324
            L C+ C ++S TY  F VLS+ +P        + +   + DC   FT  E L     W C
Sbjct: 606  LRCKICAHTSTTYQAFSVLSVPVP--------RARSCTIYDCFKEFTKLETLEKDELWYC 657

Query: 1325 PRC 1327
            P C
Sbjct: 658  PYC 660

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 69/148 (46%), Gaps = 38/148 (25%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVL-----KNSEVAK-- 1441
            +P+T K +    +P  L+IHL RF  ++  KNN+ V+YP  L++        N E+ K  
Sbjct: 664  QPST-KQIIITRLPNNLIIHLKRFD-NMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDN 721

Query: 1442 --------------FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVK 1487
                          +RL+++ +H GTL  GHYTS V+K        G+  W  FDD   +
Sbjct: 722  GVSLPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDDVSWR 773

Query: 1488 FDTNHGDYDNGIASVSSSNVYVLFYERI 1515
                  +Y        + N YVLFY R+
Sbjct: 774  KIRRKDEY-------ITPNAYVLFYRRV 794

 Score = 36.2 bits (82), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 60/149 (40%), Gaps = 19/149 (12%)

Query: 336 SSMLLIDLRLPKRYEYSHILAENVINIDP----ELLWDDE---KGAPVSSVKELELVIDN 388
           S +LL+D+R    +   HI   NVI I+P    E   D +   K    +S +E++     
Sbjct: 172 SGILLVDIRPRMDFNDGHIKHNNVICIEPISFKESYTDSDILRKSLITASDREVD----- 226

Query: 389 HLFRSRRQFATIVCYTD-----NYTYMQIDXXXXXXXXXXXXXGRPQLVLKTLSGGYEQW 443
            LF++R +F  IV YTD      Y + Q++                   +  L  G   W
Sbjct: 227 -LFKNRDKFRLIVLYTDTDEHTKYYWQQLEVLQDILCNRSFDKPLHHTKVIVLQNGVNAW 285

Query: 444 K-SFLKELKRTESIILSDFLWKRPHKNEH 471
           K  +  ELK+     +SD   K    N H
Sbjct: 286 KEKYPMELKKIMESAISDIRTKPVEHNFH 314

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
            (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 100/246 (40%), Gaps = 38/246 (15%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL----KSPEMDTMSRSFYMLFRK 1160
             GL N+ N+CY+N ++QCL  T     +FL + Y +++    +      +++ F  L   
Sbjct: 56   VGLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQLIHN 115

Query: 1161 MYM-------------NGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXX 1207
            M               N   +V P  F   C ++    +    QQD Q            
Sbjct: 116  MQQQAISASGRKSTSGNERNAVQPLHFKVACGSINSLFKTT-SQQDCQEFCQFLLDGLHE 174

Query: 1208 XXS------SIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQM 1261
              +      +++ +S +   +     +R+     ++ ++   +      S I DLFQGQ 
Sbjct: 175  DLNQCGGNPALKELSEEAEAIREKLCMRI-ASSIEWERYLTTD-----FSVIVDLFQGQY 228

Query: 1262 ENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNA 1321
             +QL C+ CG +S TY  F VLS+ +P        +  +  L DC   FT  E L     
Sbjct: 229  ASQLMCKVCGRTSTTYQPFSVLSVPVP--------RGARCNLLDCFEEFTKIETLEKDEQ 280

Query: 1322 WDCPRC 1327
            W CPRC
Sbjct: 281  WSCPRC 286

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 66/148 (44%), Gaps = 35/148 (23%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIV--------------- 1433
            K  + K +    +PR L+IHL RF  +L  KNNI VSYP  L++                
Sbjct: 289  KQPSTKKITITRLPRNLIIHLKRFD-NLLHKNNIFVSYPHTLDLTPFWANDFDGSLPKGV 347

Query: 1434 -----LKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKF 1488
                    +    + LY++  HFGTL  GHYT+ VNKE        K  W YFDD   + 
Sbjct: 348  AELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKE-------DKNGWCYFDDTCWRK 400

Query: 1489 DTNHGDYDNGIASVSSSNVYVLFYERIF 1516
              +  +         +++ YVLFY R +
Sbjct: 401  AKSEDE-------CITTSAYVLFYHRKY 421

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar to
            uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
            ubiquitin-specific protease
          Length = 887

 Score = 72.8 bits (177), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 69/149 (46%), Gaps = 38/149 (25%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNI---------------- 1432
            K  + K L    +PR L+IHL RF  ++  KNNI V YP IL++                
Sbjct: 753  KQPSTKKLTITRLPRNLIIHLKRF-DNMMNKNNIFVRYPQILDLTPFWANDSDGKLPPGI 811

Query: 1433 ---VLKNSEVAKF--RLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQK-WYYFDDEIV 1486
               +    +V  F  RLY    HFGTL  GHYTS V+K        G +K W YFDD + 
Sbjct: 812  TDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDK--------GPEKGWIYFDDTVY 863

Query: 1487 KFDTNHGDYDNGIASVSSSNVYVLFYERI 1515
            +       + N   S S+   YVLFY RI
Sbjct: 864  R----PVRFQNEFISPSA---YVLFYHRI 885

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 112/282 (39%), Gaps = 66/282 (23%)

Query: 1083 PIPHFSI----PTIENSYNEYVALSIT-GLRNMSNTCYINSMLQCLFSTSAFRNLF---- 1133
            PIP   I    P    S N+ +  S T GL NM N+CYIN ++QC+F+T+    +F    
Sbjct: 498  PIPSTLIRKNSPEKTLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLNGT 557

Query: 1134 ----------------LSNKYAHYLKSPEMDTMSRSF---YMLFRKMYMNGGCSVVPSGF 1174
                            LS+ +A  LK    +  S+     +   + +     C+ V S F
Sbjct: 558  YAKHINKQSKLGSKGVLSHNFAKLLKDMYEENSSKKIGKKHGAVKTLQFKMACASVNSLF 617

Query: 1175 --------LKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESVSNDYSHLLLHD 1226
                    L+ C  L   L     Q                    ++ +S +   +   +
Sbjct: 618  KDASQQDCLEFCQFLLDGLHEDLNQCGAN--------------PPLKELSPEAEKM--RE 661

Query: 1227 NVRLYVDDA-QYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSL 1285
            N+ L V  + ++ ++   +      S I DLFQGQ  +QL C+ C  +S TY  F VLS 
Sbjct: 662  NLSLRVASSIEWERYLTTD-----FSIIVDLFQGQYASQLRCKVCNRTSTTYQAFSVLS- 715

Query: 1286 ALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRC 1327
             +P P  K+ G      L DC   FT  E L     W CP C
Sbjct: 716  -VPVPSGKSCG------LLDCFIEFTKTENLEVDEQWFCPSC 750

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 11/103 (10%)

Query: 318 SSSIKCLDLLSKLTSSERSSMLLIDLRLPKRYEYSHILAENVINIDPELL---WDDEKGA 374
            S I C +LLS L   +  S+LLID+R    Y+  HI  +N+I I+P      + D++  
Sbjct: 187 GSGISCSELLS-LMKMKEDSLLLIDVRPKLEYDAHHIKTKNIICIEPISFKESYSDQQIE 245

Query: 375 PVSSVKELELVIDNHLFRSRRQFATIVCYTD-----NYTYMQI 412
             S +   +  I   LF+ R +F  I+ YTD     N+ + Q+
Sbjct: 246 KTSMIPSPKHEI--QLFQRRSEFQYIILYTDLEEKSNFYFQQL 286

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
            Anc_8.188 YDR069C
          Length = 671

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 93/437 (21%), Positives = 163/437 (37%), Gaps = 109/437 (24%)

Query: 1085 PHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKS 1144
            P+++ PT+           I G++N  N CY+N ++QCL     F N FL N Y      
Sbjct: 335  PNYTSPTV-----------IKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAY------ 377

Query: 1145 PEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKP-----DLRIPYGQQDTQXXXX 1199
              + T++ +  +  + + +     ++ + F      ++P     + R  +     +    
Sbjct: 378  --LGTINVNSRLGHQGLVVKNWAKIIQAFFQVSQENIQPAVSITEFREQWANLFPEYGKY 435

Query: 1200 XXXXXXXXXXSSIESVSNDYSHLLLHD-NVRLYVDDAQYNKWFDQNIDQNGLSP-IDDLF 1257
                        +E +  D +     + +  + VDD +   W   N+ + G S  I D F
Sbjct: 436  QQHDCSEFCLRLLEEIHEDSNWGRPQNSDAAMQVDDYR-EAW---NLYRKGNSSYIVDTF 491

Query: 1258 QGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLS 1317
            +GQ+++QL+CQ C   S  Y  F +L+L +P              + DC+       VL+
Sbjct: 492  KGQIKSQLTCQVCQTQSNNYEPFSILNLPIP--------LVSMCHIYDCMKELFKVHVLT 543

Query: 1318 DQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKF 1377
              + W C  C             K K  ++                 G  + +  E    
Sbjct: 544  GDDRWYCSTC-------------KTKTHST----------------LGTTITNVPEVLII 574

Query: 1378 SSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNS 1437
                 D + N K        F+  P +L         DL++ N +           L   
Sbjct: 575  HFNRFDNLLNKKEC------FVKYPYLL---------DLSQGNGL-----------LGKC 608

Query: 1438 EVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDN 1497
            +V  ++L ++  H GTL SGHYT+   K       + +  WY+FDD   K  +N      
Sbjct: 609  DVP-YKLVAVACHTGTLFSGHYTAYCFK-------NSENGWYHFDDTQCKPVSN------ 654

Query: 1498 GIASVSSSNVYVLFYER 1514
                  S + Y+LFY++
Sbjct: 655  --GECISQSAYLLFYQK 669

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 63.5 bits (153), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 115/284 (40%), Gaps = 78/284 (27%)

Query: 1253 IDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTC 1312
            I D+F G ++ ++ C+ CG  S T    Y LSL L         K KKL   D       
Sbjct: 471  IYDIFGGLLQQRVKCKSCGSVSITEQPIYDLSLHL---------KGKKLAKGD------- 514

Query: 1313 DEVLSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRS 1372
            D  + D    D     +PS                      G++  ++L K  Y +  +S
Sbjct: 515  DSTVDDSITGDVKNSAAPS----------------------GSTDGAELPKRRYSIE-KS 551

Query: 1373 EAPKFSSKLSDKVSNGK-------PATVKSLN---FITMPRILVIHLSRFIYDLTKKNNI 1422
                F+ +L  KV N +        AT  ++     +  P  L++HL +F ++ T  + +
Sbjct: 552  IRDFFNPELIKKVDNKEGYVCEKCKATTNAIKRNMILRAPETLLVHLKKFRFNGTSSSKM 611

Query: 1423 --VVSYPLILNIVLKNSEVA-----KFRLYSIVNHFG-TLISGHYTSLVNKELNHEISHG 1474
               VSYPL +++     E A     K++L S+V H G +L SGHY           I+H 
Sbjct: 612  KQAVSYPLFMDLTEYCVEAAKCLPVKYQLISVVVHEGRSLSSGHY-----------IAHC 660

Query: 1475 KQ---KWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYERI 1515
            KQ    W  +DDE +   T      N +  V   N Y L Y R+
Sbjct: 661  KQPDGTWATYDDEYINKITER----NVLKEV---NAYYLVYTRL 697

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 63.2 bits (152), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 119/289 (41%), Gaps = 62/289 (21%)

Query: 1251 SPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFF 1310
            S I D+F G ++  ++C+ CG  S T   FY LSL L        GK K    E+  N  
Sbjct: 564  SIIYDIFGGLLKQLVTCKSCGEVSKTEQPFYDLSLHLK-------GKRKLHSSEE--NVG 614

Query: 1311 TCDEVLSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRS 1370
            T    L+D ++ +  +        S   K     +TSF S  G     ++ F     +R 
Sbjct: 615  TTTNALADTDSSNAKQTQDNLVANSISSKTTSDTNTSFASQEG----LTRRFSIEKSIRD 670

Query: 1371 ---------RSEAPKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNN 1421
                       E   +  +  +K +N      K    +  P  L+IHL +F ++ T  + 
Sbjct: 671  FFNPELIKVDKEKKGYVCEKCNKTTNA----TKRSTILRAPETLLIHLKKFRFNGTSSSK 726

Query: 1422 I--VVSYPLILNIVL-----KNSEV-AKFRLYSIVNHFG-TLISGHYTSLVNKELNHEIS 1472
            +   VSYP+ L++       K+S +  K++L S+V H G +L SGHY           I+
Sbjct: 727  MKQAVSYPMFLDLTEFCEAGKDSILPVKYQLLSVVVHEGRSLSSGHY-----------IA 775

Query: 1473 HGKQ---KWYYFDDEIVKFDTNHGDYDNGIAS---VSSSNVYVLFYERI 1515
            H KQ    W  +DDE          Y N I+    +   N Y L Y R+
Sbjct: 776  HCKQPDGSWATYDDE----------YINKISEREMLKEPNAYYLLYTRL 814

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 58.9 bits (141), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 57/129 (44%), Gaps = 15/129 (11%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSI 1447
            +S+    +P  L +HL RF Y  TK +NI     V YPL L++     NS   K+ L  I
Sbjct: 604  RSVGLKQLPHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGI 663

Query: 1448 VNHFGTLIS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSN 1506
            V H G     GHY SL   +           W  FDDE V+  +     D    S + + 
Sbjct: 664  VVHMGGGPQHGHYVSLCKND--------NFGWLLFDDETVESVSEKTVLDFVGDSSTLTT 715

Query: 1507 VYVLFYERI 1515
             YVLFY  +
Sbjct: 716  AYVLFYREL 724

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 12/62 (19%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMYM 1163
            + G  N  NTCY NS+LQCL++ + FR           L+ PE ++ +R      RK+ M
Sbjct: 130  VFGFENFGNTCYCNSVLQCLYNMTEFR--------IQMLQHPERNSNTRR----KRKVDM 177

Query: 1164 NG 1165
             G
Sbjct: 178  PG 179

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
            {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
            YJL197W UBP12 Ubiquitin-specific protease present in the
            nucleus and cytoplasm that cleaves ubiquitin from
            ubiquitinated proteins
          Length = 1204

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 83/216 (38%), Gaps = 48/216 (22%)

Query: 1103 SITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE----MDTMSRSFYMLF 1158
             ITGL N+ NTCY+NS LQCL      R+ FL N +   +           ++R+F  L 
Sbjct: 291  GITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNNPLGYQGYVARAFSGLV 350

Query: 1159 RKMYMNGGCSVV-----------PSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXX 1207
            + ++   GC  +           P+GF          +   Y QQD+Q            
Sbjct: 351  QNLF---GCKTLSSGSTLTPAYSPTGFKSTIGHFN-SMFSGYMQQDSQEFITFLLDGLHE 406

Query: 1208 XXSSI-------------ESVSNDYSHL--LLHDNVRLYVDDAQYNKWFDQNIDQNGLSP 1252
              + I             E  SND++ +  L  D  +L++              Q   S 
Sbjct: 407  DLNRIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTWKLHL--------------QRNDSV 452

Query: 1253 IDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALP 1288
            I DLF G  E+ L C  C   S T+  +  L+L LP
Sbjct: 453  ITDLFVGLYESTLQCPECNNVSITFDPYNDLTLPLP 488

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 1394 KSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYP---LILNIVLKNSEVAKFRLYSIV 1448
            K +     P +L+IHL RF  +   + K + VV +P   L ++  L N    +  +Y +V
Sbjct: 914  KQIQLWDTPDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLVNKGDPRGTIYDLV 973

Query: 1449 ---NHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSS 1505
               NH+G L  GHYT+          +    KWYYFDD  V   T     + GIA    S
Sbjct: 974  AVDNHYGGLGGGHYTAYAK-------NVDDSKWYYFDDSRVTETTP----ERGIA----S 1018

Query: 1506 NVYVLFYER 1514
            + Y+LFY R
Sbjct: 1019 SAYLLFYVR 1027

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 55/122 (45%), Gaps = 15/122 (12%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNIV----VSYPLILNIVLK-NSEVA-KFRLYSIVNHFGTL 1454
            +P  L +HL RF Y   +  NI     + YPL LN+    NSEV  K+ L  IV H G  
Sbjct: 555  LPDTLTLHLKRFKYSEKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAGIVVHMGGG 614

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYE 1513
               GHY SL          H K  W  FDDE V+        +    S + +  YVLFY+
Sbjct: 615  PQHGHYVSLC--------KHQKFGWLLFDDETVEAVKEETVLEFTGESANMATAYVLFYK 666

Query: 1514 RI 1515
             +
Sbjct: 667  AV 668

 Score = 37.4 bits (85), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            + G  N  NTCY NS+LQCL++ S  R   L
Sbjct: 139  VFGYENFGNTCYCNSVLQCLYNLSPLRENIL 169

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
            (REAL)
          Length = 1255

 Score = 56.6 bits (135), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 91/222 (40%), Gaps = 42/222 (18%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE----MDTMSRSFYMLFRK 1160
            TGL N+ NTCY+NS LQCL      R+ FL N Y   +           ++R+F  L +K
Sbjct: 364  TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPLGYHGYVARAFSDLVQK 423

Query: 1161 MYMNGGCSV-----VPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESV 1215
            ++ N   S+      P    K        +   Y QQD+Q                ++S+
Sbjct: 424  LFHNKLSSMQRNAAFPPSMFKSTVGHFNSMFSGYMQQDSQEFLAFL----------LDSL 473

Query: 1216 SNDYSHLLLHDNVRLYVD------DAQYNKW----------FDQNIDQNGLSPIDDLFQG 1259
              D + ++     + Y++      D   N W          ++ ++ +N  S I DLF G
Sbjct: 474  HEDLNRII----KKAYIEKPSLSPDDDVNDWNVVKKLADDTWEMHLKRN-CSVITDLFVG 528

Query: 1260 QMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKL 1301
              ++ L C  C   S T+  +    + LP PV   + KT K+
Sbjct: 529  LYKSTLYCPECKNVSITFDPYN--DVTLPLPVDTVWSKTVKI 568

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 60/129 (46%), Gaps = 23/129 (17%)

Query: 1394 KSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYPLIL-----NIVLKNSEVAK-FRLY 1445
            K +     P IL++HL RF      + K +  V++P+       ++V K+      + LY
Sbjct: 998  KQIQLWNTPDILLVHLKRFESQRSFSDKIDATVNFPVTALDLSKHVVHKDDPRGSIYDLY 1057

Query: 1446 SIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSS 1505
            ++ NH+G L  GHYT+ V        +    KWYYFDD  V         +N I    S 
Sbjct: 1058 AVDNHYGGLGGGHYTAYVK-------NFADSKWYYFDDSRVTETVP----ENSI----SG 1102

Query: 1506 NVYVLFYER 1514
            + Y+LFY R
Sbjct: 1103 SAYLLFYIR 1111

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 56/122 (45%), Gaps = 15/122 (12%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNIV----VSYPLILNIVLK-NSEVA-KFRLYSIVNHFGTL 1454
            +P  L +HL RF Y   +  NI     + YPL LN+    NSEV  K++L  IV H G  
Sbjct: 558  LPDTLALHLKRFKYSEKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAGIVVHMGGG 617

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYE 1513
               GHY SL          H K  W  FDDE V+        +    S + +  YVLFY+
Sbjct: 618  PQHGHYVSLC--------KHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLFYK 669

Query: 1514 RI 1515
             +
Sbjct: 670  AM 671

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFR 1130
            + G  N  NTCY NS+LQCL++ S+ R
Sbjct: 140  VFGYENFGNTCYCNSVLQCLYNLSSLR 166

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 94/428 (21%), Positives = 152/428 (35%), Gaps = 133/428 (31%)

Query: 1103 SITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLK--------SPEMDTMSRSF 1154
             + GL NM +TC+++S++Q +     F    LS+K+ +           S  +D ++  F
Sbjct: 131  GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSGTKCVSCALDEIACDF 190

Query: 1155 YMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIES 1214
            Y         G  S V  GF+   N L     I +                     S + 
Sbjct: 191  Y---GNGPGTGKSSSVSKGFV---NLLSASWHINH-----------------HLVGSSQQ 227

Query: 1215 VSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSS 1274
             +++Y   LL+   +L+ D A+    F  +   +       +FQG ++N L C +CG+S 
Sbjct: 228  DAHEYWQFLLN---QLHTDHARV---FGSSKAPDCQCITHRIFQGYLKNTLQCSQCGFSK 281

Query: 1275 YTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCSPSDYM 1334
             T      LSL + N            +LEDC+                           
Sbjct: 282  TTIDPIMDLSLEIKN----------NPKLEDCL--------------------------- 304

Query: 1335 SYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKVSNGKPATVK 1394
              DH  + +  T F                 Y+ +S  +                   VK
Sbjct: 305  --DHFQREETLTDFH----------------YECQSCKQ---------------NQGVVK 331

Query: 1395 SLNFITMPRILVIHLSRFIYDL---TKKNNIVVSYPLILNIVLKNSEV-------AKFRL 1444
             L     P +LVI L RF + L   + K N  V +PL LN+     ++         + L
Sbjct: 332  QLTLHKAPNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIAYDL 391

Query: 1445 YSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSS 1504
             ++V+H GT+  GHYT++   E          +W+ F+D +V   T           V  
Sbjct: 392  LNVVSHQGTVDQGHYTTVSKTE--------DGQWFKFNDSVVTSVTE--------EQVLE 435

Query: 1505 SNVYVLFY 1512
               Y+LFY
Sbjct: 436  QQAYLLFY 443

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 56.2 bits (134), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 55/123 (44%), Gaps = 15/123 (12%)

Query: 1400 TMPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSIVNHFGT 1453
            ++P+ L +HL RF Y   K  N+     + YPLILN      +S    +RL  +V H G 
Sbjct: 563  SLPKTLSLHLKRFKYSEEKNANVKLFNKIHYPLILNASSTFDSSVSKSYRLQGVVVHMGN 622

Query: 1454 LI-SGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFY 1512
                GHY SL + EL          W  FDDE V+        D   +  S +  YVLFY
Sbjct: 623  GPHHGHYVSLCHTEL--------FGWLLFDDETVESVDESYVLDFVGSHESPTTAYVLFY 674

Query: 1513 ERI 1515
              I
Sbjct: 675  SEI 677

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 5/54 (9%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYML 1157
            + G  N  NTCY NS+LQCL+    FR   L      Y + PE     R   M+
Sbjct: 160  VFGYENFGNTCYCNSVLQCLYHLPEFRLRVL-----EYPEKPEEQERHRKRAMV 208

