Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_33442.306ON42142117950.0
AGR390C2.306ON37834613750.0
KLTH0G10912g2.306ON43635212271e-167
Kwal_27.114472.306ON43936112171e-165
TDEL0G023602.306ON40235311711e-159
Suva_14.3302.306ON45736811571e-156
ZYRO0A02398g2.306ON41039011481e-155
YNL016W (PUB1)2.306ON45336711521e-155
Smik_14.3132.306ON45136911511e-155
TBLA0B071702.306ON47035311521e-155
NCAS0B061402.306ON44334811471e-155
Skud_14.3122.306ON45937311441e-154
TPHA0C035202.306ON44238811201e-150
SAKL0E07128g2.306ON4011878151e-105
KLLA0E08779g2.306ON4751888091e-103
CAGL0H10604g2.306ON4161887225e-91
NDAI0B034402.306ON4991887219e-90
KNAG0A054402.306ON4421896932e-86
KAFR0J012602.306ON3651846575e-82
Kpol_1043.342.306ON442924581e-51
KNAG0B044405.382ON3973432341e-20
Skud_8.1475.382ON5133632361e-20
NCAS0H018105.382ON4433482324e-20
ZYRO0B11660g8.229ON5871782317e-20
TPHA0B034208.229ON5791662282e-19
Kpol_1032.498.229ON5801722282e-19
KNAG0G018108.229ON5961692282e-19
CAGL0L11792g8.229ON5791742272e-19
YHR086W (NAM8)5.382ON5233662263e-19
NDAI0C061008.229ON5851882264e-19
KLLA0C17600g8.229ON5921662238e-19
Ecym_55628.229ON5801782238e-19
TDEL0A013508.229ON5881762221e-18
YER165W (PAB1)8.229ON5771662212e-18
Smik_5.3378.229ON5771662202e-18
Ecym_80105.382ON6021812202e-18
Skud_5.3048.229ON5771662202e-18
TBLA0F037808.229ON5771602193e-18
SAKL0H17952g8.229ON5891662183e-18
ADR307W5.382ON5661802183e-18
Suva_5.2998.229ON5771662183e-18
NDAI0C018205.382ON4983382164e-18
NCAS0A036808.229ON5751602131e-17
Kwal_55.201545.382ON5221822112e-17
CAGL0H02123g5.382ON5551912095e-17
KAFR0B025008.229ON5821832077e-17
AGR122C8.229ON5851782042e-16
SAKL0G08118g5.382ON5451762023e-16
AAR151W6.104ON4813842014e-16
TDEL0E024505.382ON4721811996e-16
Smik_8.1645.382ON5242051981e-15
Kwal_56.234868.229ON5871721971e-15
Ecym_62014.61ON4482361952e-15
KLLA0F14861g5.382ON5891761962e-15
KLTH0E03520g5.382ON5161761943e-15
TDEL0E006003.49ON5471761944e-15
CAGL0M03795g3.49ON5131731926e-15
TBLA0H017905.382ON6741871911e-14
KAFR0C016803.49ON4791751891e-14
NDAI0D028404.61ON4261771881e-14
KLTH0G14344g8.229ON5871601891e-14
KAFR0D048305.382ON4061651871e-14
TPHA0H015205.382ON4941891829e-14
ZYRO0C02574g3.49ON5431761821e-13
KNAG0A013703.49ON5451751811e-13
TPHA0P013103.49ON5181741792e-13
TBLA0A078103.49ON4721701792e-13
Suva_15.2805.382ON5412191774e-13
CAGL0E03245g4.61ON4251771755e-13
Ecym_20503.49ON5411761766e-13
KNAG0D032204.61ON3991801746e-13
NCAS0C046003.49ON5811741758e-13
ZYRO0A07018g5.382ON5581781741e-12
NCAS0A058904.61ON4151791721e-12
KAFR0F031204.61ON4121841711e-12
AFR107W4.61ON3961841712e-12
Kwal_55.219603.49ON5971701712e-12
KLTH0F18766g3.49ON5881701713e-12
Kpol_1076.113.49ON5261701703e-12
TBLA0C043604.61ON4031791693e-12
Skud_6.1071.357ON611721703e-12
SAKL0A07370g6.104ON4902311694e-12
Smik_15.303.49ON5361741685e-12
Skud_15.303.49ON5391741686e-12
YOL123W (HRP1)3.49ON5341741676e-12
TBLA0B085903.49ON6231761677e-12
KLTH0D03916g4.61ON5051781667e-12
Suva_15.373.49ON5511741678e-12
SAKL0C12672g3.49ON5512231678e-12
Kpol_224.18.797ON2171871599e-12
Skud_7.4834.61ON3931801641e-11
NDAI0G039703.49ON6071691661e-11
KAFR0G023206.104ON6202391661e-11
KLLA0C12925g3.49ON5701761651e-11
CAGL0E01947g3.49ON4521741622e-11
TDEL0F029104.61ON4361801623e-11
Ecym_30826.104ON5862311605e-11
NDAI0A061703.49ON5521741605e-11
Suva_7.4504.61ON3911811595e-11
YGR159C (NSR1)4.61ON4141781595e-11
NCAS0A100103.49ON5061731596e-11
YBR212W (NGR1)6.104ON6721471589e-11
Smik_6.2644.61ON3951801571e-10
SAKL0D09680g1.357ON672931581e-10
TPHA0K019104.61ON4161791561e-10
Skud_2.3456.104ON6641471571e-10
KLLA0C11495g4.61ON4451771552e-10
Kwal_14.18516.104ON5351681552e-10
Suva_6.951.357ON613721552e-10
Suva_4.4706.104ON6631471552e-10
Smik_2.3556.104ON7361471552e-10
SAKL0H23562g4.61ON4212361524e-10
KLTH0E14036g8.797ON2091711457e-10
TDEL0G036706.104ON6171481518e-10
TBLA0A099206.104ON5941471518e-10
Kpol_530.466.104ON5871411509e-10
ADL160W3.49ON5261831472e-09
ZYRO0G07326g4.61ON4681781472e-09
AEL016C1.357ON678931472e-09
NCAS0B072401.357ON610721463e-09
Ecym_27461.357ON681931463e-09
ZYRO0C05060g6.104ON7161471454e-09
CAGL0K06655g6.104ON8021461455e-09
Ecym_74208.797ON2041681385e-09
Kpol_1026.214.61ON437821435e-09
KLLA0C05522g6.104ON5402271435e-09
TBLA0D049401.357ON665701445e-09
KLTH0H06842g6.104ON5471011436e-09
YFR023W (PES4)1.357ON611721411e-08
Kwal_0.3701.357ON560881411e-08
NDAI0B045701.357ON464951373e-08
NDAI0F01720singletonON4743151373e-08
TPHA0F028206.104ON6081471364e-08
TDEL0B010108.797ON2101741306e-08
Kpol_1008.231.357ON660721341e-07
Smik_7.3341.357ON611721312e-07
Kpol_1075.1a8.229ON264851282e-07
NDAI0E030708.491ON701831312e-07
ZYRO0G00814g1.357ON654801302e-07
KAFR0B044205.76ON6251941303e-07
Suva_16.2718.491ON686831303e-07
Kwal_26.7493singletonOFF2221381253e-07
ABL059W8.797ON2041751243e-07
Kpol_1018.1221.357ON6341811294e-07
ZYRO0G04862g2.80ON376821256e-07
NCAS0C023808.491ON7021021277e-07
Smik_16.1928.491ON690831277e-07
KLLA0C14388g8.797ON2031771217e-07
NDAI0G001801.408ON4642351267e-07
KAFR0H014508.491ON690831268e-07
YPL043W (NOP4)8.491ON685831269e-07
NCAS0C048301.408ON3771671231e-06
YHR015W (MIP6)1.357ON659781241e-06
Skud_16.2388.491ON680831241e-06
KLTH0E11418g8.491ON693901242e-06
KNAG0C020301.357ON365671222e-06
CAGL0I08943g1.357ON602721223e-06
TPHA0A022201.357ON713721223e-06
SAKL0D08558g1.408ON4641731213e-06
AEL217W5.76ON8342141213e-06
Suva_8.3708.797ON2131801164e-06
AGL250W8.491ON729831214e-06
Skud_8.671.357ON652721204e-06
Kwal_27.123378.797ON2091741164e-06
KNAG0A022108.491ON682881205e-06
KAFR0C044101.357ON589801196e-06
SAKL0B06270g8.797ON2091751156e-06
Skud_15.4878.797ON2131801147e-06
CAGL0I09900g8.797ON2111721147e-06
KLLA0D13772g7.145ON3451161169e-06
TDEL0H032407.159ON1671141111e-05
KAFR0A074902.80ON381821151e-05
KNAG0I015901.357ON590501161e-05
TDEL0D022501.357ON622831161e-05
Suva_15.1981.357ON662721161e-05
CAGL0J11154g2.80ON380821142e-05
NDAI0F033202.80ON399821142e-05
TPHA0B043001.102ON334751132e-05
YGR250C5.76ON7812231152e-05
NDAI0D048104.33ON626911142e-05
NCAS0G042801.408ON4353561132e-05
TBLA0D048501.408ON4293661132e-05
TBLA0A033005.382ON362721123e-05
KNAG0G032608.797ON2011181093e-05
TDEL0B014608.491ON692881133e-05
TBLA0B080105.76ON939831133e-05
KLLA0A08338g1.357ON7661501133e-05
ZYRO0F08294g8.491ON714951133e-05
NCAS0G019502.80ON404821123e-05
Smik_8.801.357ON670721124e-05
YOR319W (HSH49)8.797ON2131801084e-05
Suva_7.5465.76ON7792201124e-05
Ecym_25418.491ON675831124e-05
Kwal_23.58647.250ON2781091094e-05
TDEL0F006802.80ON388821114e-05
ZYRO0F16214g1.102ON330751104e-05
Suva_14.1662.80ON403821105e-05
YNL175C (NOP13)2.80ON403821105e-05
YIR005W (IST3)7.159ON1481181055e-05
NDAI0G059701.357ON6111611115e-05
Smik_14.1552.80ON403821105e-05
Skud_14.1592.80ON400821106e-05
Kpol_1062.75.76ON7601161116e-05
TPHA0F023102.80ON400811106e-05
Kwal_56.247095.76ON828831106e-05
TBLA0B008102.80ON389781097e-05
KLLA0D05016g1.408ON4433441097e-05
SAKL0H11330g8.491ON697831108e-05
Kpol_1041.42.80ON384821098e-05
SAKL0A05280g6.183ON582831098e-05
TBLA0J018307.159ON140861038e-05
KLTH0C04268g8.822ON4501901098e-05
Smik_15.5008.797ON2131801068e-05
TDEL0A039905.536ON278901078e-05
Kwal_33.144632.80ON393821088e-05
SAKL0C03234g1.102ON340751089e-05
SAKL0E12738g2.80ON396821089e-05
Kwal_27.118328.491ON686831091e-04
ZYRO0G07216g4.66ON271861061e-04
ZYRO0F12716g8.797ON2101931051e-04
KLLA0C08019g7.250ON301801061e-04
ABL134C2.80ON375781071e-04
KAFR0H031101.408ON441761072e-04
CAGL0L12672g8.491ON682831072e-04
Kpol_1023.955.536ON274951052e-04
ADL063W7.250ON320901052e-04
Kpol_1002.696.183ON590791062e-04
SAKL0H23298g4.66ON2571181042e-04
KLTH0B06886g2.80ON396821052e-04
Kwal_55.209727.159ON135106992e-04
KAFR0F027704.33ON743871062e-04
Kpol_487.61.408ON3761811052e-04
Skud_7.5835.76ON7792241062e-04
CAGL0H04675g5.536ON274861032e-04
KAFR0C054305.536ON274811032e-04
KLTH0B02992gna 1ON204751023e-04
KLTH0H12958g1.357ON639731053e-04
KLTH0F13442g7.159ON134108983e-04
TPHA0J022106.183ON593831053e-04
KLLA0D13420g7.159ON1661111003e-04
Ecym_11211.102ON324751033e-04
KLLA0D11792g8.491ON685831053e-04
NDAI0E004708.797ON2581791023e-04
CAGL0M12573g7.250ON299901033e-04
TPHA0C017408.491ON697831043e-04
KNAG0B036505.536ON279891014e-04
NDAI0G041901.408ON3591741025e-04
NCAS0A028804.33ON588931035e-04
Kpol_1026.164.66ON277801015e-04
KLTH0H00792g5.76ON8351071035e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3344
         (421 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...   696   0.0  
AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}...   534   0.0  
KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some s...   477   e-167
Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {...   473   e-165
TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...   455   e-159
Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...   450   e-156
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...   446   e-155
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...   448   e-155
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...   447   e-155
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...   448   e-155
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...   446   e-155
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...   445   e-154
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...   436   e-150
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...   318   e-105
KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...   316   e-103
CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]...   282   5e-91
NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {O...   282   9e-90
KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.3...   271   2e-86
KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {...   257   5e-82
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...   181   1e-51
KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {O...    95   1e-20
Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W ...    96   1e-20
NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382     94   4e-20
ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly...    94   7e-20
TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {O...    92   2e-19
Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON} (1110...    92   2e-19
KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.2...    92   2e-19
CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} hig...    92   2e-19
YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA bi...    92   3e-19
NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON}             92   4e-19
KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} simi...    91   8e-19
Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar...    91   8e-19
TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {O...    90   1e-18
YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A...    90   2e-18
Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W ...    89   2e-18
Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to ...    89   2e-18
Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W ...    89   2e-18
TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.2...    89   3e-18
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    89   3e-18
ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic ...    89   3e-18
Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W ...    89   3e-18
NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {O...    88   4e-18
NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {O...    87   1e-17
Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {...    86   2e-17
CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {...    85   5e-17
KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.2...    84   7e-17
AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON} S...    83   2e-16
SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {...    82   3e-16
AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic ho...    82   4e-16
TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {O...    81   6e-16
Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W ...    81   1e-15
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    80   1e-15
Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar t...    80   2e-15
KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some...    80   2e-15
KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {...    79   3e-15
TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.4...    79   4e-15
CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa] ...    79   6e-15
TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {O...    78   1e-14
KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {O...    77   1e-14
NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {O...    77   1e-14
KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} high...    77   1e-14
KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.3...    77   1e-14
TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.3...    75   9e-14
ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {...    75   1e-13
KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49 ...    74   1e-13
TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {...    74   2e-13
TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3...    74   2e-13
Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086...    73   4e-13
CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {...    72   5e-13
Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to ...    72   6e-13
KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.6...    72   6e-13
NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49      72   8e-13
ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {...    72   1e-12
NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON}             71   1e-12
KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.6...    70   1e-12
AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic ho...    70   2e-12
Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]...    70   2e-12
KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]...    70   3e-12
Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {O...    70   3e-12
TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa] ...    70   3e-12
Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W ...    70   3e-12
SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {...    70   4e-12
Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W (...    69   5e-12
Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W (...    69   6e-12
YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit...    69   6e-12
TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa] ...    69   7e-12
KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some s...    69   7e-12
Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W (...    69   8e-12
SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]...    69   8e-12
Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON} comp...    66   9e-12
Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON...    68   1e-11
NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.4...    69   1e-11
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    69   1e-11
KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weak...    68   1e-11
CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some s...    67   2e-11
TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {O...    67   3e-11
Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}...    66   5e-11
NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa] ...    66   5e-11
Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON...    66   5e-11
YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}  ...    66   5e-11
NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa] ...    66   6e-11
YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA bi...    65   9e-11
Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON...    65   1e-10
SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} simila...    65   1e-10
TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {...    65   1e-10
Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W ...    65   1e-10
KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {...    64   2e-10
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    64   2e-10
Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W (...    64   2e-10
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    64   2e-10
Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W ...    64   2e-10
SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]...    63   4e-10
KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa] ...    60   7e-10
TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {O...    63   8e-10
TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON} Anc_6...    63   8e-10
Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {O...    62   9e-10
ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic ho...    61   2e-09
ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {...    61   2e-09
AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON} S...    61   2e-09
NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON} Anc_1...    61   3e-09
Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar...    61   3e-09
ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {...    60   4e-09
CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} simil...    60   5e-09
Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON} ...    58   5e-09
Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {O...    60   5e-09
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    60   5e-09
TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON} Anc_1...    60   5e-09
KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {...    60   6e-09
YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A...    59   1e-08
Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W (P...    59   1e-08
NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON} Anc_1...    57   3e-08
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    57   3e-08
TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.1...    57   4e-08
TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON...    55   6e-08
Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON} (47628....    56   1e-07
Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W ...    55   2e-07
Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 ...    54   2e-07
NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.4...    55   2e-07
ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON...    55   2e-07
KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {O...    55   3e-07
Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043...    55   3e-07
Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C...    53   3e-07
ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic hom...    52   3e-07
Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON} (325...    54   4e-07
ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {...    53   6e-07
NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.4...    54   7e-07
Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043...    54   7e-07
KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa] ...    51   7e-07
NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}...    53   7e-07
KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.4...    53   8e-07
YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}  NOP4Nucle...    53   9e-07
NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408     52   1e-06
YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putati...    52   1e-06
Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043...    52   1e-06
KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]...    52   2e-06
KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.3...    52   2e-06
CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} simila...    52   3e-06
TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {O...    52   3e-06
SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} simila...    51   3e-06
AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic ho...    51   3e-06
Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W (...    49   4e-06
AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic ho...    51   4e-06
Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W (...    51   4e-06
Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa] ...    49   4e-06
KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.4...    51   5e-06
KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {O...    50   6e-06
SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {O...    49   6e-06
Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W...    49   7e-06
CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar...    49   7e-06
KLLA0D13772g Chr4 (1185663..1186700) [1038 bp, 345 aa] {ON} some...    49   9e-06
TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON...    47   1e-05
KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2...    49   1e-05
KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {O...    49   1e-05
TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {O...    49   1e-05
Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015...    49   1e-05
CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON} sim...    49   2e-05
NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80      49   2e-05
TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON} Anc_1...    48   2e-05
YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON} P...    49   2e-05
NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa] ...    49   2e-05
NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408     48   2e-05
TBLA0D04850 Chr4 (1191350..1192639) [1290 bp, 429 aa] {ON} Anc_1...    48   2e-05
TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.3...    48   3e-05
KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.79...    47   3e-05
TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.4...    48   3e-05
TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5...    48   3e-05
KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} simila...    48   3e-05
ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {...    48   3e-05
NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {O...    48   3e-05
Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W (...    48   4e-05
YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-sn...    46   4e-05
Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON...    48   4e-05
Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {O...    48   4e-05
Kwal_23.5864 s23 (1347244..1348080) [837 bp, 278 aa] {ON} YIL061...    47   4e-05
TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {O...    47   4e-05
ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON} conse...    47   4e-05
Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {...    47   5e-05
YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON} ...    47   5e-05
YIR005W Chr9 (364889..365335) [447 bp, 148 aa] {ON}  IST3Compone...    45   5e-05
NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa] ...    47   5e-05
Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {...    47   5e-05
Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {...    47   6e-05
Kpol_1062.7 s1062 (14539..16821) [2283 bp, 760 aa] {ON} (14539.....    47   6e-05
TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.8...    47   6e-05
Kwal_56.24709 s56 complement(1113983..1116469) [2487 bp, 828 aa]...    47   6e-05
TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {O...    47   7e-05
KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [133...    47   7e-05
SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} simila...    47   8e-05
Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON} (12746.....    47   8e-05
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...    47   8e-05
TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {O...    44   8e-05
KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} simila...    47   8e-05
Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W...    45   8e-05
TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON...    46   8e-05
Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {...    46   8e-05
SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {...    46   9e-05
SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} simi...    46   9e-05
Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {...    47   1e-04
ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar...    45   1e-04
ZYRO0F12716g Chr6 (1035111..1035743) [633 bp, 210 aa] {ON} simil...    45   1e-04
KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {O...    45   1e-04
ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON} S...    46   1e-04
KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326...    46   2e-04
CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa...    46   2e-04
Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON} (22131...    45   2e-04
ADL063W Chr4 (569852..569854,569912..570871) [963 bp, 320 aa] {O...    45   2e-04
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...    45   2e-04
SAKL0H23298g Chr8 complement(2021024..2021797) [774 bp, 257 aa] ...    45   2e-04
KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} simila...    45   2e-04
Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W...    43   2e-04
KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {O...    45   2e-04
Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON} (35743..36...    45   2e-04
Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON...    45   2e-04
CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {O...    44   2e-04
KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {...    44   2e-04
KLTH0B02992g Chr2 complement(234560..235174) [615 bp, 204 aa] {O...    44   3e-04
KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} simi...    45   3e-04
KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} simil...    42   3e-04
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....    45   3e-04
KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa] ...    43   3e-04
Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to...    44   3e-04
KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} simi...    45   3e-04
NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON} ...    44   3e-04
CAGL0M12573g Chr13 (1247678..1248577) [900 bp, 299 aa] {ON} simi...    44   3e-04
TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.4...    45   3e-04
KNAG0B03650 Chr2 (702368..703207) [840 bp, 279 aa] {ON} Anc_5.53...    44   4e-04
NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON} Anc_1...    44   5e-04
NCAS0A02880 Chr1 complement(553819..555585) [1767 bp, 588 aa] {O...    44   5e-04
Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON} (34514.....    44   5e-04
KLTH0H00792g Chr8 (88079..90586) [2508 bp, 835 aa] {ON} some sim...    44   5e-04
CAGL0L03806g Chr12 (440385..441152) [768 bp, 255 aa] {ON} simila...    43   5e-04
NCAS0A05830 Chr1 complement(1146244..1147188) [945 bp, 314 aa] {...    44   6e-04
AFR649W Chr6 (1619582..1620514) [933 bp, 310 aa] {ON} NOHBY659; ...    44   6e-04
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...    44   6e-04
ZYRO0D12782g Chr4 complement(1077736..1078557) [822 bp, 273 aa] ...    43   6e-04
Ecym_5574 Chr5 complement(1175694..1178309) [2616 bp, 871 aa] {O...    44   7e-04
Smik_16.57 Chr16 (103313..105661) [2349 bp, 782 aa] {ON} YGR250C...    44   7e-04
AAL018W Chr1 (309542..310555) [1014 bp, 337 aa] {ON} Syntenic ho...    43   7e-04
KNAG0I02030 Chr9 (396201..396890) [690 bp, 229 aa] {ON} Anc_2.16...    43   7e-04
SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some s...    44   7e-04
TDEL0C05990 Chr3 (1079338..1080351) [1014 bp, 337 aa] {ON} Anc_1...    43   7e-04
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183     44   9e-04
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...    44   9e-04
Ecym_4446 Chr4 (912645..915212) [2568 bp, 855 aa] {ON} similar t...    44   9e-04
TDEL0B06060 Chr2 complement(1071469..1072506) [1038 bp, 345 aa] ...    43   0.001
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...    43   0.001
KLLA0A05346g Chr1 (485886..488510) [2625 bp, 874 aa] {ON} some s...    44   0.001
Suva_3.8 Chr3 complement(12157..13458) [1302 bp, 433 aa] {ON} YC...    43   0.001
KLTH0D02640g Chr4 complement(261313..262701) [1389 bp, 462 aa] {...    43   0.001
CAGL0B04807g Chr2 (460721..461980) [1260 bp, 419 aa] {ON} simila...    43   0.001
KNAG0A07610 Chr1 complement(1194108..1196711) [2604 bp, 867 aa] ...    43   0.001
ZYRO0G04004g Chr7 complement(327232..327735) [504 bp, 167 aa] {O...    41   0.001
KAFR0L00970 Chr12 (181689..182546) [858 bp, 285 aa] {ON} Anc_7.2...    42   0.001
TDEL0F01220 Chr6 complement(216951..217589) [639 bp, 212 aa] {ON...    42   0.001
NDAI0D02800 Chr4 (649804..650751) [948 bp, 315 aa] {ON} Anc_4.66       42   0.001
YCL011C Chr3 complement(102075..103358) [1284 bp, 427 aa] {ON}  ...    43   0.001
SAKL0G12474g Chr7 complement(1060462..1061016) [555 bp, 184 aa] ...    42   0.001
Skud_9.178 Chr9 complement(326982..327734) [753 bp, 250 aa] {ON}...    42   0.001
SAKL0F04400g Chr6 complement(355542..356108) [567 bp, 188 aa] {O...    41   0.001
AFL224W Chr6 (18862..19482) [621 bp, 206 aa] {ON} Syntenic homol...    42   0.001
KAFR0K01050 Chr11 complement(216574..217038) [465 bp, 154 aa] {O...    41   0.002
TDEL0F02850 Chr6 (516483..517322) [840 bp, 279 aa] {ON} Anc_4.66...    42   0.002
TBLA0A01570 Chr1 (364733..366961) [2229 bp, 742 aa] {ON} Anc_8.4...    43   0.002
NCAS0A13220 Chr1 (2600885..2601400) [516 bp, 171 aa] {ON} Anc_7....    41   0.002
TPHA0K00500 Chr11 (99226..100041) [816 bp, 271 aa] {ON} Anc_5.53...    42   0.002
CAGL0J01914g Chr10 complement(191912..192421) [510 bp, 169 aa] {...    41   0.002
TPHA0D03960 Chr4 complement(829035..831653) [2619 bp, 872 aa] {O...    42   0.002
Smik_4.703 Chr4 complement(1245222..1246046) [825 bp, 274 aa] {O...    42   0.002
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...    42   0.002
ADR017W Chr4 (734484..735005) [522 bp, 173 aa] {ON} Syntenic hom...    40   0.002
YDR429C Chr4 complement(1324477..1325301) [825 bp, 274 aa] {ON} ...    42   0.002
Skud_4.704 Chr4 complement(1244854..1245678) [825 bp, 274 aa] {O...    42   0.002
NCAS0A08980 Chr1 (1778830..1780647) [1818 bp, 605 aa] {ON} Anc_1...    42   0.002
KNAG0F02200 Chr6 (422342..422980) [639 bp, 212 aa] {ON} Anc_6.17...    41   0.002
KLLA0E11045g Chr5 (968674..969972) [1299 bp, 432 aa] {ON} simila...    42   0.002
Kwal_33.15208 s33 (1012397..1012957) [561 bp, 186 aa] {ON} YIR00...    40   0.002
TPHA0O00720 Chr15 complement(136275..137711) [1437 bp, 478 aa] {...    42   0.003
Ecym_7289 Chr7 complement(608012..610132) [2121 bp, 706 aa] {ON}...    42   0.003
KLTH0A04554g Chr1 (380152..380988) [837 bp, 278 aa] {ON} weakly ...    41   0.003
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...    42   0.003
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...    42   0.003
KLLA0D08206g Chr4 (700152..701327) [1176 bp, 391 aa] {ON} simila...    42   0.003
KLTH0F02838g Chr6 complement(245748..246740) [993 bp, 330 aa] {O...    42   0.003
Kpol_1029.3 s1029 complement(3577..4251) [675 bp, 224 aa] {ON} c...    41   0.003
AGL038C Chr7 complement(639306..641444) [2139 bp, 712 aa] {ON} S...    42   0.003
KAFR0A00980 Chr1 complement(182578..184506) [1929 bp, 642 aa] {O...    42   0.003
Suva_9.214 Chr9 (351853..352293) [441 bp, 146 aa] {ON} YIR005W (...    40   0.003
Smik_16.355 Chr16 complement(627408..630068) [2661 bp, 886 aa] {...    42   0.003
SAKL0F08866g Chr6 (678049..678054,678125..679027) [909 bp, 302 a...    41   0.003
YGL044C Chr7 complement(416146..417036) [891 bp, 296 aa] {ON}  R...    41   0.003
Skud_16.399 Chr16 complement(714087..716726) [2640 bp, 879 aa] {...    42   0.003
KAFR0F03150 Chr6 complement(624522..625349) [828 bp, 275 aa] {ON...    41   0.003
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...    42   0.003
TDEL0H01940 Chr8 complement(334207..335163) [957 bp, 318 aa] {ON...    41   0.003
Ecym_4324 Chr4 complement(697762..698754,698828..698830) [996 bp...    41   0.004
Smik_9.126 Chr9 complement(219413..220315) [903 bp, 300 aa] {ON}...    41   0.004
Suva_2.605 Chr2 complement(1077179..1078003) [825 bp, 274 aa] {O...    41   0.004
Smik_7.239 Chr7 complement(407397..408296) [900 bp, 299 aa] {ON}...    41   0.004
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...    41   0.004
TPHA0K01870 Chr11 (391768..392637) [870 bp, 289 aa] {ON} Anc_4.6...    41   0.004
Skud_7.240 Chr7 complement(418142..419098) [957 bp, 318 aa] {ON}...    41   0.004
ADR189W Chr4 (1034091..1034900) [810 bp, 269 aa] {ON} Syntenic h...    41   0.004
NDAI0A02810 Chr1 complement(633738..634247) [510 bp, 169 aa] {ON...    40   0.004
KLLA0F23650g Chr6 (2210563..2211501) [939 bp, 312 aa] {ON} simil...    41   0.004
TDEL0F01640 Chr6 complement(302376..304346) [1971 bp, 656 aa] {O...    41   0.004
KAFR0B04540 Chr2 (945164..945826) [663 bp, 220 aa] {ON} Anc_2.16...    40   0.004
SAKL0E10604g Chr5 (884025..884690) [666 bp, 221 aa] {ON} similar...    40   0.005
ADR035C Chr4 complement(768390..770906) [2517 bp, 838 aa] {ON} S...    41   0.005
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...    41   0.005
Smik_3.71 Chr3 complement(100547..101833) [1287 bp, 428 aa] {ON}...    41   0.005
KLTH0E06226g Chr5 (568785..571112) [2328 bp, 775 aa] {ON} weakly...    41   0.005
YIR001C Chr9 complement(356143..356895) [753 bp, 250 aa] {ON}  S...    40   0.006
Suva_9.210 Chr9 complement(343096..343848) [753 bp, 250 aa] {ON}...    40   0.006
NCAS0E03880 Chr5 complement(761175..763328) [2154 bp, 717 aa] {O...    41   0.007
Suva_14.344 Chr14 (602901..602930,603310..604644) [1365 bp, 454 ...    40   0.007