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1297

 Score = 56.2 bits (134), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 59/139 (42%), Gaps = 34/139 (24%)

Query: 1394 KSLNFITMPRILVIHLSRFI--YDLTKKNNIVVSYPLI---------------LNIVLKN 1436
            + +   + P IL++HL RF   Y  T K N  V +PL                       
Sbjct: 967  RQIELWSTPEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPHLPCRDGDGDGDGDDG 1026

Query: 1437 SEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDD-EIVKFDTNHGDY 1495
                 + L ++ NHFG L SGHYT+ V   ++        KWY FDD E+ + D      
Sbjct: 1027 GRENVYDLIAVDNHFGGLGSGHYTAYVKNPVD-------DKWYLFDDSEVREVDAE---- 1075

Query: 1496 DNGIASVSSSNVYVLFYER 1514
                 SV+SS  Y+LFY R
Sbjct: 1076 -----SVASSFGYLLFYRR 1089

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKS 1144
            GL N+ +TC+INS+LQCL   +  R+ FL N +A  L +
Sbjct: 352  GLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNT 390

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 1293 KAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRC 1327
            +A  + ++  LEDC++ FT  EVL+  ++W CP C
Sbjct: 925  RAGRQKQETTLEDCLDLFTAPEVLNTADSWYCPAC 959

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 56/123 (45%), Gaps = 15/123 (12%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNIV----VSYPLILNIVLK-NSEVA-KFRLYSIVNHFGTL 1454
            +P  L +HL RF Y   +  NI     + YPL LN+    NS+V  K+ L  IV H G  
Sbjct: 555  LPDTLTLHLKRFKYSEKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAGIVVHMGGG 614

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYE 1513
               GHY SL          H K  W  FDDE V+        +    S + +  YVLFY+
Sbjct: 615  PQHGHYVSLC--------KHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLFYK 666

Query: 1514 RIF 1516
             ++
Sbjct: 667  AMY 669

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            + G  N  NTCY NS+LQCL++ S+ R   L
Sbjct: 139  VFGYENFGNTCYCNSVLQCLYNLSSLRENIL 169

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 69/155 (44%), Gaps = 25/155 (16%)

Query: 1373 EAPKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNI----VVSYPL 1428
            E  + S+K   ++ N      + +    +P+ LV+HL RF Y   K  NI     V+YP 
Sbjct: 512  EILRASNKFYCEICNEYQEAERLIGIKELPKHLVVHLKRFKYCEEKNCNIKLFNKVNYPF 571

Query: 1429 ILNI--VLKNSEVAKFRLYSIVNHFGTLIS-GHYTSLVNKELNHEISHGKQKWYYFDDEI 1485
             LNI  V  +S   K+ L SIV H G     GHY +L          H    W  +DDE 
Sbjct: 572  TLNISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLC--------KHKSYGWLIYDDET 623

Query: 1486 VKFDTNHGDYDNGIASV-----SSSNVYVLFYERI 1515
            V+  +     D  ++ +      S+  Y+LFYE +
Sbjct: 624  VQAVS-----DELVSRILNNEQRSATAYLLFYEEV 653

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 1100 VALSITGLRNMSNTCYINSMLQCLFSTSAFRN 1131
            V   + G +N   TCY NS+LQ LF+  +FR+
Sbjct: 101  VGERVFGFQNFGYTCYCNSILQALFNIGSFRD 132

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 55/120 (45%), Gaps = 15/120 (12%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNIV----VSYPLILNIVLK-NSEVA-KFRLYSIVNHFGTL 1454
            +P  L +HL RF Y   +  NI     + YPL LN+    NSEV  K+ L  IV H G  
Sbjct: 557  LPDTLALHLKRFKYSEKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSGIVVHMGGG 616

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYE 1513
               GHY SL      HEI      W  FDDE V+        +    S + +  YVLFY+
Sbjct: 617  PQHGHYVSLC----KHEIF----GWLLFDDETVEAVKEEAVLEFTGESPNMATAYVLFYK 668

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            + G  N  NTCY NS+LQCL++ S+ R   L
Sbjct: 140  VFGYENFGNTCYCNSVLQCLYNLSSVRENIL 170

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
            YJL197W (REAL)
          Length = 1256

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 92/227 (40%), Gaps = 44/227 (19%)

Query: 1101 ALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE----MDTMSRSFYM 1156
            A   TGL N+ NTCY+NS LQCL      R+ FL N Y   +           ++R+F  
Sbjct: 357  ASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPLGYHGYVARAFSD 416

Query: 1157 LFRKMY------MNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXS 1210
            L +K++      M    +  P+ F          +   Y QQD+Q               
Sbjct: 417  LIQKLFQNKLNIMQRNGAFPPTMFKSTIGHFNS-MFSGYMQQDSQEFLAFL--------- 466

Query: 1211 SIESVSNDYSHLLLHDNVRLYVD------DAQYNKW----------FDQNIDQNGLSPID 1254
             ++S+  D + ++     + Y++      D   N W          ++ ++ +N  S I 
Sbjct: 467  -LDSLHEDLNRII----KKAYIEKPSLSPDDDVNDWNVIKKLADDTWELHLKRNR-SVIT 520

Query: 1255 DLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKL 1301
            DLF G  ++ L C  C   S T+  +    + LP PV   + KT K+
Sbjct: 521  DLFVGMYKSTLYCPECKDVSTTFDPYN--DVTLPLPVDTVWSKTVKI 565

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 62/130 (47%), Gaps = 25/130 (19%)

Query: 1394 KSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYPLILNIVLKNSEVAK-------FRL 1444
            K +     P IL+IHL RF      + K +  V++P I ++ L    V K       + L
Sbjct: 995  KQIQLWNTPDILLIHLKRFESQRSFSDKIDDTVNFP-ITDLDLSEHVVYKDDPRGSIYDL 1053

Query: 1445 YSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSS 1504
            Y++ NH+G L  GHYT+ V   +++       KWYYFDD  V         +N +A    
Sbjct: 1054 YAVDNHYGGLGGGHYTAYVKNFMDN-------KWYYFDDSRVTETVP----ENSVA---- 1098

Query: 1505 SNVYVLFYER 1514
             + Y+LFY R
Sbjct: 1099 GSAYLLFYIR 1108

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            present in the nucleus and cytoplasm that cleaves
            ubiquitin from ubiquitinated proteins
          Length = 1254

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 90/216 (41%), Gaps = 22/216 (10%)

Query: 1101 ALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE----MDTMSRSFYM 1156
            A   TGL N+ NTCY+NS LQCL      R+ FL + Y   +           ++R+F  
Sbjct: 360  ASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPLGYHGYVARAFSD 419

Query: 1157 LFRKMY------MNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXS 1210
            L +K++      M    +  PS F          +   Y QQD+Q              +
Sbjct: 420  LVQKLFQNRMSIMQRNAAFPPSMFKSTIGHFNS-MFSGYMQQDSQEFLAFLLDSLHEDLN 478

Query: 1211 SIESVSNDYSH---LLLHDNVRLY--VDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQL 1265
             I  +  +Y+    L   D+V  +  V     + W + ++ +N  S I DLF G  ++ L
Sbjct: 479  RI--IKKEYTEKPSLSPGDDVNDWNVVKKLADDTW-EMHLKRN-CSVITDLFVGMYKSTL 534

Query: 1266 SCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKL 1301
             C  C   S T+  +    + LP PV   + KT K+
Sbjct: 535  YCPECQNVSITFDPYN--DVTLPLPVDTVWDKTIKI 568

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 60/130 (46%), Gaps = 25/130 (19%)

Query: 1394 KSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYPLILNIVLKNSEVAK-------FRL 1444
            K +     P IL+IHL RF      + K +  V++P I ++ L    V K       + L
Sbjct: 996  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFP-ITDLDLSRYVVYKDDPRGLIYDL 1054

Query: 1445 YSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSS 1504
            Y++ NH+G L  GHYT+ V        +    KWYYFDD  V         +N IA    
Sbjct: 1055 YAVDNHYGGLGGGHYTAYVK-------NFADNKWYYFDDSRV----TETAPENSIA---- 1099

Query: 1505 SNVYVLFYER 1514
             + Y+LFY R
Sbjct: 1100 GSAYLLFYIR 1109

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
            (REAL)
          Length = 1247

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 92/224 (41%), Gaps = 38/224 (16%)

Query: 1101 ALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE----MDTMSRSFYM 1156
            A   TGL N+ NTCY+NS LQCL      R+ FL + Y + +           ++R+F  
Sbjct: 360  ASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEENPLGYHGYVARAFSD 419

Query: 1157 LFRKMY------MNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXS 1210
            L +K++      M    +  PS F          +   Y QQD+Q               
Sbjct: 420  LIQKIFQNRLSVMQRNGAFPPSMFKSTVGHFN-SMFSGYMQQDSQEFLAFL--------- 469

Query: 1211 SIESVSNDYSHLLLHDNVRL-------YVDDAQYNK------WFDQNIDQNGLSPIDDLF 1257
             ++S+  D + ++  + +          VDD    K      W + ++ +N  S I DLF
Sbjct: 470  -LDSLHEDLNRIIKKEYIEKPSLSPGDDVDDWNVVKKLADDTW-EMHLKRN-CSVITDLF 526

Query: 1258 QGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKL 1301
             G  ++ L C  C   S T+  +    + LP PV   + KT K+
Sbjct: 527  VGMYKSTLYCPECKNVSITFDPYN--DVTLPLPVDTVWNKTVKI 568

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 1394 KSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYP-----LILNIVLKNSEVAK-FRLY 1445
            K +     P IL+IHL RF      + K +  V++P     L  N+V K+      + LY
Sbjct: 992  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSKNVVYKDDPRGSIYDLY 1051

Query: 1446 SIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSS 1505
            ++ NH+G L  GHYT+ V    N+       KWYYFDD  V         +N IA     
Sbjct: 1052 AVDNHYGGLGGGHYTAYVKNFANN-------KWYYFDDSRVTETVP----ENSIA----G 1096

Query: 1506 NVYVLFYER 1514
            + Y+LFY R
Sbjct: 1097 SAYLLFYIR 1105

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 61/131 (46%), Gaps = 15/131 (11%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSI 1447
            +++    +P  L++HL RF Y   + +NI     V YPLIL +    K ++  K+ L  I
Sbjct: 511  RAVELKKLPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGI 570

Query: 1448 VNHFGTLIS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSN 1506
            V H G     GHY +L   E        K  W ++DDE V+  +            + S 
Sbjct: 571  VIHVGDGPQMGHYVALCKTE--------KYGWLFYDDETVESVSEETVLKFIGDEKTQST 622

Query: 1507 VYVLFYERIFD 1517
             YVLFY+++ D
Sbjct: 623  AYVLFYKKLGD 633

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 51/117 (43%), Gaps = 25/117 (21%)

Query: 1054 NSSISHKGADRSPEETNNIKVDGHKLIRNPIPHFSIPTIENSYNEYVALS-----ITGLR 1108
            N+   +    ++P  TN +  D  +++  PI         N+ NE +        + G  
Sbjct: 78   NTDAEYSAISKNPFITNEVGED--EVLNFPI------LFANTINEQLPFGDGSNKVFGYE 129

Query: 1109 NMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMYMNG 1165
            N  NTCY NS+LQCL++   FR         + L+ PE + M +      RK+ M G
Sbjct: 130  NFGNTCYCNSVLQCLYNLPEFR--------LNILQYPERNLMDQR----VRKLEMPG 174

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 1253 IDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTC 1312
            I+++FQG + N++ C  C   +     F    L LP  V K  G T   R+   + +++ 
Sbjct: 437  INEIFQGTLTNKVRCLTCDNVTSREEAF----LDLPIEV-KENGDTDIQRV---LKYYSQ 488

Query: 1313 DEVLSDQNAWDCPRCCS 1329
             E+L+  N ++C +CC+
Sbjct: 489  REMLNGSNKFNCSQCCA 505

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa] {ON}
            Anc_1.137 YJL197W
          Length = 1178

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 86/206 (41%), Gaps = 31/206 (15%)

Query: 1103 SITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE----MDTMSRSFYMLF 1158
             ITGL N+ NTCY+NS LQCL      R+ FL + +   + S         ++++F +L 
Sbjct: 300  GITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNPLGYQGNIAKAFSLLV 359

Query: 1159 RKMYMNGGCSVVPSGF----LKM----CNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXS 1210
            + ++     S     F     KM    CNT+       Y QQD+Q              +
Sbjct: 360  KSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSG----YMQQDSQEFLAFLLDGLHEDLN 415

Query: 1211 SIE--------SVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQME 1262
             +         S+S + S +   D ++   +D      +  ++ +N  S + DLF    E
Sbjct: 416  RVHDKPYIEKPSLSPN-SDVTDRDTIKKLAEDT-----WKMHLLRND-SIVTDLFVALYE 468

Query: 1263 NQLSCQRCGYSSYTYSTFYVLSLALP 1288
            + L C  C   S T+  +  L+L LP
Sbjct: 469  STLECPECRNVSITFDPYNDLTLPLP 494

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 58/128 (45%), Gaps = 24/128 (18%)

Query: 1394 KSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYP-----LILNIVLKNSEVAKFRLYS 1446
            K +   + P +L+IHL RF      + K +  V +P     +  ++V ++   + + L +
Sbjct: 904  KQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIA 963

Query: 1447 IVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSN 1506
            + NHFG L  GHYT+ V             KW+YFDD  V         +    S  + +
Sbjct: 964  VDNHFGGLGGGHYTAYVKT---------NDKWFYFDDSRVT--------ETKPESSIAGS 1006

Query: 1507 VYVLFYER 1514
             Y+LFY R
Sbjct: 1007 AYLLFYLR 1014

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 55/122 (45%), Gaps = 15/122 (12%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNIV--LKNSEVAKFRLYSIVNHF-GT 1453
            +P  L +HL RF Y   +  NI     V YPL L++     +S   K+ L  +V H  G+
Sbjct: 541  LPHTLALHLKRFKYSEEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGVVIHMGGS 600

Query: 1454 LISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYE 1513
               GHY SL   +        K  W  FDDE V+  T     +    S + +  YVLFY+
Sbjct: 601  PQHGHYVSLCKND--------KFGWLLFDDETVESVTEKTVLEFTGDSSNQATAYVLFYK 652

Query: 1514 RI 1515
             +
Sbjct: 653  EL 654

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 18/92 (19%)

Query: 1079 LIRNPIPHFSIPTIENSYNEYVALS-----ITGLRNMSNTCYINSMLQCLFSTSAFRNLF 1133
            +I +PI     P +    N+ +        + G  N  NTCY NS+LQCL++ +  R   
Sbjct: 106  IISDPIVEMESPILFTPMNQLLPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLTELR--- 162

Query: 1134 LSNKYAHYLKSPEMDTMSRSFYMLFRKMYMNG 1165
                  + L+ P  D  +R      RK+ M+G
Sbjct: 163  -----LNLLEYPARDPKTR-----IRKLDMDG 184

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
            to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
            ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 52.8 bits (125), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 88/217 (40%), Gaps = 29/217 (13%)

Query: 1103 SITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMD-------TMSRSFY 1155
             I GL N+ NTCY+NS LQCL      R+ F    Y  Y +   +D       T++ +F 
Sbjct: 287  GIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFF---YGGYEQEINLDNPLGYNGTVATAFG 343

Query: 1156 MLFRKMY-----MNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXS 1210
             L + +Y          S  P+ F KM       +   Y QQD+Q              +
Sbjct: 344  NLIQNLYSYHWNQQQYQSYSPNRF-KMTLGQANSMFAGYMQQDSQEFLAFLLDSLHEDLN 402

Query: 1211 S------IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQ 1264
                   IE  + + S  L  +N    V       W D ++ +N  S I+DLF G  ++ 
Sbjct: 403  RIHDKPYIEKPTLETSEELADENA---VKQLAKKTW-DAHLARND-SVINDLFVGMYKST 457

Query: 1265 LSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKL 1301
            L C  C   S T+  +    L LP P++  + K  K+
Sbjct: 458  LKCPTCKNISITFDPYN--DLTLPLPISTVWNKKVKI 492

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 19/100 (19%)

Query: 1394 KSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYPL--------ILNIVLKNSEVAKFR 1443
            K L     P IL+IHL RF      + K + VV +P+        +++ V+++  +  + 
Sbjct: 879  KQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPYVVDSVVEDGCI--YD 936

Query: 1444 LYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDD 1483
            L+++ NH+G L  GHYTS V   +++       +WYYFDD
Sbjct: 937  LFAVDNHYGGLGGGHYTSYVKNNIDN-------RWYYFDD 969

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 52.4 bits (124), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 108/278 (38%), Gaps = 74/278 (26%)

Query: 1253 IDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTC 1312
            I D+F G ++  + C  CG  S T    Y LSL L         K +K          T 
Sbjct: 480  IYDVFGGLLQQSVKCSNCGEISTTEQPIYDLSLHL---------KGRK----------TT 520

Query: 1313 DEVLSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRS 1372
            D+   DQN+         S       K +  I  S                F  ++  R 
Sbjct: 521  DQ---DQNSVGQDNSIDNSVDQQQSSKRRFSIEKSIRDF------------FNPELIKRV 565

Query: 1373 EAPK-FSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNI--VVSYPLI 1429
            +  + ++ +   KV+N     +KS   I  P  LV+HL +F ++ T  + +   VSYP+ 
Sbjct: 566  DNKEGYTCEKCKKVTNA----LKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMF 621

Query: 1430 LNIVLKNSEV-----AKFRLYSIVNHFG-TLISGHYTSLVNKELNHEISHGKQ---KWYY 1480
            L++     E       +++L S+V H G +L SGHY           I+H KQ    W  
Sbjct: 622  LDLTEYCHESISSLPVRYQLISVVVHEGRSLSSGHY-----------IAHCKQPDGSWAT 670

Query: 1481 FDDEIVKFDTNHGDYDNGIAS---VSSSNVYVLFYERI 1515
            +DDE          Y N I+    +   N Y L Y R+
Sbjct: 671  YDDE----------YINKISEKQLLKEPNAYFLVYTRL 698

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
            (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 97/216 (44%), Gaps = 25/216 (11%)

Query: 1257 FQGQMENQLSCQRCGYSSY-TYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEV 1315
            F+G++ + LSC  CG +S    STF +L +  P   +          LE+ I     D++
Sbjct: 209  FEGKLASYLSCLNCGQTSIPNISTFNILPIQTPQEYSA--------ELEEIIYGNQIDQI 260

Query: 1316 LSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRS-EA 1374
             +D +   C       +  +  HKG    +T    +         + +   ++ S++   
Sbjct: 261  -TDYSCLVCQTNAILKNEKTNGHKGN---TTDEHEIVKYLEDVLPVLRINEELDSKTLNY 316

Query: 1375 PKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYD--LTKKNNIVVSYPLILNI 1432
             K+ +K   K  N K   +K  + I  P+IL+IHLSR IY+  +  +N+  V +   ++I
Sbjct: 317  IKYYNKYGMKSGNIKSTIIKKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSI 376

Query: 1433 VLKNS---------EVAKFRLYSIVNHFGTLISGHY 1459
              + +         E+  ++L SI+ H GT  SGHY
Sbjct: 377  ERQTTDEKNENLKIELVDYQLQSIIKHTGTHNSGHY 412

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 57/130 (43%), Gaps = 27/130 (20%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNIV--LKNSEVAKFRLYSIVNHFGTL 1454
            +P IL +HL RF Y   K  NI     V YPL LN+     +S    + L  +V H G+ 
Sbjct: 645  LPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSS 704

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNH------GDYDNGIASVSSSNV 1507
               GHY SL   +        K  W  FDDE V+  +        GD +N       +  
Sbjct: 705  PQHGHYVSLCKND--------KFGWLLFDDETVESVSESTVLEFTGDPNN------QATA 750

Query: 1508 YVLFYERIFD 1517
            YVLFY+ I D
Sbjct: 751  YVLFYKEIKD 760

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFR 1130
            + G  N  NTCY NS+LQCL++   FR
Sbjct: 171  VFGYENFGNTCYCNSVLQCLYNLYEFR 197

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 59/132 (44%), Gaps = 17/132 (12%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSI 1447
            +++    +P  L +HL RF Y      NI     + YPL LN+     +S   K++L  I
Sbjct: 618  RTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGI 677

Query: 1448 VNHFGTL-ISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSN 1506
            V H G+    GHY ++   +        K  W  FDDE   +  N  +  + I    S N
Sbjct: 678  VVHMGSSPQQGHYVAICKTD--------KYGWLLFDDETASW-INEEEVLSFIGDEKSQN 728

Query: 1507 -VYVLFYERIFD 1517
              YVLFYE + D
Sbjct: 729  TAYVLFYEEVKD 740

 Score = 37.0 bits (84), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 8/72 (11%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFR-NLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMY 1162
            I G  N  NTCY NS+LQCL+    F+ NL  ++  +  L  PE   +  S  M  RK+ 
Sbjct: 154  IFGYENFGNTCYCNSVLQCLYHLDDFKLNLLKTSLRSSSL--PECSFLEDSPRM--RKLE 209

Query: 1163 MNGGCSVVPSGF 1174
            M G    +P  F
Sbjct: 210  MPGN---IPKHF 218

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 55/120 (45%), Gaps = 15/120 (12%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNIVLK--NSEVAKFRLYSIVNHFGTL 1454
            +PRIL +HL RF Y   +  NI     ++YPL L +  K   S   K+ L  +V H G  
Sbjct: 548  LPRILALHLKRFKYSEAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGGG 607

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYE 1513
               GHY S+   +           W +FDDE V+        +    + +S+  YVLFY+
Sbjct: 608  PQHGHYVSVCKTD--------NFGWLFFDDETVETLDEPQVLNFTGDTTTSTTAYVLFYK 659

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (67%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            I G  N  NTCY NS+LQCLF+ + FRN  L
Sbjct: 113  IFGYENFGNTCYCNSILQCLFNLTEFRNSIL 143

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
            Anc_1.137 YJL197W
          Length = 1201

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 87/211 (41%), Gaps = 28/211 (13%)

Query: 1096 YNEYV-ALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE----MDTM 1150
            YN+ V +L ITGL N+ NTCY+NS LQC+     FR  FL + Y   L +         +
Sbjct: 311  YNDLVPSLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHV 370

Query: 1151 SRSFYMLFRKMYMNGGC---SVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXX 1207
            + +F  L R ++ +      +  P+ F          +   Y QQD+Q            
Sbjct: 371  AEAFSELIRCLFGDKLVQFSAYAPNHFKATIGHFN-SMFSGYLQQDSQEFLAFLLDSLHE 429

Query: 1208 XXSSIESV----------SNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLF 1257
              + I+            + D +   +   V+   DD      +  ++ +N  S I DLF
Sbjct: 430  DLNRIDKKPYVEKPSLPSTADLNDFRI---VKKLADDT-----WKAHLLRND-SVITDLF 480

Query: 1258 QGQMENQLSCQRCGYSSYTYSTFYVLSLALP 1288
             G  ++ L C  C   S T+  +  L+L LP
Sbjct: 481  VGLYKSTLECPECQNISITFDPYNDLTLPLP 511

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 79/218 (36%), Gaps = 66/218 (30%)

Query: 1297 KTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNS 1356
            K K++ L DC+N F+  E+LS  ++W CP C           K  R+ +   +  N  + 
Sbjct: 892  KNKEITLNDCLNLFSKPEILSLNDSWYCPTC-----------KEHRQATKQIQLWNAPDV 940

Query: 1357 SRSKLFKFGYKMRSRSEAPKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDL 1416
                L +F            FS K+ D V    P T   ++               +Y  
Sbjct: 941  LLIHLKRF-------ENQQSFSDKIDDVVQ--FPITDFDIS------------EHLVYKD 979

Query: 1417 TKKNNIVVSYPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQ 1476
              + N+                   + L ++ NH+G L  GHYT+      +        
Sbjct: 980  DPRGNV-------------------YDLIAVDNHYGGLGGGHYTAYAKNSTD-------G 1013

Query: 1477 KWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYER 1514
            KWYYFDD  V         +N I   +    Y+LFY R
Sbjct: 1014 KWYYFDDSRV----TETVAENSITGAA----YLLFYLR 1043

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
            Anc_7.390 YBL067C
          Length = 715

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 48/93 (51%), Gaps = 15/93 (16%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI-VLKNSEVAK-FRLYSIVNHFGTL 1454
            +P  L++HL RF Y   + +NI     ++YPL+L +    NS+++K + L  IV H G  
Sbjct: 520  LPETLILHLKRFKYSEEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGIVLHLGGG 579

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
               GHY S+   E        K  W  FDDE+V
Sbjct: 580  PQHGHYVSICKNE--------KYGWLLFDDEVV 604

 Score = 37.0 bits (84), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 1075 DGHKLIRNPIPH---FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRN 1131
            D  +L++N   H     I  + +S N+     + G  N  NTCY NS+LQCL++    R+
Sbjct: 84   DPRELVKNDSDHQKLLEITKLSDSSNK-----VFGYENFGNTCYCNSVLQCLYNIPELRD 138

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 57/126 (45%), Gaps = 27/126 (21%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNIVLK-NSEVAK-FRLYSIVNHFGTL 1454
            +P+ L +HL RF Y   + +NI     VSYPL L +    N  ++K + L  IV H G  
Sbjct: 566  LPKTLALHLKRFKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGIVVHMGGG 625

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNH------GDYDNGIASVSSSNV 1507
               GHY SL   E        K  W  FDDE V+  +        GD D      + +  
Sbjct: 626  PQHGHYISLCKNE--------KFGWLLFDDETVEAISEQAVLQYTGDKD------TMTTA 671

Query: 1508 YVLFYE 1513
            YVLFY+
Sbjct: 672  YVLFYQ 677

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            I G  N  NTCY NS+LQCL++   FRN  L
Sbjct: 149  IFGYENFGNTCYCNSVLQCLYNLPEFRNDML 179

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
            YJL197W
          Length = 1286

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 83/207 (40%), Gaps = 39/207 (18%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMD-------TMSRSFYML 1157
             GL N+ NTCY+NS LQCL      R+ F   K+  Y     +D        ++ +F  L
Sbjct: 398  VGLNNLGNTCYMNSALQCLAHIPPIRDYF---KFGAYKNEINLDNPLGFQGNIANAFSAL 454

Query: 1158 FRKMYMNG---GCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIE- 1213
             + +Y N      S  PS F K+       +   Y QQD+Q              + I+ 
Sbjct: 455  VQNLYKNQFIPSASYAPSQF-KLTIGHYNQMFSGYFQQDSQEFLAFLLDGLHEDLNRIKD 513

Query: 1214 ------------SVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQM 1261
                        S  NDY+ +      RL  D        + ++ +N  S I DLF G  
Sbjct: 514  KPYVEKPSLADGSDVNDYNII-----ARLAADT------LEAHLKRND-SIIIDLFVGLY 561

Query: 1262 ENQLSCQRCGYSSYTYSTFYVLSLALP 1288
            ++ L C  C + S T+  +  L+L +P
Sbjct: 562  KSTLKCPVCNHVSITFDPYCDLTLPIP 588

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 61/129 (47%), Gaps = 23/129 (17%)

Query: 1394 KSLNFITMPRILVIHLSRFIYD--LTKKNNIVVSYP---LILNIVLKNSEVAKFRLYSIV 1448
            K +   + P IL IHL RF      + K + VV +P   L L+  + +   ++  +Y ++
Sbjct: 996  KQIQLWSTPDILTIHLKRFETQGSFSDKIDDVVDFPINGLDLSKHILDKSTSQLNIYDLI 1055

Query: 1449 ---NHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSS 1505
               NH+G L  GHYT+ +   +++       KWYYFDD  V              SV+ S
Sbjct: 1056 AVDNHYGGLGGGHYTAYIKNLIDN-------KWYYFDDSRVSETVPE-------RSVAGS 1101

Query: 1506 NVYVLFYER 1514
              Y+LFY R
Sbjct: 1102 -AYLLFYMR 1109

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YJL197W
            (UBP12)
          Length = 1287

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 81/197 (41%), Gaps = 21/197 (10%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHY--LKSP--EMDTMSRSFYMLFRKM 1161
            GL N+ NTCY+NS LQCL     F++ FL N Y     +++P      ++ +F  + + +
Sbjct: 347  GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWAFASMVQAL 406

Query: 1162 Y---MNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSS-IESVSN 1217
            +    +   S  P  F      L   +   Y QQD+Q              +  IE    
Sbjct: 407  FGKRHSAATSYSPRNFKNTIGHLN-SMFSGYQQQDSQEFLAFLLDGLHEDLNRIIEKPYV 465

Query: 1218 DYSHLLLHDN------VRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCG 1271
            +   L   D+      ++   DD     W    +  +  S I DLF G  ++ L C  C 
Sbjct: 466  EKPELTSTDDTAEFKVIKKLADDT----WGKHKLRND--SVITDLFVGLYKSTLICPVCK 519

Query: 1272 YSSYTYSTFYVLSLALP 1288
             +S T+  +  L+L LP
Sbjct: 520  KTSVTFDPYNDLTLPLP 536

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 81/224 (36%), Gaps = 83/224 (37%)

Query: 1299 KKLRLEDCINFFTCDEVLSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSR 1358
            KK+ L DC+  F+  EVL   ++W CP C           K  R+ +   E  N      
Sbjct: 960  KKITLHDCLTLFSTPEVLGATDSWFCPNC-----------KEHRQATKQIELWNA----- 1003

Query: 1359 SKLFKFGYKMRSRSEAPKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTK 1418
                                                       P IL+IHL RF    + 
Sbjct: 1004 -------------------------------------------PDILLIHLKRFENQRSF 1020

Query: 1419 KNNIV--VSYP-----LILNIVLKNSEVAK-FRLYSIVNHFGTLISGHYTSLVNKELNHE 1470
             + I   V +P     +   +V KN +    + L ++ NH+G L  GHYT+ V K ++  
Sbjct: 1021 SDKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLIAVDNHYGGLGGGHYTAYV-KNID-- 1077

Query: 1471 ISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYER 1514
                  KWYYFDD  V         +  IA     + Y+LFY R
Sbjct: 1078 -----GKWYYFDDSRVSETLP----ERSIA----GSAYLLFYRR 1108

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
            similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 93/221 (42%), Gaps = 36/221 (16%)

Query: 1257 FQGQMENQLSCQRCGYSSYTYST-FYVLSLALPNPVAKAFGKTKKLRLEDCINFFTC--- 1312
            F+G++ + L C  C  SS    T F +L LA+P  +     +       + I  ++C   
Sbjct: 335  FRGKVADHLVCTACRNSSKVRVTQFNMLPLAVPQAITAKLAEMVSDNQVESIEGYSCLTC 394

Query: 1313 --DEVLSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKF--GYKM 1368
               ++L ++   D       S Y + +      ++ +F +L   +    +L  +  GY  
Sbjct: 395  KVGKILENEKGRDT------SSYETTEQNTLASLARAFPNLTINDDVSEELMNYINGYNR 448

Query: 1369 RSRSEAPKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTK--KNNIVVSY 1426
                     +S+L       K   VK    +  P++L+IHLSR +++ T   +N   V++
Sbjct: 449  DGL-----VTSQL-------KSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNF 496

Query: 1427 PLILNI---VLKNSEV-----AKFRLYSIVNHFGTLISGHY 1459
              IL +   V++N          + L +IV H G+   GHY
Sbjct: 497  DEILQLQEQVIQNDRCVGINSVNYELKAIVKHAGSHSQGHY 537

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 62/134 (46%), Gaps = 26/134 (19%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIV--VSYPLILNI--VLKNSEVAKFRLYSIVN 1449
            K++ F  +P+ L +HL RF  D    + +   + YPL L +     NS    + L  +V 
Sbjct: 531  KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 1450 HFG-TLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV-----KFDTNH-GDYDNGIASV 1502
            H G +   GHY S+          H K  W  +DDE +     +  T+H G+ +N I + 
Sbjct: 591  HVGASPTHGHYVSIC--------KHEKYGWLMYDDETIESIPEEAVTSHVGEPNNPITA- 641

Query: 1503 SSSNVYVLFY-ERI 1515
                 YVLFY E+I
Sbjct: 642  -----YVLFYSEKI 650

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 3/61 (4%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMYM 1163
            + G  N  +TCY NS+LQC+++   FR   L     + LKS         F+ L  + Y+
Sbjct: 120  VFGYENFGHTCYCNSVLQCIYNLPEFRKSILQFPQRYPLKS---RVRVEEFHSLHERNYI 176

Query: 1164 N 1164
            N
Sbjct: 177  N 177

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
            YPL072W
          Length = 494

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 93/221 (42%), Gaps = 35/221 (15%)

Query: 1257 FQGQMENQLSCQRCGYSSYTYST-FYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEV 1315
            F+G + N L C +CG +S+     FY+  L LP        +   ++L D +N     E 
Sbjct: 191  FKGIVGNHLVCLQCGRTSHVNEQPFYIYELTLP--------QQGSVKLSDLVN----GEQ 238

Query: 1316 LSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAP 1375
            +     + C  C + +  ++ + + K  +S +   LN     + KL      +    E P
Sbjct: 239  METIENYSCMYCKTVA-MLTNEREEKSNVSRTDAELNILKFLKGKL----STLLINEELP 293

Query: 1376 KFSSKLSDKVSNG-------KPATVKSLNFITMPRILVIHLSRFIYDLTK--KNNIVVSY 1426
            +  +   +  + G       K   V+   F   P I +IHLSR +++     +N   V +
Sbjct: 294  EHITHYINSYNKGYCNTSEIKSVIVRKSTFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEF 353

Query: 1427 P---LILNIVLKNS-----EVAKFRLYSIVNHFGTLISGHY 1459
                L+   +LK+      E  K++L SIV H G+   GHY
Sbjct: 354  EEEILLPRQILKDHQCVGFETVKYKLKSIVKHTGSHYQGHY 394

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1252

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 78/215 (36%), Gaps = 36/215 (16%)

Query: 1096 YNEYVALS-ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL--------KSPE 1146
            YN+  A S I GL N+ NTCY+NS LQCL         FL   Y   +        K   
Sbjct: 329  YNKLNAPSGIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDV 388

Query: 1147 MDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXX 1206
                    Y LF   Y        P  F          L   YGQQD+Q           
Sbjct: 389  AHAFGHLLYSLFAPSY-GQSTFYAPRNFKNTIGHYN-SLFAGYGQQDSQEFLAFL----- 441

Query: 1207 XXXSSIESVSNDYSHLLL--HDNVRLYVDDAQY-----------NKWFDQNIDQNGLSPI 1253
                 ++ +  D + ++   + N   + +D Q            N W    I +   S I
Sbjct: 442  -----LDGLHEDLNRVIEKPYVNKPEFPNDGQIDDTDQIVLLAANMW--DYIKKRNDSVI 494

Query: 1254 DDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALP 1288
             DLF G  ++ L C  C + S T+  +  L+L LP
Sbjct: 495  MDLFVGLYKSTLVCPNCNHVSITFDPYNDLTLPLP 529

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 59/129 (45%), Gaps = 23/129 (17%)

Query: 1394 KSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYP---LILNIVL---KNSEVAKFRLY 1445
            K +     P IL+IHL RF      + K +  V +P   L ++  L   K  E   + L 
Sbjct: 936  KQIELWNTPDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDVYDLI 995

Query: 1446 SIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSS 1505
            ++ NH+G L  GHYT+     ++        KWYYFDD  V    N    +N IA     
Sbjct: 996  AVDNHYGGLGGGHYTAYCRNFID-------GKWYYFDDSRV----NEVSPENSIA----G 1040

Query: 1506 NVYVLFYER 1514
            + Y+LFY R
Sbjct: 1041 SAYLLFYRR 1049

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 35/137 (25%)

Query: 1393 VKSLNFITMPRILVIHLSRFIYD--LTKKNNIVVSYPLILNIVL-----KNSEVAKFRLY 1445
            +K    +  P  LV+HL +F ++   + K    VSYP+ L+I       K    AK++L 
Sbjct: 705  IKRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITEYCESSKKVLPAKYQLL 764

Query: 1446 SIVNHFG-TLISGHYTSLVNKELNHEISHGKQ---KWYYFDDEIVKFDTNHGDYDNGIAS 1501
            S+V H G +L SGHY           I+H +Q    W  +DDE++          N I+ 
Sbjct: 765  SVVVHEGRSLSSGHY-----------IAHCRQPDGTWATYDDELI----------NKISE 803

Query: 1502 ---VSSSNVYVLFYERI 1515
               ++  N Y L Y R+
Sbjct: 804  LKLLTEPNAYYLVYTRL 820

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 80/196 (40%), Gaps = 41/196 (20%)

Query: 1099 YVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLF 1158
            +  L   GL N   TCY N+ +Q +    A ++         Y K+ + +++S +     
Sbjct: 436  FANLRPKGLINHGVTCYTNAAVQAMVHIPAVQHYLFDILRGKY-KNIDPNSVSYTLAETT 494

Query: 1159 RKMYMN---GGCSVV----PSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSS 1211
            R+M+++   G   V+    P+  ++  + +   +  PY Q+D                  
Sbjct: 495  RRMWLSNKKGNKKVIAYYNPNELIERLDDINWSMN-PYNQED------------------ 535

Query: 1212 IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCG 1271
                S++Y   L+    +L  +     +   ++I       I D+F G +E  ++C+ CG
Sbjct: 536  ----SHEYFMSLMS---KLQENSVPIGRNMTESI-------IYDIFGGLLEQTVTCKSCG 581

Query: 1272 YSSYTYSTFYVLSLAL 1287
              S T   FY LSL L
Sbjct: 582  GVSKTEQEFYDLSLDL 597

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 56/129 (43%), Gaps = 33/129 (25%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSIVNHFGTL 1454
            +P IL +HL RF Y   +K+NI     + YPL L++      S   K+ L  +V H G+ 
Sbjct: 554  LPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGSG 613

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDE---------IVKFDTNHGDYDNGIASVSS 1504
               GHY  +   E        K  W  +DDE         +++F  + GD          
Sbjct: 614  PQHGHYVCICRNE--------KFGWLLYDDETVESIKEETVLQFTGHPGD---------Q 656

Query: 1505 SNVYVLFYE 1513
            +  YVLFY+
Sbjct: 657  TTAYVLFYK 665

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFR 1130
            + G  N  NTCY NS+LQCL++   FR
Sbjct: 133  VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
            similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 57/136 (41%), Gaps = 15/136 (11%)

Query: 1387 NGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNI----VVSYPLILNIVLKNSEVA-- 1440
            NG     +++    +P+IL +HL RF Y    ++NI     + YPL L +  K+  +   
Sbjct: 576  NGLQEAERTVGLKQLPKILSLHLKRFKYSEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCK 635

Query: 1441 KFRLYSIVNHFGTLIS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGI 1499
             + L  IV H G     GHY ++          H    W  +DDE V+       +    
Sbjct: 636  NYELNGIVIHMGGGPQHGHYVAIC--------KHDMFGWLLYDDETVESIDEETVFKFVG 687

Query: 1500 ASVSSSNVYVLFYERI 1515
                 +  YVLF++ +
Sbjct: 688  DEKDMTTAYVLFFKEV 703

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            + GL N  NTCY NS+LQCLF+ S  R   L
Sbjct: 132  VFGLENFGNTCYCNSVLQCLFNLSELRTNIL 162

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1.137
            YJL197W
          Length = 1462

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 62/129 (48%), Gaps = 23/129 (17%)

Query: 1394 KSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYP-----LILNIVLKNSEVAK-FRLY 1445
            K +     P IL+IHL RF      + K + VV++P     L  +IV  + E +  + L 
Sbjct: 1104 KQIELWNTPDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYDLI 1163

Query: 1446 SIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSS 1505
            ++ NH+G L  GHYT+ V   ++       QKWYYFDD  V       D    I    S 
Sbjct: 1164 AVDNHYGGLGGGHYTAYVKNFVD-------QKWYYFDDSRVSL----ADPQRSI----SG 1208

Query: 1506 NVYVLFYER 1514
            + Y+LFY R
Sbjct: 1209 SAYLLFYVR 1217

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 89/231 (38%), Gaps = 61/231 (26%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL--------KSPEMDTMSRSFYML 1157
            GL N+ NTCY+NS LQCL     F   FL N Y   +        +    +   +  + L
Sbjct: 415  GLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANAFGKLIHKL 474

Query: 1158 FRKMYMNGGC--------SVVPSGF---LKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXX 1206
            F +  ++           S  P+ F   +  CN++       Y QQD+Q           
Sbjct: 475  FEERIIDNESEKSSFSINSFSPTNFKSTVGYCNSMFSG----YLQQDSQEFLAFI----- 525

Query: 1207 XXXSSIESVSNDYSHLL---------LHDN--------VRLYVDDAQYNKWFDQNIDQNG 1249
                 ++ +  D + +L         L +N        ++   DD      ++ ++ +N 
Sbjct: 526  -----LDGLHEDLNRILKKPFVEKPSLPENSNYKDYKVIKKLADDT-----WEAHLKRND 575

Query: 1250 LSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALP-----NPVAKAF 1295
             S + DLF G  ++ L C  C   S T+  +  L+L LP     N V K F
Sbjct: 576  -SIVTDLFVGMYKSTLQCPDCHNVSVTFDPYNDLTLPLPVETIWNKVIKIF 625

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
            similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 78/201 (38%), Gaps = 27/201 (13%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDT-------MSRSFYML 1157
             GL N+ NTCY+NS LQCL     F++ FL N Y    K   +D        ++ +F  L
Sbjct: 349  VGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYE---KEINVDNPLGHKGHIAWAFGTL 405

Query: 1158 FRKMYM---NGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSI-- 1212
             + ++    N   S  P  F      L   +   Y QQD+Q              + I  
Sbjct: 406  IQSLFGKRNNLISSYSPRHFKTTIGHLN-SMFAGYQQQDSQEFLAFLLDGLHEDLNRIVD 464

Query: 1213 -----ESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSC 1267
                 +   N    +   + ++   DD     W    +  +  S I DLF G  ++ L C
Sbjct: 465  KPYVEKPELNPTDDVTEFETIKKLADDT----WLKHKLRND--SVILDLFVGLYKSTLIC 518

Query: 1268 QRCGYSSYTYSTFYVLSLALP 1288
              C   S T+  +  L+L LP
Sbjct: 519  PTCKKVSTTFDPYNDLTLPLP 539

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 80/216 (37%), Gaps = 66/216 (30%)

Query: 1299 KKLRLEDCINFFTCDEVLSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSR 1358
            KK+ L DC+  F+  EVL   ++W CP C           K  R+ +   E  N  +   
Sbjct: 935  KKITLHDCLTLFSTPEVLGATDSWYCPSC-----------KEHRQATKQIELWNTPDILL 983

Query: 1359 SKLFKFGYKMRSRSEAPKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTK 1418
              L +F    RS      FS K+ D               +  P   +      +Y   K
Sbjct: 984  IHLKRFE-NQRS------FSDKIGD--------------IVHFPITDLDMSPYLVYKDDK 1022

Query: 1419 KNNIVVSYPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKW 1478
            K  I                   + L ++ NH+G L  GHYT+ V   L++       KW
Sbjct: 1023 KGTI-------------------YDLIAVDNHYGGLGGGHYTAYVKNFLDN-------KW 1056

Query: 1479 YYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYER 1514
            YYFDD  V    N    +  IA     + Y+LFY R
Sbjct: 1057 YYFDDSRV----NETVPERSIA----GSAYLLFYRR 1084

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 56/131 (42%), Gaps = 33/131 (25%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSIVNHFGTL 1454
            +P IL +HL RF Y   + +NI     + YPL L++      S   ++ L  +V H G+ 
Sbjct: 557  VPYILSLHLKRFKYSEEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGSG 616

Query: 1455 -ISGHYTSLVNKELNHEISHGKQKWYYFDDE---------IVKFDTNHGDYDNGIASVSS 1504
               GHY  +   E        K  W  +DDE         ++KF  + GD          
Sbjct: 617  PQHGHYVCICKNE--------KFGWLLYDDETVESVSEETVLKFTGHSGD---------Q 659

Query: 1505 SNVYVLFYERI 1515
            +  YVLFY+ I
Sbjct: 660  TTAYVLFYKEI 670

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFR 1130
            + G  N  NTCY NS+LQCL++   FR
Sbjct: 135  VFGYENFGNTCYCNSVLQCLYNIPEFR 161

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 56/129 (43%), Gaps = 33/129 (25%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSIVNHFGTL 1454
            +P IL +HL RF Y   +K+NI     + YPL L++      S   K+ L  +V H G+ 
Sbjct: 552  LPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSG 611

Query: 1455 -ISGHYTSLVNKELNHEISHGKQKWYYFDDE---------IVKFDTNHGDYDNGIASVSS 1504
               GHY  +   E        K  W  +DDE         +++F  + GD          
Sbjct: 612  PQHGHYVCICKNE--------KFGWLLYDDETVESIREETVLQFTGHPGD---------Q 654