KLTH0F11968g Chr6 (1008620..1011259) [2640 bp, 879 aa] {ON} simi...    41   0.007
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...    40   0.007
Suva_16.440 Chr16 complement(757046..759706) [2661 bp, 886 aa] {...    40   0.008
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...    40   0.008
Smik_8.17 Chr8 (40206..42356) [2151 bp, 716 aa] {ON} YHL024W (REAL)    40   0.008
Smik_9.200 Chr9 complement(332149..332898) [750 bp, 249 aa] {ON}...    40   0.008
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    40   0.009
KNAG0F01320 Chr6 complement(237828..239075) [1248 bp, 415 aa] {O...    40   0.009
Smik_9.204 Chr9 (340893..341342) [450 bp, 149 aa] {ON} YIR005W (...    39   0.009
Suva_8.27 Chr8 (58726..60849) [2124 bp, 707 aa] {ON} YHL024W (REAL)    40   0.009
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...    40   0.009
ZYRO0E04928g Chr5 complement(374326..375537,375710..375727) [123...    40   0.009
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...    40   0.009
NDAI0E04860 Chr5 (1103131..1104102) [972 bp, 323 aa] {ON} Anc_7....    40   0.010
YPR112C Chr16 complement(749256..751919) [2664 bp, 887 aa] {ON} ...    40   0.010
KNAG0E03510 Chr5 complement(701816..702334) [519 bp, 172 aa] {ON...    39   0.010
NDAI0A04750 Chr1 (1085815..1088346) [2532 bp, 843 aa] {ON} Anc_3...    40   0.010
ZYRO0B00924g Chr2 complement(71856..74432) [2577 bp, 858 aa] {ON...    40   0.010
Smik_14.324 Chr14 (581702..582988) [1287 bp, 428 aa] {ON} YNL004...    40   0.010
KNAG0L01580 Chr12 (280914..281831) [918 bp, 305 aa] {ON} Anc_7.2...    40   0.011
Kpol_365.5 s365 (9615..10148,10369..11028) [1194 bp, 397 aa] {ON...    40   0.011
TPHA0O01260 Chr15 (250335..252413) [2079 bp, 692 aa] {ON} Anc_1....    40   0.011
KLTH0D04158g Chr4 (394755..395537) [783 bp, 260 aa] {ON} similar...    39   0.011
Skud_8.20 Chr8 (44743..46833) [2091 bp, 696 aa] {ON} YHL024W (REAL)    40   0.012
Kpol_150.1 s150 (1938..2354) [417 bp, 138 aa] {ON} (1938..2354) ...    38   0.012
CAGL0L05038g Chr12 (571776..573317) [1542 bp, 513 aa] {ON} weakl...    40   0.012
CAGL0D06182g Chr4 (581992..582834) [843 bp, 280 aa] {ON} similar...    39   0.012
NCAS0C00510 Chr3 (83308..84645) [1338 bp, 445 aa] {ON} Anc_8.822...    40   0.013
CAGL0B04169g Chr2 complement(404713..407298) [2586 bp, 861 aa] {...    40   0.013
TPHA0B02950 Chr2 complement(672465..673121) [657 bp, 218 aa] {ON...    39   0.013
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    39   0.014
YHL024W Chr8 (56649..58790) [2142 bp, 713 aa] {ON}  RIM4Putative...    40   0.014
Ecym_4071 Chr4 complement(153279..154091) [813 bp, 270 aa] {ON} ...    39   0.014
ZYRO0G13706g Chr7 complement(1097882..1099144) [1263 bp, 420 aa]...    39   0.015
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...    40   0.015
TDEL0H03080 Chr8 complement(508090..508917) [828 bp, 275 aa] {ON...    39   0.015
Kwal_27.10364 s27 (303432..304763) [1332 bp, 443 aa] {ON} YMR268...    39   0.016
CAGL0H03861g Chr8 complement(361189..362520) [1332 bp, 443 aa] {...    39   0.016
Kpol_2000.44 s2000 (86199..87215) [1017 bp, 338 aa] {ON} (86199....    39   0.016
Skud_3.48 Chr3 complement(80985..82274) [1290 bp, 429 aa] {ON} Y...    39   0.017
KNAG0D03250 Chr4 complement(580147..580956) [810 bp, 269 aa] {ON...    39   0.017
Kwal_0.250 s0 complement(122111..122758) [648 bp, 216 aa] {OFF} ...    39   0.017
NCAS0H02590 Chr8 complement(514898..515710) [813 bp, 270 aa] {ON...    39   0.017
Kwal_YGOB_0.250 s0 complement(122081..122758) [678 bp, 226 aa] {...    39   0.018
Skud_14.323 Chr14 (589699..589728,590087..591421) [1365 bp, 454 ...    39   0.019
Kwal_27.11096 s27 complement(635969..636574) [606 bp, 201 aa] {O...    38   0.020
ZYRO0D09482g Chr4 complement(808223..809092) [870 bp, 289 aa] {O...    39   0.022
SAKL0H25366g Chr8 complement(2212946..2214826) [1881 bp, 626 aa]...    39   0.022
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...    39   0.023
TPHA0C03940 Chr3 complement(844251..844688) [438 bp, 145 aa] {ON...    37   0.024
TBLA0C02300 Chr3 (543570..546176) [2607 bp, 868 aa] {ON} Anc_3.4...    39   0.027
Kwal_23.3985 s23 (510995..513625) [2631 bp, 876 aa] {ON} YPR112C...    39   0.027
CAGL0F08217g Chr6 complement(814508..816544) [2037 bp, 678 aa] {...    39   0.028
TBLA0C04320 Chr3 (1040065..1040874) [810 bp, 269 aa] {ON} Anc_4....    38   0.028
TDEL0G01000 Chr7 (206991..209408) [2418 bp, 805 aa] {ON} Anc_5.7...    39   0.029
KLTH0D09262g Chr4 (769384..770055) [672 bp, 223 aa] {ON} similar...    38   0.029
NDAI0C01030 Chr3 (199929..200780) [852 bp, 283 aa] {ON} Anc_5.53...    38   0.030
Ecym_5419 Chr5 (864517..865164) [648 bp, 215 aa] {ON} similar to...    38   0.030
KLTH0H05214g Chr8 (465108..465710) [603 bp, 200 aa] {ON} highly ...    37   0.033
Skud_9.182 Chr9 (335662..336111) [450 bp, 149 aa] {ON} YIR005W (...    37   0.033
TBLA0G00910 Chr7 (221951..222784) [834 bp, 277 aa] {ON} Anc_5.53...    38   0.034
Skud_13.439 Chr13 complement(776753..778090) [1338 bp, 445 aa] {...    38   0.034
Kwal_26.8458 s26 (793431..794090) [660 bp, 219 aa] {ON} YNL110C ...    37   0.034
Suva_7.231 Chr7 complement(407919..408848) [930 bp, 309 aa] {ON}...    38   0.035
NCAS0A11540 Chr1 complement(2283352..2285961) [2610 bp, 869 aa] ...    39   0.035
TPHA0H02600 Chr8 (607962..609338) [1377 bp, 458 aa] {ON} Anc_7.9...    38   0.036
Kwal_26.7522 s26 (402305..403093) [789 bp, 262 aa] {ON} YGL044C ...    38   0.037
YNL004W Chr14 (622915..622944,623287..624621) [1365 bp, 454 aa] ...    38   0.040
KNAG0L00570 Chr12 complement(86604..87899) [1296 bp, 431 aa] {ON...    38   0.040
YIL061C Chr9 complement(244657..245559) [903 bp, 300 aa] {ON}  S...    38   0.042
TBLA0F03500 Chr6 complement(861480..863774) [2295 bp, 764 aa] {O...    38   0.042
KLLA0F09383g Chr6 (865710..866486) [777 bp, 258 aa] {ON} similar...    37   0.046
KLLA0F18216g Chr6 (1677731..1679857) [2127 bp, 708 aa] {ON} some...    38   0.047
KAFR0B03680 Chr2 (767040..768365) [1326 bp, 441 aa] {ON} Anc_8.8...    38   0.048
Kwal_55.20903 s55 complement(604836..605279) [444 bp, 147 aa] {O...    36   0.049
ZYRO0C12452g Chr3 complement(983386..985986) [2601 bp, 866 aa] {...    38   0.049
ZYRO0C08382g Chr3 (639267..640181) [915 bp, 304 aa] {ON} similar...    37   0.050
NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797      37   0.050
KLLA0D14949g Chr4 complement(1259860..1262496) [2637 bp, 878 aa]...    38   0.050
TBLA0A08550 Chr1 (2112176..2114533) [2358 bp, 785 aa] {ON} Anc_4...    38   0.052
Skud_9.111 Chr9 complement(215540..216442) [903 bp, 300 aa] {ON}...    37   0.053
TPHA0J00920 Chr10 (217471..218400) [930 bp, 309 aa] {ON} Anc_7.2...    37   0.054
Kpol_259.1 s259 (2949..3947) [999 bp, 332 aa] {ON} (2949..3947) ...    37   0.057
Suva_13.452 Chr13 complement(782217..783551) [1335 bp, 444 aa] {...    37   0.060
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    37   0.060
ADL126C Chr4 complement(469989..471389) [1401 bp, 466 aa] {ON} S...    37   0.062
NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167      37   0.063
TDEL0F03140 Chr6 complement(574041..576608) [2568 bp, 855 aa] {O...    37   0.067
KLTH0G03960g Chr7 complement(314167..315009) [843 bp, 280 aa] {O...    37   0.070
Kpol_1066.35 s1066 complement(57266..58168) [903 bp, 300 aa] {ON...    37   0.074
TBLA0C05600 Chr3 complement(1357001..1357648) [648 bp, 215 aa] {...    37   0.075
SAKL0F06160g Chr6 complement(462236..464878) [2643 bp, 880 aa] {...    37   0.085
KAFR0A05510 Chr1 (1098387..1100939) [2553 bp, 850 aa] {ON} Anc_3...    37   0.087
TPHA0D02400 Chr4 complement(496366..497247) [882 bp, 293 aa] {ON...    37   0.087
Kwal_26.7179 s26 complement(251330..252700) [1371 bp, 456 aa] {O...    37   0.095
NDAI0A08510 Chr1 (1960682..1962106) [1425 bp, 474 aa] {ON} Anc_7...    37   0.096
TPHA0K00690 Chr11 complement(135928..144285) [8358 bp, 2785 aa] ...    37   0.098
ACR274W Chr3 (854587..855867) [1281 bp, 426 aa] {ON} Syntenic ho...    37   0.10 
SAKL0H05192g Chr8 (466582..466661,466747..467632) [966 bp, 321 a...    37   0.10 
Ecym_6416 Chr6 (811576..812748) [1173 bp, 390 aa] {ON} similar t...    37   0.11 
KNAG0I03040 Chr9 complement(605783..607876) [2094 bp, 697 aa] {O...    37   0.11 
KNAG0I01230 Chr9 (230872..232332) [1461 bp, 486 aa] {ON} Anc_1.4...    37   0.11 
Suva_9.140 Chr9 complement(235080..235988) [909 bp, 302 aa] {ON}...    36   0.11 
KLLA0B00847g Chr2 complement(65983..66792) [810 bp, 269 aa] {ON}...    36   0.11 