Query: 1505 SNVYVLFYE 1513
            +  YVLFY+
Sbjct: 655  TTAYVLFYK 663

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFR 1130
            + G  N  NTCY NS+LQCL++   FR
Sbjct: 133  VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
            Anc_1.137 YJL197W
          Length = 1253

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 77/203 (37%), Gaps = 33/203 (16%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE----MDTMSRSFYMLFRKM 1161
            GL N+ NTCY+NS LQC+     FR+ FL   +   +           M+R+F  L + +
Sbjct: 331  GLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNEGNPLGYQGYMARAFSDLIQSL 390

Query: 1162 YMNGGCSVV---PSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESVS-- 1216
            + +   S     PS F          +   Y QQD+Q              + I+     
Sbjct: 391  FGDNITSTTAYSPSYFKSTLGHFN-SMFSGYLQQDSQEFLAFLLDSLHEDLNRIDKKPYV 449

Query: 1217 -----------NDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQL 1265
                       ND+      D V+   DD     W    +  + +  I DLF    ++ L
Sbjct: 450  EKPSLPLTANLNDF------DVVKRLADDT----WKAHLLRNDSV--ITDLFVAMYKSTL 497

Query: 1266 SCQRCGYSSYTYSTFYVLSLALP 1288
             C  C  +S T+  +  L+L LP
Sbjct: 498  KCPECQNTSVTFDPYNDLTLPLP 520

 Score = 41.6 bits (96), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 85/234 (36%), Gaps = 72/234 (30%)

Query: 1287 LPNPVAKAFGKTKK------LRLEDCINFFTCDEVLSDQNAWDCPRCCSPSDYMSYDHKG 1340
            LPNP  +   + +       + L+DC+  F+  E+LS  ++W CP C           K 
Sbjct: 919  LPNPQLEKLKEQRDKQEERHITLDDCLKLFSKPEILSSNDSWYCPHC-----------KE 967

Query: 1341 KRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKVSNGKPATVKSLNFIT 1400
             R+ +   E  N  +     L +F      RS    FS K+ D V            F  
Sbjct: 968  HRQATKQIELWNTPDILLIHLKRFE---NQRS----FSDKIVDTVF-----------FPI 1009

Query: 1401 MPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHYT 1460
                +  HL   +Y    + N+                   + L ++ NH+G L  GHYT
Sbjct: 1010 TDFDISEHL---VYKEDPRGNV-------------------YDLIAVDNHYGGLGGGHYT 1047

Query: 1461 SLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYER 1514
            +          +    KWYYFDD  V              S++ S  Y+LFY R
Sbjct: 1048 AYAK-------NANDNKWYYFDDSRVSVTAPE-------KSIAGS-AYLLFYVR 1086

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
            YJL197W
          Length = 1171

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 83/208 (39%), Gaps = 19/208 (9%)

Query: 1096 YNEYV-ALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEM----DTM 1150
            YN++  A    GL N+ NTCY+NS LQCL      R+ FL + Y   L +  +      +
Sbjct: 313  YNDFHHAKGTMGLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYV 372

Query: 1151 SRSFYMLFRKMY------MNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXX 1204
            +++F  L + ++           S  P+ F          +   Y QQD+Q         
Sbjct: 373  AKAFSSLVQNLFGDTITKQGTNSSFGPNHFKSTVGHFNS-MFSGYLQQDSQEFLAFLLDS 431

Query: 1205 XXXXXSS-IESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGL---SPIDDLFQGQ 1260
                 +  I   S +   L   D+   Y D A      D+    + L   S I DLF G 
Sbjct: 432  LHEDLNRIINKPSTEKPSLKEGDD---YNDPAVIKSLADETWKMHLLRNDSVITDLFVGM 488

Query: 1261 MENQLSCQRCGYSSYTYSTFYVLSLALP 1288
             ++ L C  C   S T+  +  L+L LP
Sbjct: 489  YKSTLECPECTNVSITFDPYSDLTLPLP 516

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 61/130 (46%), Gaps = 25/130 (19%)

Query: 1394 KSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYPLILNIVLKNSEVAK-------FRL 1444
            K +     P +L+IHL RF      + K +  V++P I N+ +    V K       + L
Sbjct: 906  KRIQLWNTPDVLLIHLKRFENQRSFSDKIDATVNFP-IENLDMSPYLVHKDDPRGTVYDL 964

Query: 1445 YSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSS 1504
            Y++ NH+G L  GHYT+ V   +++       KWYYFDD  V        Y+       S
Sbjct: 965  YAVDNHYGGLGGGHYTAYVKNFIDN-------KWYYFDDSRV--------YETDPEKSVS 1009

Query: 1505 SNVYVLFYER 1514
             + Y+LFY R
Sbjct: 1010 GSAYLLFYLR 1019

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa] {ON}
            complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 83/207 (40%), Gaps = 41/207 (19%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDT-------MSRSFYMLF 1158
            GL N+ NTCY+NS LQCL      R+ FL   Y  + K   +D        ++RSF +L 
Sbjct: 343  GLNNLGNTCYMNSALQCLVHIPQLRDYFL---YKVFEKEINLDNPLGYQGHVARSFAILI 399

Query: 1159 RKMYMNG---GCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSI--- 1212
            + ++ +      S  P+ F          +   Y QQD+Q              + I   
Sbjct: 400  QNLFKDELLPSLSYSPTTFKSTVGHFNS-MFSGYLQQDSQEFIAFLLDGLHEDLNRITNK 458

Query: 1213 -----------ESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQM 1261
                       + VSN        + ++   DD      ++ ++ +N  S I D+F G  
Sbjct: 459  PVVEKPSLKPEDDVSN-------QEVIKKLADDT-----WNSHLLRND-SIITDIFVGLY 505

Query: 1262 ENQLSCQRCGYSSYTYSTFYVLSLALP 1288
            ++ L C  C   S T+  +  L+L LP
Sbjct: 506  KSTLHCPECDNLSVTFDPYNDLTLPLP 532

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (48%), Gaps = 23/129 (17%)

Query: 1394 KSLNFITMPRILVIHLSRFIYD--LTKKNNIVVSYP---LILNIVLKNSEVAKFRLYSIV 1448
            K L   + P IL+IHL RF      + K +  V +P   L L+  + N++ +K  +Y +V
Sbjct: 943  KQLQLWSTPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLV 1002

Query: 1449 ---NHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSS 1505
               NH+G L  GHYT+ V   ++       +KWYYFDD  V              S++ S
Sbjct: 1003 SVDNHYGGLGGGHYTAYVKNFVD-------KKWYYFDDSRVTETVPE-------RSIAGS 1048

Query: 1506 NVYVLFYER 1514
              Y+LFY R
Sbjct: 1049 -AYLLFYMR 1056

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 1299 KKLRLEDCINFFTCDEVLSDQNAWDCPRC 1327
            KK+ L+DC+N F   EVL   ++W CP C
Sbjct: 907  KKITLDDCLNLFAKKEVLGMNDSWYCPTC 935

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
            YJL197W
          Length = 1231

 Score = 47.0 bits (110), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 87/223 (39%), Gaps = 72/223 (32%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE----MDTMSRSFYMLFRKM 1161
            GL N+ NTCY+NS LQCL      R+ F+ N +   +           M+RSF+ L + +
Sbjct: 322  GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNNPLGFQGHMARSFHGLIQSL 381

Query: 1162 YMNGGCSVVP---------------------SGFLK---------MCNTLKPDL-RI--- 1187
            +   G S+ P                     SGF +         + ++L  DL RI   
Sbjct: 382  F---GDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQQQDSQEFLAFLLDSLHEDLNRIVEK 438

Query: 1188 PYGQQDTQXXXXXXXXXXXXXXSSIESVSNDY--SHLLLHDNVRLYVDDAQYNKWFDQNI 1245
            PY ++ +                +I+ ++N+   SHL+ +D++                 
Sbjct: 439  PYVEKPS-----LKPGDDINDFDTIKKLANETWKSHLMRNDSI----------------- 476

Query: 1246 DQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALP 1288
                   I D+F G  ++ L C  C   S T+  +  L+L LP
Sbjct: 477  -------ITDIFVGMYKSTLECPECSNVSITFDPYNDLTLPLP 512

 Score = 37.0 bits (84), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 81/212 (38%), Gaps = 66/212 (31%)

Query: 1303 LEDCINFFTCDEVLSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLF 1362
            L+DC+N F+  EVL   ++W CP C           K  R+ +   E  N  +     L 
Sbjct: 895  LKDCLNLFSKKEVLGMSDSWYCPNC-----------KEHRQATKKIELWNTPDVFLIHLK 943

Query: 1363 KFGYKMRSRSEAPKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNI 1422
            +F     +RS         SDK+     AT      I  P          I DL     +
Sbjct: 944  RFE---NTRS--------FSDKID----AT------ILFP----------IEDLDMSEYL 972

Query: 1423 VVSYPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFD 1482
            V            +   + + L ++ NH+G +  GHYT+ V K L        Q WYYFD
Sbjct: 973  VYK---------DDPRGSVYDLIAVDNHYGGMGGGHYTAYV-KNLT------DQNWYYFD 1016

Query: 1483 DEIVKFDTNHGDYDNGIASVSSSNVYVLFYER 1514
            D  V   +          S++ S  Y+LFY R
Sbjct: 1017 DSRVSKTSPE-------KSIAGS-AYLLFYLR 1040

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 57/129 (44%), Gaps = 33/129 (25%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSIVNHFGTL 1454
            +P IL +HL RF Y   +++NI     + YPL L++     +S   K+ L  +V H G+ 
Sbjct: 546  LPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSG 605

Query: 1455 -ISGHYTSLVNKELNHEISHGKQKWYYFDDE---------IVKFDTNHGDYDNGIASVSS 1504
               GHY  +   E        K  W  +DDE         ++KF  + GD          
Sbjct: 606  PQHGHYVCICKNE--------KFGWLLYDDETVESIREETVLKFTGHPGD---------Q 648

Query: 1505 SNVYVLFYE 1513
            +  YVLFY+
Sbjct: 649  TTAYVLFYK 657

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFR 1130
            + G  N  NTCY NS+LQCL++ S FR
Sbjct: 125  VFGYENFGNTCYCNSVLQCLYNISEFR 151

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 48/108 (44%), Gaps = 15/108 (13%)

Query: 1386 SNGKPATVKSLNFITMPRILVIHLSRFIYDL---TKKNNIVVSYPLILNI--VLKNSEVA 1440
             N     +K L    +P +LV+ L RF + L   + K N +V +PL LN+       +V 
Sbjct: 342  CNTTQNAIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDVP 401

Query: 1441 K--FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
               F L  I+ H GT+  GHY +       H        W+ F+D +V
Sbjct: 402  DIIFELIGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMV 441

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 91/428 (21%), Positives = 149/428 (34%), Gaps = 123/428 (28%)

Query: 1088 SIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE- 1146
            SIPT+  ++       + GL NM +TCY++S+LQCL     F +L +   + +Y K  + 
Sbjct: 126  SIPTLTQAH------GLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNYCKIQDP 179

Query: 1147 MDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRI-----PYGQQDTQXXXXXX 1201
            M  MS +   +  + Y  G     P+  L   + L    R+      Y QQD        
Sbjct: 180  MKCMSCAIDNIISETY--GNKKTTPNEGLV--DILNCSWRVNKNLAGYTQQDAHEFLQFI 235

Query: 1202 XXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQM 1261
                      +  + NDY    +HD  +  ++   +    + N  +  L           
Sbjct: 236  ----------LNQMHNDYKLNEIHDTNKQEMNGTDFKTMVNGNSSKEHLH---------- 275

Query: 1262 ENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSD-QN 1320
                                 L   LP+ + + F K+            +C E  +  Q 
Sbjct: 276  ---------------------LCNCLPHTIFQGFLKS----------IISCSECKAQSQT 304

Query: 1321 AWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSK 1380
              D      P   +S D KGK  +    ES +       +L  F Y  +  +++   + +
Sbjct: 305  TID------PYMDLSLDVKGKSTLYECLESFH----RTERLHDFTYNCKKCNKSQDANRQ 354

Query: 1381 LSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTK---KNNIVVSYPLILNI----- 1432
            LS                + +  I+VI L RF + +T    K N  V +PL LN+     
Sbjct: 355  LS---------------ILKLAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCT 399

Query: 1433 --------------VLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKW 1478
                            K++    + L  IV H GT+  GHY +                W
Sbjct: 400  APTPDTDPTNLNEKTNKSTPDMIYELTGIVTHRGTVNEGHYITYTKT--------ADGVW 451

Query: 1479 YYFDDEIV 1486
            Y F+D +V
Sbjct: 452  YQFNDSVV 459

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1198

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 63/131 (48%), Gaps = 23/131 (17%)

Query: 1392 TVKSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYPLI-LN----IVLKNSEVAK-FR 1443
              K +     P IL IHL RF   +  + K + VV +P+  LN    +V +++E    + 
Sbjct: 935  ATKQIQLWNSPDILTIHLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYD 994

Query: 1444 LYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVS 1503
            L ++ NH+G L  GHYT+     ++        KWYYFDD  V    +  D +  ++  +
Sbjct: 995  LVAVDNHYGGLGGGHYTAFAKNPVD-------GKWYYFDDSRV----SETDPETSVSGAA 1043

Query: 1504 SSNVYVLFYER 1514
                Y+LFY R
Sbjct: 1044 ----YLLFYRR 1050

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 79/194 (40%), Gaps = 13/194 (6%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE----MDTMSRSFYMLFRK 1160
            TGL N+ N+CY+NS LQCL      ++ FL   Y   + +         ++++F  L + 
Sbjct: 334  TGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGYKGLVAQAFAALIKS 393

Query: 1161 MYMNGGCSVV---PSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSS-IESVS 1216
            ++     S     P  F  +    +  +   + QQD+Q              +  IE   
Sbjct: 394  LFDERSSSAFAFSPREFKSIIGQ-QNSMFAGFLQQDSQEFLAFLLDGLHEDLNRIIEKPF 452

Query: 1217 NDYSHLLLHDNV--RLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSS 1274
             +   L   ++V  R  +       W    +  +  S I DLF G  ++ L+C  C  +S
Sbjct: 453  VEKPELSPDEDVNNREVIHRLASKTWDKHKLRND--SVILDLFVGLYKSTLTCPVCDKTS 510

Query: 1275 YTYSTFYVLSLALP 1288
             T+  +  L+L LP
Sbjct: 511  VTFDPYSDLTLPLP 524

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 19/105 (18%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNI--------VLKNSEVAK 1441
            K + F + P IL + L RF YD      I ++    +P  +++        + +N E  K
Sbjct: 384  KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCK 443

Query: 1442 FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
            + L+ ++ H G + +GHY +++  +L       + +WY FDDE V
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDL-------QDQWYRFDDEKV 481

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 7/91 (7%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMYMN 1164
             G RN   TCY+NS+LQ  F T  FR L        Y    E ++ + S  +  ++ +  
Sbjct: 207  VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YQIPTENESPNDSVPLALQRAFYQ 259

Query: 1165 GGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQ 1195
               S +P   L++  +   D    + Q D Q
Sbjct: 260  LQVSDIPLDTLELTRSFGWDSAEAFTQHDVQ 290

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
            YFR010W
          Length = 493

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 43/95 (45%), Gaps = 13/95 (13%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMD-----TMSRSFYMLFRK 1160
            GL+NM NTCY+N+ LQ LF   + R+L L+   A      EM       M R F  L  K
Sbjct: 108  GLQNMGNTCYMNATLQALFRVDSIRDLILNYDPAKASPQDEMHHKIVLEMKRCFENLENK 167

Query: 1161 MYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQ 1195
             Y     SV+P   L +     P     + ++D Q
Sbjct: 168  SYK----SVMPLMLLNVLRKCYPQ----FAERDAQ 194

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 60/127 (47%), Gaps = 28/127 (22%)

Query: 1388 GKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNI-------VLKN 1436
            G     K + F + P++L + L RF YD      I ++    +P  +++       VLKN
Sbjct: 380  GLQDAYKGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKN 439

Query: 1437 ---SEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV------- 1486
               +E   ++L+ ++ H G + +GHY +++  +L      G Q WY FDDE V       
Sbjct: 440  ENETESHIYKLHGVLVHTGDISTGHYYTMIKPDL------GDQ-WYRFDDERVWKVDRKQ 492

Query: 1487 KFDTNHG 1493
             FD N G
Sbjct: 493  VFDENFG 499

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNL 1132
             G RN   TCY+NS+LQ  F T  FR L
Sbjct: 209  VGFRNQGATCYLNSLLQSYFFTKYFRKL 236

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512 bp,
            503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (68%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNK 1137
            GL+N+ NTCY+N+ LQCLF     R + L+ K
Sbjct: 110  GLKNLGNTCYLNATLQCLFRIEPLREMILNYK 141

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
            YPL072W
          Length = 471

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 68/162 (41%), Gaps = 39/162 (24%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTK--KNNIVVSYPLILNIVLKN-----SEVAK 1441
            K A ++       P IL +HLSR +++     +N   V YP  L ++ ++     +E   
Sbjct: 315  KTAIIRRTAISNAPSILSLHLSRSMFNGASFTRNPCRVEYPETLIVLQRDVENGTAERIT 374

Query: 1442 FRLYSIVNHFGTLISGHYTSLVNK-ELNHEISHG-------------------------K 1475
            +RL S++ H GT  SGHY    +K +L   +  G                          
Sbjct: 375  YRLRSMIKHTGTHYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKSV 434

Query: 1476 QKW-YYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYERIF 1516
            ++W Y+F  + V  ++N G          S  VY+LFYER+ 
Sbjct: 435  RRWPYWFISDAVVRESNAGKMLR-----ESKYVYMLFYERVL 471

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
            (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
            114] FULL
          Length = 1160

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 59/129 (45%), Gaps = 23/129 (17%)

Query: 1394 KSLNFITMPRILVIHLSRF--IYDLTKKNNIVVSYPLI-----LNIVLKN-SEVAKFRLY 1445
            K +     P IL IHL RF   +  + K + VV +P+       ++V  + ++ + + L 
Sbjct: 906  KQIQLWNTPDILTIHLKRFENRHSFSDKISDVVDFPITGLDMSEHLVCHDPNQNSMYDLI 965

Query: 1446 SIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSS 1505
            ++ NH+G L  GHYT+ V   ++        KWYYFDD  V         +       S 
Sbjct: 966  AVDNHYGGLGGGHYTAYVKNFMD-------GKWYYFDDSRVS--------ETEAERAISG 1010

Query: 1506 NVYVLFYER 1514
              Y+LFY R
Sbjct: 1011 AAYLLFYRR 1019

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 79/203 (38%), Gaps = 27/203 (13%)

Query: 1103 SITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE----MDTMSRSFYMLF 1158
             I GL N+ N+CY+NS LQCL      R+ FL   +   + +         ++++F  L 
Sbjct: 296  GIVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPLGYQGQIAQAFAALV 355

Query: 1159 RKMYMNGGCSV---VPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIE-- 1213
            + ++ +   ++    P  F  +       +   + QQD+Q              + I   
Sbjct: 356  KSLFDDKASALQAFSPRAFKSIIGH-HNGMFAGFLQQDSQELLAFLLDGLHEDLNRIMKK 414

Query: 1214 --------SVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQL 1265
                    + S+D + + +  N+           W    +     S I DLF G  ++ L
Sbjct: 415  PFVEKPELASSDDVNDIDVIRNLASLT-------WEKHKLRNE--SVIVDLFVGLYKSTL 465

Query: 1266 SCQRCGYSSYTYSTFYVLSLALP 1288
            +C  C   S T+  F  L+L LP
Sbjct: 466  TCPACDRVSVTFDPFSDLTLPLP 488

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLS--NKYAHYLKSPE 1146
            TGL N+ NTCY+NS+LQ  FS S+ R   L   N   H+L + E
Sbjct: 733  TGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQE 776

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
            (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE------MDTMSRSFYMLFR 1159
            GL NM NTCY+NS LQ L+     R++ L  K    ++  +      +  + R F  L +
Sbjct: 110  GLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQANVQPGDELHYKLISELKRCFENLQK 169

Query: 1160 KMYMNGGCSVVPSGFLKMCNTLKPDL 1185
            K Y     SV+P  FL +     P  
Sbjct: 170  KSYE----SVMPVVFLNLLRKCYPQF 191

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 54/131 (41%), Gaps = 23/131 (17%)

Query: 1396 LNFITMPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSIVN 1449
            L    +P+ L IHL RF Y      N+     + YP+ L +      S    + L  +V 
Sbjct: 522  LGLKELPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVV 581

Query: 1450 HFGTLIS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSN-- 1506
            H G     GHY S+          +G   W  FDDE V+  +     D  ++ V  SN  
Sbjct: 582  HIGIGPQHGHYISVCKTS-----DYG---WLLFDDETVECISE----DTVLSFVGDSNSA 629

Query: 1507 --VYVLFYERI 1515
               YVLFY+ I
Sbjct: 630  GTAYVLFYKEI 640

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 1085 PHFSIPTIENSYNEYVAL-SITGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            P FS    EN+ +  + +  + GL N  NTCY NS+LQCL++ + FR   L 
Sbjct: 110  PVFSPTNEENNLDIDIDIHKVYGLENFGNTCYCNSILQCLYNMNEFRENILG 161

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 52/112 (46%), Gaps = 9/112 (8%)

Query: 1216 SNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSY 1275
            ++++ + LL+D V  Y+D A   K  D     N  + ++D+F+G + NQ+ C  C   + 
Sbjct: 410  AHEFLNFLLND-VSDYLDKANTEKNPDNTRSGNETNFVNDIFKGTITNQIRCLTCDTVTS 468

Query: 1276 TYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRC 1327
             Y +F      L  P+     +T  + ++  +  +   E+L   N + C  C
Sbjct: 469  RYESF------LDFPIEVIGDET--IDIQKMMISYHQKEMLQGSNKFYCGTC 512

>Kpol_378.4 s378 (18665..20344) [1680 bp, 559 aa] {ON}
           (18665..20344) [1680 nt, 560 aa]
          Length = 559

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 123/227 (54%), Gaps = 46/227 (20%)

Query: 569 STNENSVSQSHLSTTPDAKSVSQSNLS----TTPDAKSVSQSNLS----TTPDAKSVSQS 620
           +T E+S ++    +TPD ++ ++ + +    +TPD ++ ++ + +    +TPD ++ ++ 
Sbjct: 318 ATEEDSTAEE--DSTPDDETATEEDSTVEEDSTPDDETATEEDSTAEEDSTPDDETATEE 375

Query: 621 NLS----TTPD----AKSVSQSNLSTTPDAKSVSQSNLS----TTPDAKSVSQSN----L 664
           + +    +TPD    A+  S +   +TPD ++ ++ + +    +TPD ++ ++ +     
Sbjct: 376 DSTAEEDSTPDDDLAAEEDSTAEEDSTPDDETATEEDSTAEEDSTPDDETATEEDSITEE 435

Query: 665 STTPD----AKSVSQSNLSTTPDAKSVSQSNLS----TTPDAKSVSQSNLS----TTPD- 711
            +TPD    A+  S +   +TPD ++ ++ + +    +TPD ++ ++ + +    +TPD 
Sbjct: 436 DSTPDDDLAAEEDSTAEEDSTPDDETATEEDSTAEEDSTPDDETATEEDSTAEEDSTPDD 495

Query: 712 ---AKSVSQSHLSSTPDAKSVSQSNLSATPESNLSATPDANSASQSN 755
              A+  S +   STPD ++ ++ +  +TPE +  +TPD  +A++ +
Sbjct: 496 DLAAEEDSTAEEDSTPDDETATEED--STPEED--STPDDETATEED 538

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 123/231 (53%), Gaps = 44/231 (19%)

Query: 569 STNENSVSQSHLSTTPDAKSVSQSNLSTTPD--AKSVSQSNLSTTPDAKSVSQSNLS--- 623
           +T E+S ++    +TPD ++ ++ + +   D  A+  S +   +TPD ++ ++ + +   
Sbjct: 270 ATEEDSTAEE--DSTPDDETATEEDSTAEEDSTAEEDSTAEEDSTPDDETATEEDSTAEE 327

Query: 624 -TTPDAKSVSQSNLS----TTPDAKSVSQSNLS----TTPDAKSVSQSNLS----TTPD- 669
            +TPD ++ ++ + +    +TPD ++ ++ + +    +TPD ++ ++ + +    +TPD 
Sbjct: 328 DSTPDDETATEEDSTVEEDSTPDDETATEEDSTAEEDSTPDDETATEEDSTAEEDSTPDD 387

Query: 670 ---AKSVSQSNLSTTPDAKSVSQSNLS----TTPDAKSVSQSN----LSTTPD----AKS 714
              A+  S +   +TPD ++ ++ + +    +TPD ++ ++ +      +TPD    A+ 
Sbjct: 388 DLAAEEDSTAEEDSTPDDETATEEDSTAEEDSTPDDETATEEDSITEEDSTPDDDLAAEE 447

Query: 715 VSQSHLSSTPDAKSVSQSNLSATPESNLSATPDANSASQSNLS----NTPD 761
            S +   STPD ++ ++ + +A  +S    TPD  +A++ + +    +TPD
Sbjct: 448 DSTAEEDSTPDDETATEEDSTAEEDS----TPDDETATEEDSTAEEDSTPD 494

 Score = 37.0 bits (84), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 118/231 (51%), Gaps = 44/231 (19%)

Query: 569 STNENSVSQSHLSTTPD----AKSVSQSNLSTTPD----AKSVSQSNLSTTPD----AKS 616
           +T E+S+++    +TPD    A+  S +   +TPD     +  S +   +TPD     + 
Sbjct: 216 ATEEDSITEE--DSTPDDDLAAEEDSTAEEDSTPDDEIATEDDSTAEEDSTPDDDLATEE 273

Query: 617 VSQSNLSTTPDAKSVSQSNLSTTPD--AKSVSQSNLSTTPDAKSVSQSNLS----TTPDA 670
            S +   +TPD ++ ++ + +   D  A+  S +   +TPD ++ ++ + +    +TPD 
Sbjct: 274 DSTAEEDSTPDDETATEEDSTAEEDSTAEEDSTAEEDSTPDDETATEEDSTAEEDSTPDD 333

Query: 671 KSVSQSNLS----TTPDAKSVSQSNLS----TTPDAKSVSQSNLS----TTPD----AKS 714
           ++ ++ + +    +TPD ++ ++ + +    +TPD ++ ++ + +    +TPD    A+ 
Sbjct: 334 ETATEEDSTVEEDSTPDDETATEEDSTAEEDSTPDDETATEEDSTAEEDSTPDDDLAAEE 393

Query: 715 VSQSHLSSTPDAKSVSQSNLSATPESNLSATPDANSASQSN----LSNTPD 761
            S +   STPD ++ ++ + +A  +S    TPD  +A++ +      +TPD
Sbjct: 394 DSTAEEDSTPDDETATEEDSTAEEDS----TPDDETATEEDSITEEDSTPD 440

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 49/233 (21%), Positives = 122/233 (52%), Gaps = 48/233 (20%)

Query: 569 STNENSVSQSHLSTTPDAKSVSQSNLSTTPDAKSVSQSNLS----TTPDAKSVSQSNLS- 623
           +T E+S ++   +    A+  S +   +TPD ++ ++ + +    +TPD ++ ++ + + 
Sbjct: 288 ATEEDSTAEEDST----AEEDSTAEEDSTPDDETATEEDSTAEEDSTPDDETATEEDSTV 343

Query: 624 ---TTPDAKSVSQSNLS----TTPDAKSVSQSNLS----TTPD----AKSVSQSNLSTTP 668
              +TPD ++ ++ + +    +TPD ++ ++ + +    +TPD    A+  S +   +TP
Sbjct: 344 EEDSTPDDETATEEDSTAEEDSTPDDETATEEDSTAEEDSTPDDDLAAEEDSTAEEDSTP 403

Query: 669 DAKSVSQSNLS----TTPDAKSVSQSN----LSTTPD----AKSVSQSNLSTTPDAKSVS 716
           D ++ ++ + +    +TPD ++ ++ +      +TPD    A+  S +   +TPD ++ +
Sbjct: 404 DDETATEEDSTAEEDSTPDDETATEEDSITEEDSTPDDDLAAEEDSTAEEDSTPDDETAT 463

Query: 717 Q----SHLSSTPDAKSVSQSNLSATPESNLSATPDANSASQSNLS----NTPD 761
           +    +   STPD ++ ++ + +A  +S    TPD + A++ + +    +TPD
Sbjct: 464 EEDSTAEEDSTPDDETATEEDSTAEEDS----TPDDDLAAEEDSTAEEDSTPD 512

 Score = 35.8 bits (81), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 118/233 (50%), Gaps = 48/233 (20%)

Query: 569 STNENSVSQSHLSTTPDAKSVSQSN----LSTTPD----AKSVSQSNLSTTPDAKSVSQS 620
           +T E+S ++    +TPD ++ ++ +      +TPD    A+  S +   +TPD +  ++ 
Sbjct: 198 ATEEDSTAEE--DSTPDDETATEEDSITEEDSTPDDDLAAEEDSTAEEDSTPDDEIATED 255

Query: 621 NLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPD--AKSVSQSNL 678
           +  +T +  S    +L+T  D+ +   S    TPD ++ ++ + +   D  A+  S +  
Sbjct: 256 D--STAEEDSTPDDDLATEEDSTAEEDS----TPDDETATEEDSTAEEDSTAEEDSTAEE 309

Query: 679 STTPDAKSVSQSNLS----TTPDAKSVSQSNLS----TTPDAKSVSQ----SHLSSTPDA 726
            +TPD ++ ++ + +    +TPD ++ ++ + +    +TPD ++ ++    +   STPD 
Sbjct: 310 DSTPDDETATEEDSTAEEDSTPDDETATEEDSTVEEDSTPDDETATEEDSTAEEDSTPDD 369

Query: 727 KSVSQSNLSA----TPESNLSA----------TPDANSASQSNLS----NTPD 761
           ++ ++ + +A    TP+ +L+A          TPD  +A++ + +    +TPD
Sbjct: 370 ETATEEDSTAEEDSTPDDDLAAEEDSTAEEDSTPDDETATEEDSTAEEDSTPD 422

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 115/231 (49%), Gaps = 44/231 (19%)

Query: 569 STNENSVSQSHLSTTPD----AKSVSQSNLSTTPDAKSVSQSNLS----TTPDAKSVSQS 620
           +T E+S ++    +TPD    A+  S +   +TPD ++ ++ + +    +TPD ++ ++ 
Sbjct: 162 ATEEDSTAEE--DSTPDDDLAAEEDSTAEEDSTPDDETATEEDSTAEEDSTPDDETATEE 219

Query: 621 N----LSTTPD----AKSVSQSNLSTTPD----AKSVSQSNLSTTPD----AKSVSQSNL 664
           +      +TPD    A+  S +   +TPD     +  S +   +TPD     +  S +  
Sbjct: 220 DSITEEDSTPDDDLAAEEDSTAEEDSTPDDEIATEDDSTAEEDSTPDDDLATEEDSTAEE 279

Query: 665 STTPDAKSVSQSNLSTTPD--AKSVSQSNLSTTPDAKSVSQSNLS----TTPDAKSVSQS 718
            +TPD ++ ++ + +   D  A+  S +   +TPD ++ ++ + +    +TPD ++ ++ 
Sbjct: 280 DSTPDDETATEEDSTAEEDSTAEEDSTAEEDSTPDDETATEEDSTAEEDSTPDDETATEE 339

Query: 719 ----HLSSTPDAKSVSQSNLSATPESNLSATPDANSASQSNLS----NTPD 761
                  STPD ++ ++ + +A  +S    TPD  +A++ + +    +TPD
Sbjct: 340 DSTVEEDSTPDDETATEEDSTAEEDS----TPDDETATEEDSTAEEDSTPD 386

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 53/120 (44%), Gaps = 27/120 (22%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNI---------VLKNSEVA 1440
            K + F + P +L + L RF YD      I ++    +P  +++          L N E  
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEAC 439

Query: 1441 KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV-------KFDTNHG 1493
             + L+ ++ H G + +GHY +++   ++ E       WY FDD+ V        FD N G
Sbjct: 440  IYNLHGVLVHAGDISTGHYYTMIRPGVSDE-------WYRFDDDKVWRVTKKQAFDENFG 492

 Score = 37.7 bits (86), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 7/91 (7%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMYMN 1164
             G +N   TCY+NS+LQ  F T  FR L        Y    +MD+ + S  +  ++ +  
Sbjct: 203  VGFKNQGATCYLNSLLQSYFFTKYFRRLV-------YEIPTDMDSPNNSVPLALQRAFYQ 255

Query: 1165 GGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQ 1195
               S  P   L++  +   D    + Q D Q
Sbjct: 256  LQVSNEPLDTLELTRSFGWDNGDAFTQHDVQ 286

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
            similar to uniprot|P43593 Saccharomyces cerevisiae
            YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 46/107 (42%), Gaps = 24/107 (22%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFL-----------SNKYAHYLKSPEMDTMSRSF 1154
            GL+NM NTCY+N+ LQ LF     ++L L           +N   HY    E   + R+F
Sbjct: 110  GLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVLE---LKRTF 166

Query: 1155 YMLFRKMYMNGGCSVVPSGFLKMCNTLKPDL--RIP----YGQQDTQ 1195
              L ++ +     SV+P   L       P    R P    Y QQD +
Sbjct: 167  ETLKKRSFK----SVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAE 209

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
            (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 54/127 (42%), Gaps = 25/127 (19%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSIVNHFGTL 1454
            +P+IL +HL RF Y      NI     ++YP  L++      S   K+ L  I+ H G  
Sbjct: 549  LPKILSLHLKRFKYSEENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLGAG 608

Query: 1455 -ISGHYTSLVNKELNHEISHGKQKWYYFDDEIV-----KFDTNHGDYDNGIASVSSSNVY 1508
               GHY ++   E        K  W  +DDE V     K    H    N +A+      Y
Sbjct: 609  PQHGHYVAMCKTE--------KFGWLLYDDETVEAVLEKDVLRHVGDSNDLAT-----AY 655

Query: 1509 VLFYERI 1515
            +LFY+ I
Sbjct: 656  ILFYKTI 662

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFR-NLFL 1134
            + G  N  NTCY NS+LQCL++ S  R NL L
Sbjct: 126  VFGFENFGNTCYCNSVLQCLYNFSELRDNLIL 157

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 10/87 (11%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLT--KKNNIVVSYP--LILN-IVLKNSEVA--- 1440
            K   VK    +  PR+L++HLSR +++     KN   V++P  L++N  +L+N++     
Sbjct: 375  KSTIVKRTVSVDSPRVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVR 434

Query: 1441 --KFRLYSIVNHFGTLISGHYTSLVNK 1465
              +++L +++ H GT   GHY    +K
Sbjct: 435  AVRYKLCAMIKHIGTHSQGHYACFRHK 461

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 20/32 (62%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            I G  N  NTCY NS+LQC F+ S FR   LS
Sbjct: 126  IFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 52/125 (41%), Gaps = 23/125 (18%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSIVNHFGTL 1454
            +P+ L +HL RF Y   K  NI     + YP  L +     +    ++ L S V H G  
Sbjct: 512  LPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLSKRYELASAVIHLGDG 571

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSN---VYVL 1510
               GHY SL   E     + G   W  FDDE V+        +  + S +  N    YVL
Sbjct: 572  PQYGHYISLCKTE-----TFG---WLLFDDETVE-----AVDEQTVLSFTGENSDTAYVL 618

Query: 1511 FYERI 1515
            FY  +
Sbjct: 619  FYNEV 623

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 25/118 (21%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNI--VLKNSEVAK-----F 1442
            K + F + P +L + L RF YD      I V+    +P  +++   L++S+  K     +
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 1443 RLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV-------KFDTNHG 1493
             L+ ++ H G + +GHY +L+   L       + +WY FDDE V        F+ N+G
Sbjct: 440  NLHGVLVHAGDISTGHYYTLIKPGL-------EDQWYRFDDERVWKVTKNQVFEENYG 490

 Score = 37.4 bits (85), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNL 1132
             G RN   TCY+NS+LQ  F T  FR L
Sbjct: 203  VGFRNQGATCYLNSLLQSYFFTKYFRRL 230

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 63/148 (42%), Gaps = 42/148 (28%)

Query: 1386 SNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIV---VSYPLILNIVL-------- 1434
             N     +K L    +P +LV+ L RF + L   N  +   + +P  LN+          
Sbjct: 339  CNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKD 398

Query: 1435 KNSEVAK-----FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFD 1489
            K+SE  K     + L  IV+H GT+  GHY +        +IS G  +W+ F+D +V   
Sbjct: 399  KHSENGKVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGG--QWFKFNDSMV--- 447

Query: 1490 TNHGDYDNGIASVSSSNV-----YVLFY 1512
                      +S+S   V     Y+LFY
Sbjct: 448  ----------SSISQEEVLKEQAYLLFY 465

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRS 1153
            + G  N  NTCY NS+LQCL++ + FR L L     H  + P++    +S
Sbjct: 123  VFGYENFGNTCYCNSVLQCLYNLTEFRLLLLQ----HLERDPKIKRKRKS 168

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 53/131 (40%), Gaps = 33/131 (25%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILN--IVLKNSEVAKFRLYSIVNHFGTL 1454
            +P  L +HL RF Y   +  NI     + YPL L+      +S   K+ L  IV H G  
Sbjct: 568  LPHTLALHLKRFKYSEEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGIVVHMGGG 627

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDEIV---------KFDTNHGDYDNGIASVSS 1504
               GHY SL   +           W  FDDE V         KF    GD D      S 
Sbjct: 628  PQHGHYVSLCKND--------NFGWLLFDDETVEAVHESTVSKFI---GDRD------SL 670

Query: 1505 SNVYVLFYERI 1515
            +  YVLFY+ I
Sbjct: 671  TTAYVLFYKEI 681

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 54/251 (21%), Positives = 98/251 (39%), Gaps = 30/251 (11%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDT---MSRSFYMLFRKM 1161
             G RN   TCY+NS+LQ  F T  FR+L      A   ++P       + R+FY L    
Sbjct: 259  VGFRNQGATCYLNSLLQSYFFTKYFRDLVYQIPTAD--ENPNDSVALALQRAFYQL---- 312

Query: 1162 YMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQX--XXXXXXXXXXXXXSSIESVSNDY 1219
                  S  P   L++  +   D    + Q D Q                +S+E    D 
Sbjct: 313  ----QVSNYPLDTLELTRSFGWDTAEAFTQHDVQELNRILMDRLESRMKGTSVEGKLTD- 367

Query: 1220 SHLLLHDNVRLYV-------DDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGY 1272
               +    ++ Y+       + ++   ++D  ++  GL  + + F+  +E +L      Y
Sbjct: 368  ---VFVGKMKSYIKCVNIDYESSRVEDFWDIQLNVKGLEGLANAFENYIEVELMDGENQY 424

Query: 1273 SSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCSPSD 1332
            ++  Y     L  A    V ++F +   L+L+     F  D+++   + ++ P     S 
Sbjct: 425  AAQDYG----LQDAKKGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSP 480

Query: 1333 YMSYDHKGKRK 1343
            YM  +   K+K
Sbjct: 481  YMDKEVLKKQK 491

 Score = 40.4 bits (93), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 52/119 (43%), Gaps = 26/119 (21%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTK----KNNIVVSYPLILNIV-LKNSEVAK------- 1441
            K + F + P +L + L RF YD       K N    +P  +++    + EV K       
Sbjct: 436  KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNN 495

Query: 1442 FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV-------KFDTNHG 1493
            + L+ ++ H G + +GHY +++    +        KWY FDDE V        FD N G
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTD-------DKWYRFDDEKVWRVTKKQVFDENFG 547

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
            {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 9/94 (9%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMY--M 1163
            G +NM NTCY+NS LQ LF     +++ L+ K      SPE D +     +  +K +  +
Sbjct: 110  GFQNMGNTCYMNSTLQALFRVDVLKDMILNYKTEGNNISPE-DELHHKIVIELKKCFETL 168

Query: 1164 NGG--CSVVPSGFLKMCNTLKPDLRIPYGQQDTQ 1195
            +G    +V+P   L +     P     + ++D+Q
Sbjct: 169  DGKKFKAVMPVVLLSVLRKCYP----QFAERDSQ 198

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
            Anc_1.369 YFR010W
          Length = 499

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 40/100 (40%), Gaps = 10/100 (10%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYM----LFRKM 1161
            G +NM NTCY+N+ LQ LF     R L L+     +      D M     +     F  +
Sbjct: 109  GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAFTNLNPQDEMHHKLILELKHCFESL 168

Query: 1162 YMNGGCSVVPSGFLKMCNTLKPDL--RIP----YGQQDTQ 1195
                  SV+P   + +   + P    R P    Y QQD +
Sbjct: 169  KQKNYQSVLPIVLINVLRKVYPQFAERDPQAGFYKQQDAE 208

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 41.6 bits (96), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 39/94 (41%), Gaps = 13/94 (13%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDT---MSRSFYMLFRKM 1161
             G RN   TCY+NS+LQ  F T  FR L       H  +SP       + R+FY L    
Sbjct: 205  VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEH--ESPNNSVPLALQRAFYQL---- 258

Query: 1162 YMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQ 1195
                  S +P   L++  +   D    + Q D Q
Sbjct: 259  ----QVSDIPLDTLELTRSFGWDTAESFTQHDVQ 288

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 52/112 (46%), Gaps = 26/112 (23%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNI-------VLKNSEVAK- 1441
            K + F + P +L + L RF YD      + V+    +P  +++       VLK +  ++ 
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 1442 -------FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
                   + L+ ++ H G + +GHY +L+   +       + +WY FDDE V
Sbjct: 442  KDKNPYVYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERV 486

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 64/137 (46%), Gaps = 26/137 (18%)

Query: 1386 SNGKPATVKSLNFITMPRILVIHLSRFIYDL---TKKNNIVVSYPLILNI--VLKNSEVA 1440
             N K   ++ L    +P +LV+ L RF + +   + K N  + +P  L++    +  +V 
Sbjct: 328  CNTKQNAIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVG 387

Query: 1441 K-----FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDY 1495
            +     + L  +++H G++  GHYTS+       +I  G  +W+ F+D +V   T   + 
Sbjct: 388  ETPAIVYELIGLISHQGSVNQGHYTSIC------KIPGG--QWFKFNDSMV---TAVAEI 436

Query: 1496 DNGIASVSSSNVYVLFY 1512
            D     V     Y+LFY
Sbjct: 437  D-----VLKEQAYLLFY 448

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
            Ashbya gossypii AEL029W
          Length = 483

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 1093 ENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDT--- 1149
            +N   ++++    G+ N+ NTCY+N+ LQ LF     R   L       +K   +DT   
Sbjct: 90   KNEQGQHLSKMPMGIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIKEG-VDTYHA 148

Query: 1150 -MSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKP 1183
             + R   + F+K+    G ++ P   L++   + P
Sbjct: 149  QLVRELKVTFQKLKDRKGENITPLLLLEILRRVFP 183

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 26/125 (20%)

Query: 1388 GKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNI-------VLKN 1436
            G     K + F + P +L + L RF YD      I V+    +P  +++       +LK 
Sbjct: 375  GLQDAYKGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKK 434

Query: 1437 SEVAK-FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV-------KF 1488
            +   K ++L+ ++ H G + +GHY +++   L       + +WY FDDE V        F
Sbjct: 435  TPGPKNYKLHGVLVHTGDISTGHYYAMIKPTL-------EDQWYRFDDEKVWKVDKKQVF 487

Query: 1489 DTNHG 1493
            D N G
Sbjct: 488  DENFG 492

 Score = 37.7 bits (86), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNL 1132
             G RN   TCY+NS+LQ  F T  FR L
Sbjct: 204  VGFRNQGATCYLNSLLQSYFFTKYFRKL 231

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 39/94 (41%), Gaps = 13/94 (13%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDT---MSRSFYMLFRKM 1161
             G RN   TCY+NS+LQ  F T  FR L       H  +SP       + R+FY L    
Sbjct: 205  VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEH--ESPNNSVPLALQRAFYQL---- 258

Query: 1162 YMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQ 1195
                  S +P   L++  +   D    + Q D Q
Sbjct: 259  ----QVSDIPLDTLELTRSFGWDTAESFTQHDVQ 288

 Score = 37.7 bits (86), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 25/111 (22%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNI-------VLK------- 1435
            K + F + P +L + L RF YD      I V+    +P  +++       VLK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 1436 NSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
            N     + L+ ++ H G + +GHY +L+   +       + +WY FDDE V
Sbjct: 442  NGNPYIYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERV 485

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 101/263 (38%), Gaps = 79/263 (30%)

Query: 1281 YVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRC-------CSPSDY 1333
            YVLSL  P  V +A  K       DCI     +  L  +++  CP C         P   
Sbjct: 253  YVLSLPNPKEVDRANNKRC-----DCIVHTVFEGSL--ESSIVCPGCQNNSKTTIDPFMD 305