TPHA0H01140 Chr8 complement(251773..254277) [2505 bp, 834 aa] {O...    37   0.12 
TBLA0A01040 Chr1 complement(235996..236433) [438 bp, 145 aa] {ON...    35   0.13 
ZYRO0B09790g Chr2 (765258..765854) [597 bp, 198 aa] {ON} similar...    35   0.13 
Kpol_478.5 s478 (22217..24601) [2385 bp, 794 aa] {ON} (22217..24...    37   0.13 
SAKL0D01958g Chr4 (151411..154248) [2838 bp, 945 aa] {ON} some s...    37   0.13 
AGR010C Chr7 complement(736603..737403) [801 bp, 266 aa] {ON} Sy...    36   0.15 
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...    36   0.17 
Kpol_1040.23 s1040 complement(65741..67144) [1404 bp, 467 aa] {O...    36   0.18 
CAGL0J02200g Chr10 complement(217645..218079) [435 bp, 144 aa] {...    35   0.18 
CAGL0E03630g Chr5 complement(335328..337568) [2241 bp, 746 aa] {...    36   0.18 
Kwal_30.12890 s30 (3814..4656) [843 bp, 280 aa] {ON} YDR429C (TI...    35   0.19 
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...    36   0.19 
Ecym_7344 Chr7 (717321..718130) [810 bp, 269 aa] {ON} similar to...    35   0.20 
Kpol_1002.79 s1002 (208736..209365) [630 bp, 209 aa] {ON} (20873...    35   0.26 
CAGL0C01529g Chr3 (167802..168512) [711 bp, 236 aa] {ON} similar...    35   0.26 
Ecym_4467 Chr4 complement(951838..952359) [522 bp, 173 aa] {ON} ...    34   0.28 
NCAS0I00520 Chr9 complement(83655..85001) [1347 bp, 448 aa] {ON}...    35   0.29 
AFL050W Chr6 (345624..346280) [657 bp, 218 aa] {ON} Syntenic hom...    35   0.29 
KLTH0F13090g Chr6 complement(1079045..1079482) [438 bp, 145 aa] ...    34   0.30 
NCAS0E03280 Chr5 complement(650337..651302) [966 bp, 321 aa] {ON...    35   0.30 
SAKL0F04774g Chr6 (381688..382542) [855 bp, 284 aa] {ON} similar...    35   0.31 
Kpol_322.1 s322 complement(711..974) [264 bp, 87 aa] {ON} comple...    33   0.33 
KNAG0K00460 Chr11 (77388..79508) [2121 bp, 706 aa] {ON} Anc_5.76...    35   0.35 
Kwal_33.13496 s33 complement(251014..252006) [993 bp, 330 aa] {O...    35   0.39 
TPHA0J02110 Chr10 complement(472245..473024) [780 bp, 259 aa] {O...    34   0.40 
YNL110C Chr14 complement(417826..418488) [663 bp, 220 aa] {ON}  ...    34   0.40 
TBLA0B03120 Chr2 complement(729579..730898) [1320 bp, 439 aa] {O...    35   0.44 
Ecym_2246 Chr2 (485381..486091) [711 bp, 236 aa] {ON} similar to...    34   0.44 
KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 a...    35   0.46 
Smik_14.217 Chr14 complement(397474..398136) [663 bp, 220 aa] {O...    34   0.46 
CAGL0K00253g Chr11 complement(25117..25623) [507 bp, 168 aa] {ON...    33   0.51 
KAFR0K01170 Chr11 complement(242500..242925) [426 bp, 141 aa] {O...    33   0.52 
TDEL0F01800 Chr6 (337313..337972) [660 bp, 219 aa] {ON} Anc_6.17...    34   0.52 
KAFR0I02240 Chr9 complement(459158..460426) [1269 bp, 422 aa] {O...    34   0.52 
SAKL0G05126g Chr7 complement(423140..423985) [846 bp, 281 aa] {O...    34   0.55 
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...    34   0.70 
Suva_10.24 Chr10 complement(50291..51052) [762 bp, 253 aa] {ON} ...    33   0.71 
Suva_14.229 Chr14 complement(414648..415316) [669 bp, 222 aa] {O...    33   0.75 
TBLA0A01830 Chr1 complement(446153..446839) [687 bp, 228 aa] {ON...    33   0.78 
SAKL0A05588g Chr1 (505510..506133) [624 bp, 207 aa] {ON} highly ...    33   0.81 
KLLA0B10472g Chr2 complement(914512..915108) [597 bp, 198 aa] {O...    33   0.83 
NCAS0C02560 Chr3 complement(481562..482515) [954 bp, 317 aa] {ON...    33   0.84 
Suva_15.128 Chr15 complement(223683..225089) [1407 bp, 468 aa] {...    34   0.88 
KAFR0A04360 Chr1 (869776..870402) [627 bp, 208 aa] {ON} Anc_6.17...    33   0.91 
Skud_14.222 Chr14 complement(408018..408680) [663 bp, 220 aa] {O...    33   0.93 
Ecym_2633 Chr2 (1221858..1223150) [1293 bp, 430 aa] {ON} similar...    33   0.93 
KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON...    33   0.94 
ZYRO0G19844g Chr7 (1642204..1642860) [657 bp, 218 aa] {ON} highl...    33   0.95 
Kwal_55.20718 s55 (528743..530527) [1785 bp, 594 aa] {ON} YHL024...    33   0.98 
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...    33   1.0  
TPHA0F00350 Chr6 (75008..77479) [2472 bp, 823 aa] {ON} Anc_4.33 ...    33   1.0  
KNAG0B01400 Chr2 complement(261331..262335) [1005 bp, 334 aa] {O...    33   1.1  
ZYRO0D15686g Chr4 complement(1313019..1314032) [1014 bp, 337 aa]...    33   1.1  
KLTH0E10868g Chr5 (975831..976856) [1026 bp, 341 aa] {ON} simila...    33   1.1  
NDAI0H02090 Chr8 complement(511903..512289) [387 bp, 128 aa] {ON...    32   1.1  
Ecym_4483 Chr4 (978489..979556) [1068 bp, 355 aa] {ON} similar t...    33   1.1  
Skud_4.706 Chr4 (1249139..1250398) [1260 bp, 419 aa] {ON} YDR432...    33   1.3  
YMR268C Chr13 complement(802888..804222) [1335 bp, 444 aa] {ON} ...    33   1.3  
KLTH0D12540g Chr4 complement(1025489..1026407,1026476..1026555) ...    33   1.3  
CAGL0F01023g Chr6 complement(108155..109345) [1191 bp, 396 aa] {...    33   1.3  
YLL046C Chr12 complement(46714..47463) [750 bp, 249 aa] {ON}  RN...    33   1.4  
KLTH0F13816g Chr6 (1135521..1135895) [375 bp, 124 aa] {ON} simil...    32   1.5  
Skud_15.116 Chr15 complement(210151..211533) [1383 bp, 460 aa] {...    33   1.5  
Smik_4.705 Chr4 (1249525..1250769) [1245 bp, 414 aa] {ON} YDR432...    33   1.5  
KAFR0D01270 Chr4 complement(256417..257748) [1332 bp, 443 aa] {O...    33   1.5  
KAFR0E03240 Chr5 complement(645818..646963) [1146 bp, 381 aa] {O...    33   1.6  
ADR001C Chr4 complement(708435..709409) [975 bp, 324 aa] {ON} Sy...    33   1.6  
YOL041C Chr15 complement(251267..252646) [1380 bp, 459 aa] {ON} ...    33   1.7  
KLLA0B00979g Chr2 (77439..78467) [1029 bp, 342 aa] {ON} weakly s...    33   1.8  
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...    33   1.8  
NDAI0C02340 Chr3 (533251..534414) [1164 bp, 387 aa] {ON} Anc_3.7...    33   1.8  
ZYRO0D05654g Chr4 complement(485258..486583) [1326 bp, 441 aa] {...    33   1.9  
SAKL0B09702g Chr2 (819107..820528) [1422 bp, 473 aa] {ON} simila...    33   1.9  
AER285C Chr5 complement(1162117..1163397) [1281 bp, 426 aa] {ON}...    33   2.0  
NDAI0H01670 Chr8 (404385..405596) [1212 bp, 403 aa] {ON} Anc_5.5...    32   2.1  
TBLA0A04750 Chr1 complement(1177080..1178501) [1422 bp, 473 aa] ...    32   2.1  
Kwal_27.11730 s27 (922606..923715) [1110 bp, 369 aa] {ON} YDL209...    32   2.1  
KLLA0C07194g Chr3 (624694..625587) [894 bp, 297 aa] {ON} conserv...    32   2.2  
YDR432W Chr4 (1328783..1330027) [1245 bp, 414 aa] {ON}  NPL3RNA-...    32   2.3  
Kwal_55.20414 s55 (388156..389010) [855 bp, 284 aa] {ON} YFR032C...    32   2.3  
Smik_15.126 Chr15 complement(217400..218782) [1383 bp, 460 aa] {...    32   2.5  
AEL340W Chr5 (10761..11912) [1152 bp, 383 aa] {ON} Syntenic homo...    32   2.8  
TPHA0I00420 Chr9 (82903..84300) [1398 bp, 465 aa] {ON} Anc_8.822...    32   2.8  
ADR183C Chr4 complement(1024790..1025752) [963 bp, 320 aa] {ON} ...    32   2.9  
Suva_2.607 Chr2 (1081506..1082435) [930 bp, 309 aa] {ON} YDR432W...    32   3.1  
TBLA0B02730 Chr2 complement(628543..629310) [768 bp, 255 aa] {ON...    32   3.6  
Kpol_1018.135 s1018 (361521..364112) [2592 bp, 863 aa] {ON} (361...    32   3.7  
SAKL0F03982g Chr6 complement(319563..319895) [333 bp, 110 aa] {O...    30   4.2  
KLTH0D00946g Chr4 (89863..92082) [2220 bp, 739 aa] {ON} similar ...    32   5.0  
TDEL0H03570 Chr8 (590287..591546) [1260 bp, 419 aa] {ON} Anc_7.9...    31   5.0  
TDEL0A04050 Chr1 (722870..724075) [1206 bp, 401 aa] {ON} Anc_5.5...    31   5.6  
NCAS0F01150 Chr6 (227262..228401) [1140 bp, 379 aa] {ON} Anc_5.5...    31   5.7  
SAKL0G05258g Chr7 (432822..433937) [1116 bp, 371 aa] {ON} weakly...    31   5.7  
Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON} (14170.....    31   5.9  
TBLA0D01550 Chr4 complement(387300..388562) [1263 bp, 420 aa] {O...    31   6.1  
KLLA0F04631g Chr6 (455651..457990) [2340 bp, 779 aa] {ON} simila...    31   6.5  
ZYRO0D12892g Chr4 (1087239..1088474) [1236 bp, 411 aa] {ON} weak...    31   6.7  
Kpol_193.1 s193 (1..1776) [1776 bp, 591 aa] {ON} (1..1776) [1776...    31   6.8  
CAGL0H04763g Chr8 (454589..455740) [1152 bp, 383 aa] {ON} highly...    31   7.8  
Kwal_23.3650 s23 complement(376491..377390) [900 bp, 299 aa] {ON...    30   8.0  
KLLA0F07799g Chr6 complement(734889..736277) [1389 bp, 462 aa] {...    31   8.0  
Kpol_479.17 s479 (36215..37738) [1524 bp, 507 aa] {ON} (36215..3...    31   8.5  
KLLA0D16049g Chr4 complement(1352380..1353657) [1278 bp, 425 aa]...    30   9.1  
TDEL0G01840 Chr7 (368805..369605) [801 bp, 266 aa] {ON} Anc_4.7 ...    30   9.6  