Query: 1334 MSYDHKGKRKISTSFESLNGGNSSRSKLFK-FGYKMRSRSEAPKFSSKLSDKVSNGKPAT 1392
            +S D K K+K+    +S +     + +L K F Y                    N     
Sbjct: 306  LSLDIKDKQKLYECLDSFH-----KKELLKDFNYHCGE---------------CNSTQDA 345

Query: 1393 VKSLNFITMPRILVIHLSRFIYDLTKKNNIV---VSYPLILNIV-------------LKN 1436
            +K L    +P +LV+ L RF + L   N  +   + +P  LN+              + N
Sbjct: 346  IKQLGIHRLPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESENHIGN 405

Query: 1437 SEVAK--FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGD 1494
             +V    + L  IV+H GT+  GHY +        +IS G  +W+ F+D +V        
Sbjct: 406  GKVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGG--QWFKFNDSMV-------- 449

Query: 1495 YDNGIASVSSSNV-----YVLFY 1512
                 +S+S   V     Y+LFY
Sbjct: 450  -----SSISQEEVLKEQAYLLFY 467

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1225

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (71%), Gaps = 1/32 (3%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSN 1136
            TG+ N+ NTCY+NS+LQ  FS + FR  F+ N
Sbjct: 758  TGINNIGNTCYLNSLLQYYFSITLFRE-FIEN 788

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] {ON}
            highly similar to uniprot|P43593 Saccharomyces cerevisiae
            YFR010W UBP6 Ubiquitin-specific protease situated in the
            base subcomplex of the 26S proteasome releases free
            ubiquitin from branched polyubiquitin chains deletion
            causes hypersensitivity to cycloheximide and other toxic
            compounds
          Length = 500

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            G +NM NTCY+NS LQ L+     R L LS
Sbjct: 109  GFQNMGNTCYLNSTLQALYRIKPLRELILS 138

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 75/179 (41%), Gaps = 44/179 (24%)

Query: 1324 CPRCCSPSDYM-------SYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPK 1376
            CP C   S  M       S D KG+R +    +S +     R +L  F Y        P+
Sbjct: 282  CPECQDDSKTMLDPFLDLSLDIKGQRTLYDCLDSFH----RREQLHDFDY------HCPR 331

Query: 1377 FSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKN 1436
              +       +  P  +K L    +   LV+ L RF + LT   N+ ++ P+   + L  
Sbjct: 332  CQT-------SRDP--IKQLTIERLAPTLVLQLKRFEH-LTSGQNVKLNDPVQFPLHLDM 381

Query: 1437 SEVAK---------FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
            S             +RL  +V+H GT+  GHYT+++  +LN        +W+ F+D ++
Sbjct: 382  SRYCTGGEPTTSIVYRLSGVVSHSGTVNEGHYTAVL--QLN------SGEWFKFNDSMI 432

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 754

 Score = 40.8 bits (94), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (47%), Gaps = 19/124 (15%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNIV--LKNSEVAKFRLYSI-VNHFGT 1453
            +P IL +HL RF Y  T+  NI     + YPL L +     +S   ++ L  I V+  G 
Sbjct: 558  LPHILALHLKRFKYSETQNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGIVVHMGGG 617

Query: 1454 LISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKF--DTNHGDYDNGIASVSSSNVYVLF 1511
               GHY SL   E        K  W  FDDE V+   +++   +   +  ++++  YVLF
Sbjct: 618  PHHGHYVSLCKNE--------KFGWLLFDDETVESVDESSVMKFCGDLHDLTTA--YVLF 667

Query: 1512 YERI 1515
            Y+ I
Sbjct: 668  YKEI 671

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFR 1130
            + G  N  NTCY NS+LQCL++ + FR
Sbjct: 145  VFGYENFGNTCYCNSVLQCLYNLTEFR 171

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 53/104 (50%), Gaps = 18/104 (17%)

Query: 1393 VKSLNFITMPRILVIHLSRFIYDL---TKKNNIVVSYPLILNIV--LKNSEV-----AKF 1442
            +K +    +P +LV+ L RF + +   + K N  ++YP  LN+      SE        +
Sbjct: 335  IKQMTIAKLPPVLVLQLKRFEHLMNGNSVKLNEKIAYPTYLNMAPFCHQSESRPVPDMMY 394

Query: 1443 RLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
             L ++++H G++  GHYTS+       +I  G  +W+ F+D ++
Sbjct: 395  ELVAVISHEGSVNQGHYTSMC------KIPGG--QWFRFNDSMI 430

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 56/143 (39%), Gaps = 32/143 (22%)

Query: 1386 SNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIV---VSYPLILNI--VLKNSEVA 1440
             N     +K L    +P +LV+ L RF + L   N  +   + +P  LN+       E  
Sbjct: 339  CNSTQDAIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESE 398

Query: 1441 K-----------FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFD 1489
            K           + L  IV+H GT+  GHY +        +IS G  +W+ F+D +V   
Sbjct: 399  KHTGNGKVPDIIYELIGIVSHRGTVNEGHYIAFC------KISGG--QWFKFNDSVVTSI 450

Query: 1490 TNHGDYDNGIASVSSSNVYVLFY 1512
                        V     Y+LFY
Sbjct: 451  AQ--------GEVLKEQAYLLFY 465

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 39/94 (41%), Gaps = 13/94 (13%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDT---MSRSFYMLFRKM 1161
             G RN   TCY+NS+LQ  F T  FR L       H  +SP       + R+FY L    
Sbjct: 205  VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEH--ESPNNSVPLALQRAFYQL---- 258

Query: 1162 YMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQ 1195
                  S +P   +++  +   D    + Q D Q
Sbjct: 259  ----QVSDIPLDTMELTRSFGWDTAESFTQHDVQ 288

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 26/112 (23%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNI-------VL-------- 1434
            K + F + P +L + L RF YD      + V+    +P  +++       VL        
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGD 441

Query: 1435 KNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
            K+     + L+ ++ H G + +GHY +L+   +       + +WY FDDE V
Sbjct: 442  KDKNPYIYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERV 486

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
           family member that functions as an osmosensor in the
           Sho1p-mediated HOG pathway with Msb2p; proposed to be a
           negative regulator of filamentous growth; mutant
           displays defects in beta-1,3 glucan synthesis and bud
           site selection
          Length = 1802

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 88/189 (46%), Gaps = 6/189 (3%)

Query: 578 SHLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLS 637
           S  +++P A +   S  +++P A     S  +++P A +   S  +++P A     S  +
Sbjct: 488 STYTSSPSAPAAISSTYTSSPSAPVAVSSTYTSSPSAPAAISSTYTSSPSAPVAVSSTYT 547

Query: 638 TTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPD 697
           ++P A +   S  +++P A     S  +++P A     S  +++P       S  +++P 
Sbjct: 548 SSPSAPAAISSTYTSSPSAPVAVSSTYTSSPSAPVAISSTYTSSPSVPVAVSSTYTSSPS 607

Query: 698 AKSVSQSNLSTTPDAKSVSQSHLSSTPDAKSVSQSNLSATP------ESNLSATPDANSA 751
           A +   S  +++P A     S  +S+P A +   S  +++P       S  +++P A +A
Sbjct: 608 APAAISSTYTSSPSAPVAVSSTYTSSPSAPAAISSTYTSSPSVPVAVSSTYTSSPSAPAA 667

Query: 752 SQSNLSNTP 760
             S  +++P
Sbjct: 668 ISSTYTSSP 676

 Score = 38.5 bits (88), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 87/191 (45%), Gaps = 6/191 (3%)

Query: 578 SHLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLS 637
           S  +++P A +   S  +++P A     S  +++P A     S  +++P       S  +
Sbjct: 544 STYTSSPSAPAAISSTYTSSPSAPVAVSSTYTSSPSAPVAISSTYTSSPSVPVAVSSTYT 603

Query: 638 TTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPD 697
           ++P A +   S  +++P A     S  +++P A +   S  +++P       S  +++P 
Sbjct: 604 SSPSAPAAISSTYTSSPSAPVAVSSTYTSSPSAPAAISSTYTSSPSVPVAVSSTYTSSPS 663

Query: 698 AKSVSQSNLSTTPDAKSVSQSHLSSTPDAKSVSQSNLSATP------ESNLSATPDANSA 751
           A +   S  +++P       S  +S+P A +   S  +++P       S  +++P A +A
Sbjct: 664 APAAISSTYTSSPSVPVAVSSTYTSSPSAPAAISSTYTSSPSAPVAVSSTYTSSPSAPAA 723

Query: 752 SQSNLSNTPDA 762
             S  +++P A
Sbjct: 724 ISSTYTSSPSA 734

 Score = 38.5 bits (88), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 87/191 (45%), Gaps = 6/191 (3%)

Query: 578 SHLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLS 637
           S  +++P A     S  +++P       S  +++P A +   S  +++P A     S  +
Sbjct: 572 STYTSSPSAPVAISSTYTSSPSVPVAVSSTYTSSPSAPAAISSTYTSSPSAPVAVSSTYT 631

Query: 638 TTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPD 697
           ++P A +   S  +++P       S  +++P A +   S  +++P       S  +++P 
Sbjct: 632 SSPSAPAAISSTYTSSPSVPVAVSSTYTSSPSAPAAISSTYTSSPSVPVAVSSTYTSSPS 691

Query: 698 AKSVSQSNLSTTPDAKSVSQSHLSSTPDAKSVSQSNLSATP------ESNLSATPDANSA 751
           A +   S  +++P A     S  +S+P A +   S  +++P       S  +++P A +A
Sbjct: 692 APAAISSTYTSSPSAPVAVSSTYTSSPSAPAAISSTYTSSPSAPVAVSSTYTSSPSAPAA 751

Query: 752 SQSNLSNTPDA 762
             S  +++P A
Sbjct: 752 ISSTYTSSPSA 762

 Score = 37.4 bits (85), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 74/161 (45%)

Query: 578 SHLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLS 637
           S  +++P A     S  +++P A +   S  +++P       S  +++P A +   S  +
Sbjct: 614 STYTSSPSAPVAVSSTYTSSPSAPAAISSTYTSSPSVPVAVSSTYTSSPSAPAAISSTYT 673

Query: 638 TTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPD 697
           ++P       S  +++P A +   S  +++P A     S  +++P A +   S  +++P 
Sbjct: 674 SSPSVPVAVSSTYTSSPSAPAAISSTYTSSPSAPVAVSSTYTSSPSAPAAISSTYTSSPS 733

Query: 698 AKSVSQSNLSTTPDAKSVSQSHLSSTPDAKSVSQSNLSATP 738
           A     S  +++P A +   S  +S+P A     S  +++P
Sbjct: 734 APVAVSSTYTSSPSAPAAISSTYTSSPSAPVAVSSTYTSSP 774

 Score = 36.6 bits (83), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 85/191 (44%), Gaps = 6/191 (3%)

Query: 578 SHLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLS 637
           S  +++P A     S  +++P A +   S  +++P A     S  +++P A     S  +
Sbjct: 530 STYTSSPSAPVAVSSTYTSSPSAPAAISSTYTSSPSAPVAVSSTYTSSPSAPVAISSTYT 589

Query: 638 TTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPD 697
           ++P       S  +++P A +   S  +++P A     S  +++P A +   S  +++P 
Sbjct: 590 SSPSVPVAVSSTYTSSPSAPAAISSTYTSSPSAPVAVSSTYTSSPSAPAAISSTYTSSPS 649

Query: 698 AKSVSQSNLSTTPDAKSVSQSHLSSTPDAKSVSQSNLSATP------ESNLSATPDANSA 751
                 S  +++P A +   S  +S+P       S  +++P       S  +++P A  A
Sbjct: 650 VPVAVSSTYTSSPSAPAAISSTYTSSPSVPVAVSSTYTSSPSAPAAISSTYTSSPSAPVA 709

Query: 752 SQSNLSNTPDA 762
             S  +++P A
Sbjct: 710 VSSTYTSSPSA 720

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            TGL N+ NTCY+NS+LQ  FS S  R+  L+
Sbjct: 701  TGLNNIGNTCYLNSLLQYYFSISPLRDYVLN 731

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 39/94 (41%), Gaps = 13/94 (13%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDT---MSRSFYMLFRKM 1161
             G RN   TCY+NS+LQ  F T  FR L       H  +SP       + R+FY L    
Sbjct: 205  VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEH--ESPNNSVPLALQRAFYQL---- 258

Query: 1162 YMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQ 1195
                  S +P   +++  +   D    + Q D Q
Sbjct: 259  ----QVSDIPLDTMELTRSFGWDTAESFTQHDVQ 288

 Score = 36.2 bits (82), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 26/112 (23%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNIV-LKNSEVAK------- 1441
            K + F + P +L + L RF YD      + V+    +P  +++    + EV K       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGD 441

Query: 1442 -------FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
                   + L+ ++ H G + +GHY +L+   +       + +WY FDDE V
Sbjct: 442  KSRNPYVYNLHGVLVHSGDISTGHYYTLIKPGV-------EDQWYRFDDERV 486

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
            YER151C
          Length = 917

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 61/159 (38%), Gaps = 36/159 (22%)

Query: 1384 KVSNGKPATVKSLNFI-TMPRILVIHLSRFIYDLTKKNN--------------------I 1422
            + SNG     K   FI  +PR+L+I L RF + +T  N                     I
Sbjct: 765  RTSNGTDVEAKKQTFIDKLPRVLLIQLKRFAF-VTNSNKDSNMSNYNAYSGRIEKIRKKI 823

Query: 1423 VVSYPLILNI------VLKNSEVAKFRLYSIVNHFGTLI-SGHYTSLVNKELNHEISHGK 1475
            +  + L + I       L++    +++L  ++ H G+    GHYT+ V            
Sbjct: 824  IYGHDLTIPIESVSSTSLRDDANREYKLTGVIYHHGSSPDGGHYTADV-------FHQQT 876

Query: 1476 QKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYER 1514
             KWY  DD  +    N    D     + +   Y+L YE+
Sbjct: 877  NKWYRIDDVNISELKNDHVLDADDNDMGTRTAYILIYEK 915

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
            UBP16Deubiquitinating enzyme anchored to the outer
            mitochondrial membrane, probably not important for
            general mitochondrial functioning, but may perform a more
            specialized function at mitochondria
          Length = 499

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 95/243 (39%), Gaps = 48/243 (19%)

Query: 1257 FQGQMENQLSCQRC-GYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTC--- 1312
            F+G+    L C +C G S  +Y   ++  L++P   ++           + I+ ++C   
Sbjct: 205  FEGETSKFLVCLKCKGLSEPSYKQTFIRELSVPQQTSENLSNILAHDETEIIDDYSCLIC 264

Query: 1313 -DEVLSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSR 1371
                + +   +   + C+P + +  D                      +L  +  K    
Sbjct: 265  QIRAILNHEEYRNFKDCTPDEILMLD----------------------RLKNYATKAPIN 302

Query: 1372 SEAP-------KFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYD-LTKKNN-- 1421
               P       K  SK + +VSN K   +K    + +P IL++HLSR  ++ +T   N  
Sbjct: 303  ENLPFEVEQYVKRYSKGNLQVSNIKGKVIKKDVVVQLPDILIVHLSRSTFNGITYSRNPC 362

Query: 1422 -------IVVS-YPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISH 1473
                   I +S Y L  +  +  +   K+ L S+V H G+  SGHY     K    EI  
Sbjct: 363  NVKFGERITLSEYTLAESGTITENRQVKYNLKSVVKHTGSHSSGHYMCYRRKT---EIRF 419

Query: 1474 GKQ 1476
            GK+
Sbjct: 420  GKE 422

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 40.0 bits (92), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 86/230 (37%), Gaps = 53/230 (23%)

Query: 1067 EETNNIK-VDGHKLIRNPIPHFSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFS 1125
            EE N+   V GH++++N  P+ +             L   GL N   TCY N+ +Q +  
Sbjct: 264  EEVNDAGSVKGHRIVKNWGPYLT------------NLRPKGLLNHGVTCYTNAAVQAMVH 311

Query: 1126 TSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDL 1185
              A ++         +      D++S +F  + ++M+     S      L+  N  K   
Sbjct: 312  IPAVQHYLFDILRGKHSDKVSPDSVSYAFAEITKRMWSPQDKSKKKRQSLQYINPKKLIA 371

Query: 1186 RIP--------YGQQDTQXXXXXXXXXXXXXXSSIESVSNDYSHLLLHDNVRLYVDDAQY 1237
            R+         + Q+D                      S++Y   L+    RL  D    
Sbjct: 372  RLDDINCMMSVWQQED----------------------SHEYFMSLMS---RLQEDSVPR 406

Query: 1238 NKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLAL 1287
                 ++I       + D+F G +E  ++C+ CG  S T   FY LSL L
Sbjct: 407  GHKLTESI-------LYDIFGGVLEQVVTCKSCGSISKTEQPFYDLSLHL 449

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 39.7 bits (91), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 24/117 (20%)

Query: 1386 SNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIV---VSYPLILNIV--------- 1433
             N     +K L    +P +LV+ L RF + L   N  +   + +P  LN+          
Sbjct: 339  CNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESE 398

Query: 1434 --LKNSEVAK--FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
              + N +V    + L  IV+H GT+  GHY +        +IS G  +W+ F+D +V
Sbjct: 399  KHIGNKKVPDIIYELIGIVSHKGTVNEGHYIAFC------KISGG--QWFKFNDSMV 447

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
            to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 697

 Score = 40.0 bits (92), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSR 1152
            + G  N  NTCY NS+LQCL++ + FR           LK P  D + R
Sbjct: 114  VFGYENFGNTCYCNSVLQCLYNLTEFR--------TEILKYPSRDGLLR 154

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 36/77 (46%), Gaps = 8/77 (10%)

Query: 1253 IDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTC 1312
            I+DLF+G + N   C  C   +     F    + +         + ++++++D +N +  
Sbjct: 436  IEDLFKGSLCNSTKCFTCDTITARDEPFLDFPIEI--------QEDEEIKIQDILNNYKH 487

Query: 1313 DEVLSDQNAWDCPRCCS 1329
             E+L+  N + C +CC 
Sbjct: 488  RELLTGANKFYCDKCCG 504

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 40.0 bits (92), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 7/91 (7%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMYMN 1164
             G RN   TCY+NS+LQ  F T  FR L        Y    E +T + S  +  ++ +  
Sbjct: 201  VGFRNQGATCYLNSLLQSYFFTKYFRKLV-------YKIPTESETPNSSVPLALQRAFYQ 253

Query: 1165 GGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQ 1195
               S +P   L++  +   D    + Q D Q
Sbjct: 254  LQVSQIPLDTLELTRSFGWDSAEAFTQHDVQ 284

 Score = 37.0 bits (84), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 19/105 (18%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNIV--------LKNSEVAK 1441
            K + F + P IL + L RF YD      I ++    +P   +            N+E   
Sbjct: 378  KGVIFESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCI 437

Query: 1442 FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
            + L+ ++ H G + +GHY +++  +L       + +WY FDDE V
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDL-------EDQWYRFDDEKV 475

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 40.0 bits (92), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 54/119 (45%), Gaps = 26/119 (21%)

Query: 1394 KSLNFITMPRILVIHLSRFIYD-----LTKKNN-------IVVSYPLILNIVLKNSEVAK 1441
            K + F + P +L + L RF YD     L K N+       I +S  +  +++  N     
Sbjct: 380  KGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRW 439

Query: 1442 FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV-------KFDTNHG 1493
            + L+ ++ H G + +GHY +L+   L       + +WY FDDE V        FD N G
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGL-------EDQWYRFDDERVWKVSKKQAFDENFG 491

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 50/242 (20%), Positives = 92/242 (38%), Gaps = 24/242 (9%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE---MDTMSRSFYMLFRKM 1161
             G RN   TCY+NS+LQ  F T  FR L      +   ++P+   +  + R+FY L    
Sbjct: 203  VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTSQ--ENPKDSVVLALQRAFYQL---- 256

Query: 1162 YMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESVSNDYSH 1221
                  S  P   +++  +   D    + Q D Q                  +V N  + 
Sbjct: 257  ----QVSQYPLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRMKGT-TVENKLNE 311

Query: 1222 LLLHDN------VRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSY 1275
            + +         + +  + A+   ++D  ++   L  + D F+  +E +L      Y++ 
Sbjct: 312  IFVGKMKSFIKCINVDYESARTEDFWDIQMNVKNLKGLKDSFENYIEVELMDGENQYAAQ 371

Query: 1276 TYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCSPSDYMS 1335
             Y     L  A    V ++F     L+L+     F  D+++   + ++ P     S YM 
Sbjct: 372  DYG----LQDAKKGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMD 427

Query: 1336 YD 1337
             D
Sbjct: 428  KD 429

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 39.7 bits (91), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 67/164 (40%), Gaps = 44/164 (26%)

Query: 1384 KVSNGKPATVKSLNFI-TMPRILVIHLSRFIY-DLTKKNN-------------------- 1421
            K S+G     K   FI  +P +L+IHL RF + + T K+N                    
Sbjct: 868  KSSSGADVEAKKQTFIDKLPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKIS 927

Query: 1422 ----IVVSYPLILNIVLKNSEVAKFRLYSIVNHFG-TLISGHYTS-LVNKELNHEISHGK 1475
                +V+    I N      E   + L  +V H G +   GHYT+ + +KE++       
Sbjct: 928  YNHELVIPAETITNGKQLAPENRTYELTGVVYHHGLSSDGGHYTADIYHKEVD------- 980

Query: 1476 QKWYYFDD----EIVKFDTNHGDYDNGIASVSSSNVYVLFYERI 1515
             KWY  DD    E+ K D   G    G  S  S   Y+L Y+++
Sbjct: 981  -KWYRIDDVTVTELEKDDVLKG----GENSTDSRTAYILMYQKL 1019

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 39.3 bits (90), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 53/105 (50%), Gaps = 19/105 (18%)

Query: 1393 VKSLNFITMPRILVIHLSRFIYDL---TKKNNIVVSYPLILNI--------VLKNSEVAK 1441
            ++ L    +P +L++ L RF + +   + K N  +S+PL LN+         L       
Sbjct: 349  IRQLTTAKLPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPVDCLHPVPNMM 408

Query: 1442 FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
            ++L +I++H GT+  GHYT++    +N +I      W  F+D +V
Sbjct: 409  YKLSAIISHHGTVHQGHYTTIC--RINGDI------WAKFNDSMV 445

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
            (UBP6) - (putative) ubiquitin-specific protease [contig
            710] FULL
          Length = 449

 Score = 39.3 bits (90), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 1093 ENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEM-DTMS 1151
            E +  ++++ +  GL+N+ NTCY+NS LQ L+     R+  L+ K      S E    + 
Sbjct: 48   EGAQMQHLSQTPVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPREKPSEEQHHQLV 107

Query: 1152 RSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDL 1185
                  F+++      SV P   L M     P  
Sbjct: 108  SELRRCFQQLKDKPQESVTPMLLLAMLRKCYPQF 141

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
            Anc_1.369 YFR010W
          Length = 502

 Score = 39.3 bits (90), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNK 1137
            G +NM NTCY+N+ LQ L+ T   R + L  K
Sbjct: 112  GFQNMGNTCYMNATLQALYRTDDIRQMILDYK 143

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
            YBL067C
          Length = 714

 Score = 39.3 bits (90), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 17/27 (62%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFR 1130
            I G  N  NTCY NS+LQCLF    FR
Sbjct: 121  IFGYENFGNTCYCNSILQCLFFLDDFR 147

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 50/122 (40%), Gaps = 15/122 (12%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNI--VLKNSEVAKFRLYSI-VNHFGT 1453
            +P  L +HL RF Y   K  N      + YPLIL++     +S   K+ L SI V+  G 
Sbjct: 504  LPHTLALHLKRFKYLEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELISIVVHLGGG 563

Query: 1454 LISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYE 1513
               GHY S+   +        K  W  FDDE V+                 +  YVLFY 
Sbjct: 564  PHHGHYVSICKSD--------KFGWLLFDDETVESINEETVLKFVGDPEDQTTAYVLFYR 615

Query: 1514 RI 1515
             I
Sbjct: 616  EI 617

 Score = 32.7 bits (73), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 7/75 (9%)

Query: 1253 IDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTC 1312
            I D FQG + NQ+ C  C   +     F    + + N         + L ++D +N +  
Sbjct: 422  ILDQFQGTLTNQIKCLTCDTLTSNNEPFLDFPIEVKN-------DDEDLNIQDILNKYHQ 474

Query: 1313 DEVLSDQNAWDCPRC 1327
             E+L+  N + C +C
Sbjct: 475  REILNGTNKFYCNQC 489

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 39.3 bits (90), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 52/120 (43%), Gaps = 15/120 (12%)

Query: 1401 MPRILVIHLSRFIYDLTKKNNI----VVSYPLILNIVLK-NSEVAK-FRLYSIVNHFGTL 1454
            +P+ L +HL RF Y   +  NI     V+YPL L++    N  + K + L  IV H G  
Sbjct: 959  LPKTLSLHLKRFKYSEEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNGIVVHMGGG 1018

Query: 1455 IS-GHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYE 1513
               GHY ++   +        K  W   DDE V+  +          S   +  YVLFY+
Sbjct: 1019 PQHGHYVAICKND--------KFGWLLMDDETVETISEETVLRCKGDSKDLTTAYVLFYK 1070

 Score = 36.6 bits (83), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            + G  N  NTCY NS+LQCL++ +  R   L
Sbjct: 515  VFGYENFGNTCYCNSVLQCLYNMTNLRTNIL 545

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 39.3 bits (90), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 61/164 (37%), Gaps = 37/164 (22%)

Query: 1381 LSDKVSNGKPATVKSLNFI-TMPRILVIHLSRFIY--------DLTKKNNIVVSYPLILN 1431
            LS K  +G     K   F+  +PR+L+I L RF +        +L   N        I  
Sbjct: 633  LSYKADSGNDVEAKKQAFLDRLPRVLLIQLKRFEFVNNSSERRELINYNAYNGRIEKIRK 692

Query: 1432 IVLKNSEV-----------AKF---------RLYSIVNHFGTLISG-HYTSLVNKELNHE 1470
             +  + E+           AKF         RL  +V H G   SG HYT+ V       
Sbjct: 693  WIRYDQELTIPKEALSSVNAKFYLSGKDTTYRLTGVVYHHGLSPSGGHYTADV------- 745

Query: 1471 ISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYER 1514
            +   + KWY  DD  V        +  G  +  S   Y+L Y+R
Sbjct: 746  LHQTQDKWYRIDDNNVTEIRQEDVFKRGDEASDSKTAYILIYQR 789

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
            UBP6Ubiquitin-specific protease situated in the base
            subcomplex of the 26S proteasome, releases free ubiquitin
            from branched polyubiquitin chains; works in opposition
            to Hul5p polyubiquitin elongation activity; mutant has
            aneuploidy tolerance
          Length = 499

 Score = 38.9 bits (89), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 1093 ENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            E    ++  L + G +NM NTCY+N+ LQ L+  +  R++ L+
Sbjct: 98   EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLRDMILN 139

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 16/102 (15%)

Query: 1393 VKSLNFITMPRILVIHLSRFIYDLTKKN---NIVVSYPLILNI-----VLKNSEVAKFRL 1444
            +K L    +P +LV+ L RF +    +N   N  + +P  LN+       +N+    + L
Sbjct: 323  IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYEL 382

Query: 1445 YSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
              +++H GT+  GHY + +  + N         W+ F+D +V
Sbjct: 383  NGVISHIGTVNEGHYIATLKLDSN--------NWFKFNDSMV 416

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
            YFR010W (REAL)
          Length = 500

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 1101 ALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            A S  G +NM NTCY+N+ LQ L+     R++ L
Sbjct: 105  AQSPVGFKNMGNTCYLNATLQALYRVDDVRDMIL 138

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
            Ashbya gossypii AEL242W
          Length = 696

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 10/87 (11%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLT--KKNNIVVSYP--LILN--IVLKNSEVA-- 1440
            K   +K    ++ P++L++HLSR ++D     KN+  V +P  LILN   + ++  +A  
Sbjct: 391  KSRILKRTVVVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPEDLILNEQEIKEDRCIAVH 450

Query: 1441 --KFRLYSIVNHFGTLISGHYTSLVNK 1465
              +++L +++ H GT   GHY    +K
Sbjct: 451  CVRYKLQAMIKHTGTHFQGHYEVFRHK 477

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
            YFR010W (REAL)
          Length = 499

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
             G +NM NTCY+N+ LQ L+     R++ L+
Sbjct: 109  VGFKNMGNTCYLNATLQALYRVDDLRDMILN 139

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR124C
            (UBP2)
          Length = 1389

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            TG+ N+ NTCY+NS+LQ  F+ S  R   L+
Sbjct: 677  TGINNIGNTCYLNSLLQYYFTISPLREYILA 707

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479 bp,
            492 aa] {ON} highly similar to uniprot|P43593
            Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
            protease situated in the base subcomplex of the 26S
            proteasome releases free ubiquitin from branched
            polyubiquitin chains deletion causes hypersensitivity to
            cycloheximide and other toxic compounds
          Length = 492

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            GL+NM NTCY+N+ LQ L+  +  R   L+
Sbjct: 105  GLKNMGNTCYMNATLQALYQITPLREAILN 134

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
            {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            G +NM NTCY+N+ LQ L+     R++ L
Sbjct: 110  GFQNMGNTCYLNATLQALYRIEPLRDMIL 138

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
            (REAL)
          Length = 499

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 1093 ENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            E    ++  L + G +NM NTCY+N+ LQ L+  +  R + L+
Sbjct: 98   EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLREMILN 139

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 55/119 (46%), Gaps = 26/119 (21%)

Query: 1394 KSLNFITMPRILVIHLSRFIYD-----LTKKNN-------IVVSYPLILNIVLKNSEVAK 1441
            K + F + P +L + L RF YD     L K N+       I +S  L  +++ KN     
Sbjct: 379  KGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCV 438

Query: 1442 FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV-------KFDTNHG 1493
            + L+ ++ H G +  GHY +++  ++      G Q W+ FDD+ V        FD N G
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDV------GDQ-WFRFDDDKVWRVTKEQAFDENFG 490

 Score = 38.9 bits (89), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 1103 SITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPE---MDTMSRSFYML 1157
               GL+N   TCY+NS+LQ  F T  FR +    K     +SP    +  + RSFY+L
Sbjct: 200  GFIGLKNQGATCYLNSLLQSYFFTKLFRKIVY--KIPSENESPNDSVLLALQRSFYLL 255

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 38.9 bits (89), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 49/105 (46%), Gaps = 19/105 (18%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVS--YPLILNIVLK---NSEVAKFR----- 1443
            K + F + P +L + L RF YD      I ++  Y    +I L    + EV K R     
Sbjct: 376  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMM 435

Query: 1444 --LYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
              L+ ++ H G + +GHY +++   L+        KWY FDD+ V
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIKPGLD-------DKWYRFDDDKV 473

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 45/238 (18%), Positives = 91/238 (38%), Gaps = 18/238 (7%)

Query: 1103 SITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMY 1162
               GL+N   TCY+NS+LQ  + T  FR L        Y    + +T S S  +  ++ +
Sbjct: 197  GFVGLKNQGATCYLNSLLQSYYFTKYFRKLV-------YHIPTDGETPSNSVPLALQRAF 249

Query: 1163 MNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESVSNDYSHL 1222
                 S  P    ++  +   D    + Q D Q               + E V    + +
Sbjct: 250  YKLQRSSEPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKATE-VEGKLNEI 308

Query: 1223 LLHDN------VRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYT 1276
             +         V +  + ++   ++D  ++  GL+ ++  F+  +E ++      Y++  
Sbjct: 309  FVGKMKSYIKCVNVEYESSRVEDFWDIQLNVKGLNGLNQAFENYIEVEMMDGENQYAAQR 368

Query: 1277 YSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRCCSPSDYM 1334
            Y     L  A    V ++F     L+L+     F  D+++   + ++ P     S Y+
Sbjct: 369  YG----LQDAKKGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYL 422

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 38.9 bits (89), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            TGL N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 732  TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            TG+ N+ NTCY+NS+LQ  FS S  R   L 
Sbjct: 752  TGINNIGNTCYLNSLLQYYFSISPLREYVLG 782

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455 bp,
            484 aa] {ON} similar to uniprot|P43593 Saccharomyces
            cerevisiae YFR010W UBP6 Ubiquitin-specific protease
            situated in the base subcomplex of the 26S proteasome
            releases free ubiquitin from branched polyubiquitin
            chains deletion causes hypersensitivity to cycloheximide
            and other toxic compounds
          Length = 484

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            GLRNM NTCY N+ LQ L+     R   L+
Sbjct: 107  GLRNMGNTCYFNASLQALYRIKPLREKVLA 136

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            TG+ N+ NTCY+NS+LQ  FS +  R+  L+
Sbjct: 736  TGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
            YPL072W
          Length = 734

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 83/217 (38%), Gaps = 28/217 (12%)

Query: 1257 FQGQMENQLSCQRCGYSS-YTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEV 1315
            F GQ+ + L C +C  SS      F +  L +P  ++            D I  ++C   
Sbjct: 298  FGGQLADHLVCMKCTNSSKVNIHPFIIYPLTVPQAMSAKLSDMVSDNQTDTIEGYSC--- 354

Query: 1316 LSDQNAWDCPRCCSPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAP 1375
                        C  S  ++Y+ KG+     + E      +    L           E  
Sbjct: 355  ----------LTCKVSTIVNYE-KGRGYAKCTQEEKRILKTLEDALPDMAINDELSDELT 403

Query: 1376 KF-SSKLSDKVSNG--KPATVKSLNFITMPRILVIHLSRFIYDLT--KKNNIVVSYPLIL 1430
             + +S   D +     K   VK    +  P+ LV+HLSR ++D    ++N+  V++  IL
Sbjct: 404  SYINSYNKDGIVGADLKSTIVKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEIL 463

Query: 1431 ----NIVLKNSEVA----KFRLYSIVNHFGTLISGHY 1459
                 ++  N  V      ++L +IV H G+   GHY
Sbjct: 464  ESREQVIRHNKCVGINPISYKLKAIVAHSGSHSQGHY 500

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin-specific
            protease
          Length = 782

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 10/92 (10%)

Query: 1384 KVSNGKPATVKSLNFITMPRILVIHLSRFIYDLT--KKNNIVVSY--PLILN-IVLKNSE 1438
            K S  K   VK    +  P +L++HLSR ++D    +KN   VS+   L++N  V++N++
Sbjct: 430  KTSEIKSTIVKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQVIENNK 489

Query: 1439 VAKFR-----LYSIVNHFGTLISGHYTSLVNK 1465
                R     L S++ H G+  +GHY    +K
Sbjct: 490  CVGIRKDSYKLRSMLRHQGSHSTGHYECFRHK 521

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRN 1131
            TGL N+ NTCY+NS+LQ  F+ S  R+
Sbjct: 696  TGLNNIGNTCYLNSLLQYYFTISPLRD 722

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 26/119 (21%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNIV-LKNSEVAK------- 1441
            K + F + P +L + L RF YD      I V+    +P  +++    +SE  +       
Sbjct: 380  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKI 439

Query: 1442 FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVK-------FDTNHG 1493
            ++L+ ++ H G + +GHY +L+           K +WY FDD+ V        FD N G
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIK-------PSTKDEWYRFDDDRVWRATKKQIFDDNFG 491

 Score = 36.6 bits (83), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNL 1132
             G RN   TCY+NS+LQ  + T  FR L
Sbjct: 203  VGFRNQGATCYLNSLLQSYYFTKYFRRL 230

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 38.5 bits (88), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            TG+ N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 736  TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 38.5 bits (88), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            G+ N+ NTCY+NS+LQ  FS +  RN  L
Sbjct: 714  GINNIGNTCYLNSLLQYYFSIAPLRNYVL 742

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar to
            gnl|GLV|KLLA0E23463g Kluyveromyces lactis KLLA0E23463g
            and some similarites with YPL072W uniprot|Q02863
            Saccharomyces cerevisiae YPL072W UBP16 Putative
            ubiquitin-specific protease
          Length = 767

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTK--KNNIVVSYPLILN----IVLKNSEVA-- 1440
            K   VK    +  P +L+IHLSR +++     +N+  V++   L     I+ KN  V   
Sbjct: 440  KSTIVKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVN 499

Query: 1441 --KFRLYSIVNHFGTLISGHY 1459
              K+RL + V H GT  +GHY
Sbjct: 500  NVKYRLRATVRHQGTHSAGHY 520

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRN 1131
            TGL N+ NTCY+NS+LQ  F+ S  R+
Sbjct: 747  TGLNNIGNTCYLNSLLQYYFAISPLRD 773

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 70/188 (37%), Gaps = 50/188 (26%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMS----RSFYMLFRKM 1161
            G +N   TCY+NS+LQ  F T  FR +    K     +SP  D++S    RSFY+L +  
Sbjct: 203  GFKNQGATCYLNSLLQSYFFTKLFRKMVY--KIPSDNESPN-DSVSLALQRSFYLLEK-- 257

Query: 1162 YMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESVSNDYSH 1221
                  S  P   L++  +   D    + Q D Q                          
Sbjct: 258  ------SKEPLDTLELTRSFGWDTGEAFTQHDVQELNR---------------------- 289

Query: 1222 LLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFY 1281
             +L D +   +   +                ++DLF G+M++ + C    Y S+    F+
Sbjct: 290  -ILMDRLETRMKGTEVE------------GTLNDLFVGKMKSYIRCVNVDYESFRVEDFW 336

Query: 1282 VLSLALPN 1289
             + L + N
Sbjct: 337  DIQLNVKN 344

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1227

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLSNK 1137
            GL N+ NTCY+NS+LQ  FS +  R   L+ K
Sbjct: 711  GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            TG+ N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 735  TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 38.1 bits (87), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            TGL N+ NTCY+NS+LQ  F  S  R   +
Sbjct: 703  TGLNNIGNTCYLNSLLQYYFCISPLRQFIV 732

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
            Anc_3.270 YBR058C
          Length = 765

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 1105 TGLRNMSNTCYINSMLQCLF 1124
             GL NM N+CY+NS+LQCLF
Sbjct: 320  CGLINMGNSCYLNSVLQCLF 339

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 38.1 bits (87), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            GL N+ NTCY+NS+LQ  FS    R+  L
Sbjct: 763  GLNNIGNTCYLNSLLQYYFSIKPLRDFIL 791

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 38.1 bits (87), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFL 1134
            TG+ N+ NTCY+NS+LQ  FS +  R   L
Sbjct: 736  TGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YER098W (UBP9) and
            YBL067C (UBP13)
          Length = 740

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFSTSAFR 1130
            + GL N  NTCY NS+LQCL++    R
Sbjct: 98   VFGLENYGNTCYCNSVLQCLYNLKELR 124

 Score = 33.9 bits (76), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 48/114 (42%), Gaps = 17/114 (14%)

Query: 1408 HLSRFIYDLTKKNNI----VVSYPLILNIV--LKNSEVAKFRLYSIVNHFGTLIS-GHYT 1460
            HL RF Y    ++NI    V+ YPL L +     ++    + L  IV H G     GHY 
Sbjct: 552  HLKRFKYSEKHQSNIKLFNVIHYPLNLRVCSTFDHAVCKDYELNGIVIHMGGGPQHGHYV 611

Query: 1461 SLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSS-SNVYVLFYE 1513
            ++   EL          W  +DDE V+           I  V+  +  YVLFY+
Sbjct: 612  AICKHELF--------GWLLYDDETVE-SVGEDAVLRFIGDVNDMTTAYVLFYK 656

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 18/26 (69%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRN 1131
            GL N+ NTCY+NS+LQ  F  S  RN
Sbjct: 727  GLNNIGNTCYLNSLLQYYFCISPLRN 752

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 53/105 (50%), Gaps = 19/105 (18%)

Query: 1393 VKSLNFITMPRILVIHLSRF---IYDLTKKNNIVVSYPLILNI--VLKNSE------VAK 1441
            +K      +P +LV+ L RF   +  + +K N  + +P IL++   LK+++         
Sbjct: 341  IKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSIL 400

Query: 1442 FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
            + L  I++H G++  GHY +        +I +G  +W+ F+D +V
Sbjct: 401  YELIGIISHTGSVNEGHYVAFC------KIENG--EWFKFNDSMV 437

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
            {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFR 1130
            TG+ N+ NTCY+NS+LQ  F+ S  R
Sbjct: 722  TGINNIGNTCYLNSLLQFYFAISPLR 747

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            GL N+ NTCY+NS+LQ  F+ +  RN   S
Sbjct: 726  GLNNIGNTCYLNSLLQYYFAIAPLRNYICS 755

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 58/130 (44%), Gaps = 26/130 (20%)

Query: 1393 VKSLNFITMPRILVIHLSRFIYDLTKKN---NIVVSYPLILNIV--LKNSEVAK-----F 1442
            +K +    +P +LV+ L RF + +   N   N  ++YP  LN+     +SE        +
Sbjct: 334  IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 1443 RLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASV 1502
             L ++++  G++  GHYT +       ++  G  +W+ F+D ++   T           V
Sbjct: 394  ELVAVISQEGSVNQGHYTCMC------KVPGG--QWFRFNDTMIVSITE--------EDV 437

Query: 1503 SSSNVYVLFY 1512
                 Y+LFY
Sbjct: 438  LRQQAYLLFY 447

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 37.7 bits (86), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 19/113 (16%)

Query: 1386 SNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNI-------VL 1434
             +G     K + F + P +L + L RF YD      I ++    +P  +++       V 
Sbjct: 359  GHGLQDAKKGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQ 418

Query: 1435 KNSEV-AKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
            ++S   AK+ L+ ++ H G + +GHY +++   L       +  WY FDD+ V
Sbjct: 419  EDSPANAKYNLHGVLVHTGDISTGHYYAMIKPGL-------EDAWYRFDDDKV 464

 Score = 36.6 bits (83), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNL 1132
             GL+N   TCY+NS+LQ  + T  FR L
Sbjct: 190  VGLKNQGATCYLNSLLQSYYFTKYFRKL 217

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 37.7 bits (86), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 20/38 (52%)

Query: 1095 SYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNL 1132
            +YN        G +N   TCY+NS+LQ  F T  FR L
Sbjct: 183  NYNSKKVTGYVGFKNQGATCYLNSLLQSYFFTKYFRRL 220

 Score = 36.2 bits (82), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 54/120 (45%), Gaps = 27/120 (22%)

Query: 1394 KSLNFITMPRILVIHLSRFIYDLTKKNNIVVS----YP-------LILNIVLKNSEV--A 1440
            K + F + P +L + L RF YD      I V+    +P        I  +  +++E+   
Sbjct: 370  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPC 429

Query: 1441 KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV-------KFDTNHG 1493
             ++L+ ++ H G + +GHY +++           + +WY FDDE V        FD N G
Sbjct: 430  IYKLHGVLVHAGDISTGHYYAMIK-------PSTEDQWYRFDDEKVWKVTKTQVFDENFG 482

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 37.7 bits (86), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 1100 VALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            VA    G+ N+ NTCY+NS+LQ  F+    R+  L+
Sbjct: 693  VATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILN 728

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 37.7 bits (86), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRN 1131
            TGL N+ NTCY+NS+LQ  F  S  R 
Sbjct: 703  TGLNNIGNTCYLNSLLQYYFCISPLRQ 729

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 51/104 (49%), Gaps = 18/104 (17%)

Query: 1393 VKSLNFITMPRILVIHLSRFIYDLTKKN---NIVVSYPLILNI---VLKNSEVAK----F 1442
            +K      +P +LV+ L RF + +   N   N  V YPL LN+     +N+        +
Sbjct: 347  IKQFTINKLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDIIY 406

Query: 1443 RLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
             L  I++H G++  GHY  ++      +I+ G  +W+ F+D ++
Sbjct: 407  ELTGILSHIGSINEGHYVVVL------KINDG--RWFKFNDSMI 442

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
            YPL072W
          Length = 498

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 95/218 (43%), Gaps = 29/218 (13%)

Query: 1257 FQGQMENQLSCQRCG-YSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEV 1315
            F+G   N L C +C  YS   +S F +L +A+P   ++        +L D I   + DE+
Sbjct: 201  FEGVSSNYLMCLQCNKYSQTIHSPFLMLEVAVPGNYSE--------KLTDLI-LHSQDEI 251

Query: 1316 LSDQNAWDCPRCCSPSDYMSYDHKGKRKI-STSFESLNGGNSSRSKLFKFGYKMRSRSEA 1374
            +     + C  C    + +  + K   ++   S E  +  N  R+++          ++ 
Sbjct: 252  IE---GYSCLYC--KVNMILKNEKYLNQLPEYSQEEQSILNFLRNQILTLYINDDLPADV 306

Query: 1375 PKFSSKLSDK---VSNGKPATVKSLNFITMPRILVIHLSRFIYD---LTK-------KNN 1421
              +    S      +N K   +K    I  P  L++HLSR I++   +T+       + +
Sbjct: 307  SFYVDHYSKNGCVTANFKSNIIKKNAVIKEPASLIVHLSRSIFNGATITRSACRVEYEQS 366