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/421 (85%), Positives = 360/421 (85%)

Query: 1   MSVEQQEQPSQAIEVVNSVESVVATTPDQPXXXXXXXXXXXXXDQSQVTPVLATKGGRET 60
           MSVEQQEQPSQAIEVVNSVESVVATTPDQP             DQSQVTPVLATKGGRET
Sbjct: 1   MSVEQQEQPSQAIEVVNSVESVVATTPDQPGGEGNEGSGSSSEDQSQVTPVLATKGGRET 60

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF
Sbjct: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120

Query: 121 QTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
           QTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH
Sbjct: 121 QTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQXXXXX 240
           VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQ     
Sbjct: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQPRPRS 240

Query: 241 XXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGPMGMAPQGMAXXXXXXXXXXXXXXXXXX 300
                       HQQFRGIPQGHPMGSPNNAGPMGMAPQGMA                  
Sbjct: 241 NRGGFRNNNGPSHQQFRGIPQGHPMGSPNNAGPMGMAPQGMAPQGIPPQGPVVPPPVNPQ 300

Query: 301 AVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 360
           AVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE
Sbjct: 301 AVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 360

Query: 361 QAAVCIVALANFPFQGRNLRTGWGKEKPAFIPNGMVXXXXXXXXXXXXXIDAPVPQEQEQ 420
           QAAVCIVALANFPFQGRNLRTGWGKEKPAFIPNGMV             IDAPVPQEQEQ
Sbjct: 361 QAAVCIVALANFPFQGRNLRTGWGKEKPAFIPNGMVPPPQQLLHPSQQPIDAPVPQEQEQ 420

Query: 421 Q 421
           Q
Sbjct: 421 Q 421

>AGR390C Chr7 complement(1447328..1448464) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL016W
           (PUB1)
          Length = 378

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/346 (77%), Positives = 282/346 (81%), Gaps = 15/346 (4%)

Query: 49  TPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFV 108
           TPVLATKGGRETSDRILYVGNLDK INE TLKQYFQVGGPIANVKVLVDKNNEEANYAFV
Sbjct: 21  TPVLATKGGRETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFV 80

Query: 109 EYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
           EY QP DANVAFQTLDGKQIE NVIKINWAFQSQ VSSDDTFNLFVGDLNVDVDDETL+ 
Sbjct: 81  EYRQPRDANVAFQTLDGKQIENNVIKINWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSS 140

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
           TFKEFP+FIQAHVMWDM SGRSRGYGFVSF EQ+ AQ+AM++KQGF LNGRAIR+NWA+K
Sbjct: 141 TFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAK 200

Query: 229 REPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGPMGMAPQGMAXXXXXX 288
           RE Q                    HQ FRG+PQG  +G    AGPM +  QG        
Sbjct: 201 RESQH---AARPRSNRGGFRGGSGHQPFRGMPQGPHLGGAAPAGPMQL--QG-------- 247

Query: 289 XXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPE 348
                       AVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHY E
Sbjct: 248 --PPVPSPVNPQAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYAE 305

Query: 349 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPAFIPNG 394
           KGCCFIKYDTH+QAA+CIVALANFPFQGR LRTGWGKEKP+F+PNG
Sbjct: 306 KGCCFIKYDTHDQAALCIVALANFPFQGRTLRTGWGKEKPSFVPNG 351

>KLTH0G10912g Chr7 (917604..918914) [1311 bp, 436 aa] {ON} some
           similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 436