Query: 1422 IVVSYPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHY 1459
            + +   +++N   + +E  K+ L S+V H G+ + GHY
Sbjct: 367  LNLQRQVMINDAFERTEPIKYELKSVVKHTGSHVQGHY 404

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) [1488
            bp, 495 aa] {ON} similar to uniprot|P43593 Saccharomyces
            cerevisiae YFR010W UBP6 Ubiquitin-specific protease
            situated in the base subcomplex of the 26S proteasome
            releases free ubiquitin from branched polyubiquitin
            chains deletion causes hypersensitivity to cycloheximide
            and other toxic compounds
          Length = 495

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
             GL+N+ NTCY+NS LQ L+     R   L+
Sbjct: 106  VGLKNLGNTCYMNSTLQALYQIRPLREEILN 136

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
            to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
            Ubiquitin-specific protease that specifically
            disassembles unanchored ubiquitin chains
          Length = 770

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 39/74 (52%), Gaps = 11/74 (14%)

Query: 1440 AKFRLYSIVNHFGTLI-SGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNG 1498
            AK++L +++ H G  + SGHY + + K     +  GK++W  ++DE +    +  ++++ 
Sbjct: 703  AKYKLTAVICHKGNSVHSGHYVAFIKK-----VVEGKEQWVLYNDEKILLANDEPNFED- 756

Query: 1499 IASVSSSNVYVLFY 1512
                   N Y+ F+
Sbjct: 757  ----IEKNGYMFFF 766

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 19/106 (17%)

Query: 1392 TVKSLNFITMPRILVIHLSRFIYDL---TKKNNIVVSYPLILNI----VLKNSEV----A 1440
             +K L+   +P +LV+ L RF + L   + K N  + YP  LN+       +S+V     
Sbjct: 342  AIKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDVDVPDL 401

Query: 1441 KFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
             + L  +V H GT+  GHY +            G+Q W+ F+D +V
Sbjct: 402  IYELIGVVAHKGTVNEGHYVATTKVA-------GRQ-WFKFNDSMV 439

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 37.0 bits (84), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 98/248 (39%), Gaps = 33/248 (13%)

Query: 1104 ITGLRNMSNTCYINSMLQCLFST---SAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRK 1160
            I GL N  NTC++NS+LQ L S+   +AF +  + N   +       +T+ R   ++  K
Sbjct: 57   IAGLVNDGNTCFMNSVLQSLASSKELAAFLDNVIENGSENNGDIKFTETL-RELLLILNK 115

Query: 1161 MYMNGGCSVVPSGFLK-MCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXX----XSSIESV 1215
             Y         +  LK M N    ++ + Y Q+D Q                  +  +  
Sbjct: 116  KYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIKKPSTEKKEE 175

Query: 1216 SNDYSHLLLHDNVRLYVDD-------------AQYNKWFDQNIDQNGLSPIDDL--FQGQ 1260
             N+     L D+  L  DD              + N    +N DQ   SP   +    G 
Sbjct: 176  RNNIKESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVL-ENPDQKLYSPFKLITPLDGI 234

Query: 1261 MENQLSCQRCGYS-SYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQ 1319
               ++ C  CG +    YS F  LSL LP   +++  ++  L+L + +N +   E++   
Sbjct: 235  TAERIGCLTCGENGGIRYSVFSGLSLNLP---SESLNQS-TLKLSELLNEWVKPEIIE-- 288

Query: 1320 NAWDCPRC 1327
               +C RC
Sbjct: 289  -GVECNRC 295

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500 bp,
            499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 36.6 bits (83), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 1106 GLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135
            G +NM NTCY+N+ LQ L+     R+  L+
Sbjct: 108  GFKNMGNTCYLNATLQALYRIDDLRDAVLN 137

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar to
            uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
            Ubiquitin-specific protease that specifically
            disassembles unanchored ubiquitin chains
          Length = 776

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 18/21 (85%)

Query: 1105 TGLRNMSNTCYINSMLQCLFS 1125
             GL N+ N+CY+NS+LQCLF+
Sbjct: 323  CGLINLGNSCYLNSVLQCLFN 343

 Score = 33.9 bits (76), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 1241 FDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALP 1288
             D+ I +NG +P +DL +  ME++L C  CG   Y+      L L +P
Sbjct: 426  LDKKIFKNGSNP-NDLMKFTMEDRLQCTNCGKVKYSSEAAESLQLPMP 472

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
            YBR058C
          Length = 780

 Score = 36.6 bits (83), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 67/174 (38%), Gaps = 37/174 (21%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMYMN 1164
             GL N+ N+CYINS+LQCL +                +K+  +  +  SF +       N
Sbjct: 322  CGLINLGNSCYINSVLQCLLNGG--------------VKTYSLSALGESFPLDVLYPSTN 367

Query: 1165 GGCSVVPSGFLKMCNTLK--PDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESVSNDYSHL 1222
              C ++     K+ N +K  P+L  P G +                   I     ++S  
Sbjct: 368  MKCQLI-----KLNNAIKLEPEL-YPSGIR------------PRSFKKCIGQAHEEFSSE 409

Query: 1223 LLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYT 1276
               D +      + +N   D+ I     +   DL +  +EN+L C +CG   YT
Sbjct: 410  RQQDALEFL---SFFNDTLDKKIFSRSENNPSDLMRYIIENRLQCTKCGKVKYT 460

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
            [3756 nt, 1252 aa]
          Length = 1251

 Score = 36.6 bits (83), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 18/26 (69%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFR 1130
             GL N+ NTCY+NS+LQ  F+ S  R
Sbjct: 762  VGLNNIGNTCYLNSLLQYYFAISPLR 787

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 36.6 bits (83), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNL 1132
             G +N   TCY+NS+LQ  F T  FR L
Sbjct: 206  VGFKNQGATCYLNSLLQSYFFTKYFRKL 233

 Score = 36.2 bits (82), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 50/105 (47%), Gaps = 19/105 (18%)

Query: 1394 KSLNFITMPRILVIHLSRFIYD-----LTKKNN-------IVVSYPLILNIVLKNSEVAK 1441
            K + F + P +L + L RF YD     L K N+       I +S  L   I   N++   
Sbjct: 383  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYI 442

Query: 1442 FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
            + L+ ++ H G + +GHY +++   +       + +WY FDD+ V
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSI-------EDQWYRFDDDKV 480

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
            (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 36.2 bits (82), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 75/183 (40%), Gaps = 47/183 (25%)

Query: 1324 CPRCCS-------PSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPK 1376
            CP C S       P   +S D KGK   +T +E LN  +  + +L  F Y  ++      
Sbjct: 287  CPECNSDAKTTIEPFMDLSLDIKGK---NTLYECLNSFHK-KEQLHDFDYHCKN------ 336

Query: 1377 FSSKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTK---KNNIVVSYPLILN-- 1431
                      N      K L    +  +L+    RF + L+    K N V+ +PL LN  
Sbjct: 337  ---------CNTSQDPTKQLAVAKLSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMK 387

Query: 1432 ----IVLKNSEVAK----FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDD 1483
                +  ++   +K    + L  I+ H GT+  GHYT++       +I  G  +W  F+D
Sbjct: 388  DYCDVEQRDDSNSKPDLIYELIGIICHTGTVNEGHYTAIC------KIPEG--QWIKFND 439

Query: 1484 EIV 1486
             +V
Sbjct: 440  SMV 442

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 35.8 bits (81), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 53/113 (46%), Gaps = 27/113 (23%)

Query: 1393 VKSLNFITMPRILVIHLSRFIYDL---TKKNNIVVSYPLILNIVL----KNSEVAK---- 1441
            +K L    +  +LV  L RF + L   T K N  + YPL LN+       N++  +    
Sbjct: 365  IKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESN 424

Query: 1442 --------FRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
                    + L SI++H GT+  GHY  +V      +++ G  +W+ F+D +V
Sbjct: 425  SENVPDMIYELTSIISHKGTVNEGHYIVVV------KVNDG--QWFKFNDSMV 469

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa] {ON}
            some similarities with uniprot|Q02863 Saccharomyces
            cerevisiae YPL072W UBP16 Putative ubiquitin- specific
            protease
          Length = 752

 Score = 35.8 bits (81), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query: 1389 KPATVKSLNFITMPRILVIHLSRFIYDLTK--KNNIVVSYPLILNI---VLKNSEVA--- 1440
            K   VK       P IL++HLSR +++ T   +N+  V++   L+     ++N+      
Sbjct: 432  KSRIVKKTVVTESPEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQEQTIENNRCVGVK 491

Query: 1441 --KFRLYSIVNHFGTLISGHYTSLVNK 1465
              K++L S+V H GT   GHY     K
Sbjct: 492  PIKYKLKSMVKHQGTHSQGHYECFRRK 518

>KNAG0I02870 Chr9 (558973..562131) [3159 bp, 1052 aa] {ON} Anc_6.333
           YNR026C
          Length = 1052

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 51/87 (58%), Gaps = 3/87 (3%)

Query: 636 LSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTT 695
           L TT D+ ++S++ L TTP   +  + N  + PD+  V+  +++TTP +  V  +  +T 
Sbjct: 728 LPTTSDSNTISEAPLQTTPTLTNTLKGN--SEPDSTLVTHDSVTTTPMSAPVVLTRETTA 785

Query: 696 PDAKSVSQSNLSTTPDAKSVSQSHLSS 722
           P + S+  S LS+  ++KSV +  +SS
Sbjct: 786 PSSASM-DSTLSSAQESKSVVEPEVSS 811

 Score = 35.4 bits (80), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 51/87 (58%), Gaps = 3/87 (3%)

Query: 650 LSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTT 709
           L TT D+ ++S++ L TTP   +  + N  + PD+  V+  +++TTP +  V  +  +T 
Sbjct: 728 LPTTSDSNTISEAPLQTTPTLTNTLKGN--SEPDSTLVTHDSVTTTPMSAPVVLTRETTA 785

Query: 710 PDAKSVSQSHLSSTPDAKSVSQSNLSA 736
           P + S+  S LSS  ++KSV +  +S+
Sbjct: 786 PSSASM-DSTLSSAQESKSVVEPEVSS 811

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
            (REAL)
          Length = 503

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 53/121 (43%), Gaps = 14/121 (11%)

Query: 1385 VSNGKPATVKSLNFITMPRILVIHLSRFIYD-LTKKNN----------IVVSYPLILNIV 1433
            +SN K   +K    + +P++LVIHLSR  ++ +T   N           +  Y  I N+ 
Sbjct: 331  ISNVKGKVIKRDIAVKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMK 390

Query: 1434 LKNSEVAKFRLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHG 1493
            L  +    + L S+V H G+   GHY     K    +I   K+   + D   +  + NH 
Sbjct: 391  LTENRQIVYNLKSVVKHTGSHSRGHYMCYRRKG---DILFDKEDESFVDSRSIITNRNHN 447

Query: 1494 D 1494
            +
Sbjct: 448  E 448

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
            similar to uniprot|P38237 Saccharomyces cerevisiae
            YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 17/21 (80%)

Query: 1105 TGLRNMSNTCYINSMLQCLFS 1125
             GL N+ N+CY+NS LQCLF+
Sbjct: 331  CGLINLGNSCYLNSTLQCLFN 351

>Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt, 250
            aa]
          Length = 249

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 14/81 (17%)

Query: 1437 SEVAKFRLYSIVNHFGTLI-SGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDY 1495
            +E  K++L S+V H G  + SGHY + + KE+        ++W  ++DE +    +  + 
Sbjct: 182  NEPGKYKLTSVVCHKGNSVQSGHYVAFIKKEI-----ENVERWVLYNDEKIVIAEDLEEL 236

Query: 1496 DNGIASVSSSNVYVLFYERIF 1516
                    S N Y+  Y R+ 
Sbjct: 237  --------SKNGYIYIYSRVI 249

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
            weakly similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072w UBP16
          Length = 483

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 64/163 (39%), Gaps = 34/163 (20%)

Query: 1388 GKPATVKSLNFITMPRILVIHLSRFIYD--LTKKNNIVVSYPLILNIVL---------KN 1436
             + + +K   F+  P I VIHLSR  Y+     +N   V +   L+            + 
Sbjct: 321  ARRSILKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEF 380

Query: 1437 SEVAKFRLYSIVNHFGTLISGHYTSLVNKEL-----------NHEISHGKQKWYYFDDEI 1485
            ++  ++RL SIV H G+  SGHY  L  K +           N   + G++K    D   
Sbjct: 381  TKRVRYRLKSIVIHTGSHYSGHYQVLRRKPIIMKSKVSGDIVNTGTTIGEKKPTVMDSNF 440

Query: 1486 VKF------------DTNHGDYDNGIASVSSSNVYVLFYERIF 1516
             +             DTN  +           +VY+LFYERI 
Sbjct: 441  RRMKSTTIYPFWLISDTNVKEKRISDIVNEQKSVYMLFYERIL 483

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
            Anc_3.270 YBR058C
          Length = 795

 Score = 35.0 bits (79), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%)

Query: 1106 GLRNMSNTCYINSMLQCLFS 1125
            G  N+ N+CY+NS+LQCLF+
Sbjct: 334  GFINLGNSCYLNSVLQCLFN 353

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
            Anc_2.69 YNL186W
          Length = 746

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 1251 SPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLAL 1287
            S I D+F G ++ +++C+ CG  S T   FY LSL L
Sbjct: 427  SIIYDIFGGLLKQEVTCKSCGEISKTEQPFYDLSLHL 463

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 66/148 (44%), Gaps = 23/148 (15%)

Query: 1351 LNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKVSNGKPATVKSLNFITMPRILVIHLS 1410
            L+ G  ++S L +       R     F+    + +S   P  ++ L+   +P +L++ L 
Sbjct: 312  LSLGIQNKSTLHECLDSFHRRESLTDFNYCCKNCMSTSNP--IRQLSMAKLPPVLMLQLK 369

Query: 1411 RFIYDLTKKNNIVVSYPLILNIVLKNSEVAK------------FRLYSIVNHFGTLISGH 1458
            RF + L    ++ ++  +  ++ L   +  K            F+L +I+ H GT+  GH
Sbjct: 370  RFEH-LINGTSVKINDYIFFSVDLNMKDYCKPMDDQHPVPNLTFKLSAIIPHQGTVDKGH 428

Query: 1459 YTSLVNKELNHEISHGKQKWYYFDDEIV 1486
            YT++    +N ++      W  F+D +V
Sbjct: 429  YTTIC--RINGDV------WAKFNDSMV 448

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098W UBP9 Ubiquitin-specific protease that
            cleaves ubiquitin-protein fusions
          Length = 714

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 8/85 (9%)

Query: 1245 IDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLE 1304
            +D N L+ +D LF+G + N+  C  C   +Y    F   ++ + +      G+T    ++
Sbjct: 436  MDDNHLNFVDRLFKGTLTNRTKCLTCDNMTYRNEPFLDFAIEVQDD-----GETD---IQ 487

Query: 1305 DCINFFTCDEVLSDQNAWDCPRCCS 1329
              +  +   E+L+  N + C  CC 
Sbjct: 488  TTLADYHQKELLNGANKFYCDECCG 512

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 17/99 (17%)

Query: 1398 FITMPRILVIHLSRFIYDLTKKNNIVVS----YPLILNI------VLKNSEVAKFRLYSI 1447
            F + P +L + L RF YD      I ++    +P  +++             A + L+ +
Sbjct: 377  FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTPADYILHGV 436

Query: 1448 VNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIV 1486
            + H G + +GHY +++  +     +HG   WY FDD+ V
Sbjct: 437  LVHSGDISTGHYYAMIQPD-----AHG--SWYRFDDDRV 468

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 16/30 (53%)

Query: 1103 SITGLRNMSNTCYINSMLQCLFSTSAFRNL 1132
               G +N   TCY+NS+LQ    T  FR L
Sbjct: 195  GFVGFKNQGATCYLNSLLQSYHFTKLFRKL 224

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 34.3 bits (77), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 85/199 (42%), Gaps = 38/199 (19%)

Query: 1250 LSPIDDLFQGQMENQLSCQRCGY-SSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCIN 1308
            ++P+D    G    ++ C +CG      YS    +SL LP   ++  G T  L+L D +N
Sbjct: 310  VTPLD----GITAERIGCLQCGENGGIRYSVTSSMSLNLP---SEDIGST--LKLSDLLN 360

Query: 1309 FFTCDEVLSDQNAWDCPRCC--SPSDYMSYDHKGKRKISTSFESLNGGNSSRSKLFKFGY 1366
             +   E++       C RC   +  D++    K        +E  N G+S   KL +  +
Sbjct: 361  QWIKPEIIE---GVSCNRCALEAVRDHLLEQLK-------QYE--NKGDSIPEKLLQ-AF 407

Query: 1367 KMRSRS-----EAPKFS----SKLSDKVSNGKPATVKSLNFITMPRILVIHLSRFIYD-- 1415
            K R          P  S     +L  +    K +  K + F+  P +L IH++R ++D  
Sbjct: 408  KARVEELNVSLSKPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPR 467

Query: 1416 --LTKKNNIVVSYPLILNI 1432
              + +KNN  V +   LN+
Sbjct: 468  TYMIRKNNSRVLFKSRLNL 486

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
            Anc_8.540 YPL072W
          Length = 482

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 78/388 (20%), Positives = 137/388 (35%), Gaps = 89/388 (22%)

Query: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLKSPEMDTMSRSFYMLFRKMYMN 1164
            TGL N  N C+INS LQ L           S ++ HYL S     + R    L       
Sbjct: 69   TGLINKGNDCFINSSLQGLAG---------SQRFNHYLNS-----VLRCLKFLNENPKQE 114

Query: 1165 GGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQXXXXXXXXXXXXXXSSIESVSND---YSH 1221
            G    +P    ++      DL+ P      +                +    ND   ++ 
Sbjct: 115  GNRYALP--LHQVMAEFIYDLQAPTFLNTVESSDKIIVTMESIFKQKMSRRQNDAQEFTQ 172

Query: 1222 LLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSS-YTYSTF 1280
            LLL      Y +  +   +   N+D          F+G+  ++L+C +CG +S      F
Sbjct: 173  LLLEVLHNEYQELIRLMNFITNNLDIPTYP-----FEGKYCHELTCLKCGRNSEVKMFDF 227

Query: 1281 YVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQN-----AWDCPRCCSPSDYMS 1335
             +L+L LP   +                  + DE++S  N      + C  C        
Sbjct: 228  DILTLNLPAQPS-----------------ISLDELISGSNSDVIEGFSCTVC-------- 262

Query: 1336 YDHKGKRKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKVS--------- 1386
                   K+S         N +   L K    ++      K +++L + ++         
Sbjct: 263  -------KVSAILGGTGTHNPNTRSLIK---SLKEIFPELKINTELDEPLNSFVDSYSHD 312

Query: 1387 -----NGKPATVKSLNFITMPRILVIHLSRFIYD----------LTKKNNIVVSYPLILN 1431
                 N K   VK   F+ +P IL+IHL+R +++          +     +++ + L+++
Sbjct: 313  GVITRNIKSTIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAYDEKLLLEHQLVMD 372

Query: 1432 IVLKNSEVAKFRLYSIVNHFGTLISGHY 1459
             V       ++ L S + H G+   GHY
Sbjct: 373  GVSVMRNNIQYTLSSAIKHSGSHSMGHY 400

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
            Anc_3.270 YBR058C
          Length = 785

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 17/21 (80%)

Query: 1105 TGLRNMSNTCYINSMLQCLFS 1125
             GL N+ N+CY+NS+LQC ++
Sbjct: 326  VGLINLGNSCYLNSILQCFYN 346

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 33.5 bits (75), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 7/93 (7%)

Query: 565 VKPPSTNENSVSQSHLSTTPDAKSVSQSNLSTTPDAKSVSQSNLSTTPDAKSVSQSNLST 624
           V PPS+N +   Q+ + TTP+  S + S++S     K   Q  L   P  KS++   +ST
Sbjct: 473 VNPPSSNASPSRQNRMPTTPNRTSANMSSISRNATLKKEEQP-LPPIPPTKSITSPIIST 531

Query: 625 TPDAKSVSQSNLST------TPDAKSVSQSNLS 651
               +S  QS +++      +P AK V   +LS
Sbjct: 532 PAPPRSTPQSPIASPQEAGASPSAKPVQARSLS 564

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
            YBR058C (REAL)
          Length = 782

 Score = 33.1 bits (74), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 1245 IDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLAL 1287
            I  +G S ++DL +  ME++L C +CG   Y+Y     + + L
Sbjct: 433  IGSSGASNVNDLVRFIMEDRLQCNKCGKVKYSYEPAEAIQIPL 475

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 33.1 bits (74), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 60/161 (37%), Gaps = 37/161 (22%)

Query: 1384 KVSNGKPATVKSLNFI-TMPRILVIHLSRF--IYDLTKKNNIV---------------VS 1425
            K  +G     K   FI  +P++L+I L RF  + + +++  +V               + 
Sbjct: 680  KADSGNDVEAKKQAFIDRLPQVLLIQLKRFEFVNNNSERRELVNYNAYNGRIEKICKWIK 739

Query: 1426 YPLILNI-----------VLKNSEVAKFRLYSIVNHFGTLISG-HYTSLVNKELNHEISH 1473
            Y   L I            L +     ++L  +V H G   SG HYT+ V       +  
Sbjct: 740  YDHDLTIPKEALSSINAKFLFSDNDTSYKLTGVVYHHGLSSSGGHYTADV-------LHQ 792

Query: 1474 GKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYER 1514
             ++KWY  DD  V           G     S   Y+L Y+R
Sbjct: 793  DEEKWYRIDDTTVTEINKEEVVTGGEEGSHSRTAYILIYQR 833

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
            UBP10Ubiquitin-specific protease that deubiquitinates
            ubiquitin-protein moieties; may regulate silencing by
            acting on Sir4p; involved in posttranscriptionally
            regulating Gap1p and possibly other transporters;
            primarily located in the nucleus
          Length = 792

 Score = 33.1 bits (74), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%)

Query: 1251 SPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLSLAL 1287
            S I D+F G ++  ++C+ CG  S T   FY LSL L
Sbjct: 484  SIIYDIFGGLLKQIVTCKSCGSISKTEQPFYDLSLHL 520

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 154,570,679
Number of extensions: 6788804
Number of successful extensions: 47051
Number of sequences better than 10.0: 2031
Number of HSP's gapped: 37892
Number of HSP's successfully gapped: 4787
Length of query: 1517
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1394
Effective length of database: 39,377,481
Effective search space: 54892208514
Effective search space used: 54892208514
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 73 (32.7 bits)