 Score =  477 bits (1227), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 236/352 (67%), Positives = 263/352 (74%), Gaps = 3/352 (0%)

Query: 44  DQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA 103
           ++  VTP  A++GGRETSDRILYVGNLD A+ E+ LKQYFQVGG IANVK+L+DKNN++A
Sbjct: 48  EEPTVTPANASRGGRETSDRILYVGNLDLAVTEEMLKQYFQVGGSIANVKILMDKNNKQA 107

Query: 104 NYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDD 163
           NYAFVE+HQPHDANVAFQTLDGKQIE +VIKINWAFQSQ VSS+DTFNLFVGDLNVDVDD
Sbjct: 108 NYAFVEFHQPHDANVAFQTLDGKQIENHVIKINWAFQSQQVSSEDTFNLFVGDLNVDVDD 167

Query: 164 ETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
           ETL  TFK+ P+FIQAHVMWDM +GRSRGYGFVSF EQ  AQ+AME  QG ++NGRAIRI
Sbjct: 168 ETLARTFKDIPTFIQAHVMWDMQTGRSRGYGFVSFGEQTQAQKAMEDNQGAVVNGRAIRI 227

Query: 224 NWASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAG---PMGMAPQG 280
           NWASKRE   H                  H   +   Q  PMG P        MGM  Q 
Sbjct: 228 NWASKREHNSHNNNPMNNRGGARRGGFRNHGNNQLRHQMPPMGMPGRGAMLPNMGMPSQP 287

Query: 281 MAXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFI 340
                               AVEAM+R AP RVTT YIGNIPHFA E DLIPLLQNFGFI
Sbjct: 288 PMPQGAQPQGPIMPPQVPPQAVEAMMRSAPPRVTTVYIGNIPHFATEQDLIPLLQNFGFI 347

Query: 341 IDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPAFIP 392
           +DFKHYP++GCCFIKY THEQAAVCI+ L NFPFQGRNLRTGWGKEKP++IP
Sbjct: 348 VDFKHYPDRGCCFIKYGTHEQAAVCILTLGNFPFQGRNLRTGWGKEKPSYIP 399

>Kwal_27.11447 s27 complement(805408..806727) [1320 bp, 439 aa] {ON}
           YNL016W (PUB1) - poly(A)+ RNA-binding protein [contig
           27] FULL
          Length = 439

 Score =  473 bits (1217), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 238/361 (65%), Positives = 264/361 (73%), Gaps = 21/361 (5%)

Query: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107
           VTP  AT+GGRETSDRILYVGNLD A+ ED LKQYFQVGG IANVK+L+DKNN+EANYAF
Sbjct: 47  VTPANATRGGRETSDRILYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYAF 106

Query: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLT 167
           VE+HQPHDA+VAFQTLDGKQIE +VIKIN+AFQSQ VSS+DTFNLFVGDLNVDVDDETL 
Sbjct: 107 VEFHQPHDASVAFQTLDGKQIENHVIKINYAFQSQQVSSEDTFNLFVGDLNVDVDDETLA 166

Query: 168 GTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
            TFK  P+FIQAHVMWDM +GRSRGYGFVSF EQ  AQ+AME KQG ++NGRAIRINWAS
Sbjct: 167 NTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWAS 226

Query: 228 KRE-----------PQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGPM-- 274
           KRE              +                  H   +   Q  PMG P + G M  
Sbjct: 227 KREHNNGNNANNNIANNNNNNNMGNRGGLRRGGFRGHSNAQMRHQLPPMGMPTHGGAMMP 286

Query: 275 GMA---PQGMAXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLI 331
           GM    PQG                    A+EAMIR AP RVTT YIGNIPHFA E DLI
Sbjct: 287 GMGAPLPQG-----SQAPGPMLPPQVPPQAIEAMIRSAPSRVTTVYIGNIPHFASEQDLI 341

Query: 332 PLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPAFI 391
           PLLQNFGFI+DFKHYP++GCCFIKY THEQAA+CI+ L NFPFQGRNLRTGWGKEKP ++
Sbjct: 342 PLLQNFGFIVDFKHYPDRGCCFIKYGTHEQAAICILTLGNFPFQGRNLRTGWGKEKPTYV 401

Query: 392 P 392
           P
Sbjct: 402 P 402

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score =  455 bits (1171), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 230/353 (65%), Positives = 260/353 (73%), Gaps = 10/353 (2%)

Query: 44  DQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA 103
           ++  V P  A KGGRETSD++LYVGNLD +INE+ LKQYFQVGGPIANVK++VDKNN  A
Sbjct: 25  EEPSVVPANAIKGGRETSDKVLYVGNLDTSINEEILKQYFQVGGPIANVKIMVDKNNSNA 84

Query: 104 NYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDD-TFNLFVGDLNVDVD 162
           NYAFVEY Q HDAN+A QTL+GKQIE NV+KINWAFQSQ VS D+ TFNLFVGDLNVDVD
Sbjct: 85  NYAFVEYFQSHDANIALQTLNGKQIENNVVKINWAFQSQQVSPDEATFNLFVGDLNVDVD 144

Query: 163 DETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIR 222
           DETL   FKEFP+++Q HVMWDM +G SRGYGFVSF  Q+ AQ+AM++ QG  LNGR +R
Sbjct: 145 DETLRNAFKEFPTYLQGHVMWDMQTGGSRGYGFVSFGSQEEAQKAMDAMQGHELNGRPLR 204

Query: 223 INWASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGIP--QGHPMGSPNNAG-PMGMAPQ 279
           INWASK    +                        G P  +G PM  PN+   PMG+ P 
Sbjct: 205 INWASK----RENNNNNNRRNVNGPRNNGFRHNNGGFPGSRGMPMPPPNSMSLPMGVVPP 260

Query: 280 GMAXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGF 339
             A                  AV++MIRRAP RVTTAYIGNIPHFA E DLIPLLQNFGF
Sbjct: 261 PQALGNPNGPSVPPPVNPQ--AVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGF 318

Query: 340 IIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPAFIP 392
           IIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKE+ +F+P
Sbjct: 319 IIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTSFVP 371

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score =  450 bits (1157), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 226/368 (61%), Positives = 254/368 (69%), Gaps = 30/368 (8%)

Query: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107
           V P  A  GGRETSDR+LYVGNLDKAI ED LKQYFQVGGPIAN+K+++DKNN+  NYAF
Sbjct: 61  VVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAF 120

Query: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLT 167
           VEYHQ HDAN+A QTL+GKQIE NV+KINWAFQSQ  SSDDTFNLFVGDLNV+VDDETL 
Sbjct: 121 VEYHQSHDANIALQTLNGKQIENNVVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLR 180

Query: 168 GTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
             FK+FPS++  HVMWDM +G SRGYGFVSF+ QD AQ AM+S QG  LNGR +RINWA+
Sbjct: 181 NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAA 240

Query: 228 KRE-------PQQHQXXXXXX---------------XXXXXXXXXXXHQQFRGIPQGHPM 265
           KR+       PQ+                                      RG+P     
Sbjct: 241 KRDNNNTNNYPQRRNYGNNNRGGFRQYNNNNNNNNMNMGMNMGMNMNMSSNRGMP----- 295

Query: 266 GSPNNAG-PMGMAPQGMAXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHF 324
             P++ G PMG  P                      AV+ +IR AP RVTTAYIGNIPHF
Sbjct: 296 --PSSMGMPMGAMPLPSQGQPQQSQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHF 353

Query: 325 AQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWG 384
           A E DLIPL QNFGFI+DFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWG
Sbjct: 354 ATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWG 413

Query: 385 KEKPAFIP 392
           KE+  F+P
Sbjct: 414 KERSNFMP 421

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score =  446 bits (1148), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 231/390 (59%), Positives = 265/390 (67%), Gaps = 24/390 (6%)

Query: 19  VESVVATTPDQPXXXXXXXXXXXXXDQSQVTPVL---ATKGGRETSDRILYVGNLDKAIN 75
           V  V A+ P Q              ++ + TPV+   ATKGGRETSDR+LYVGNLDK+I 
Sbjct: 9   VIGVNASVPVQEEPTVSPSPERSDSEERETTPVVPANATKGGRETSDRVLYVGNLDKSIT 68

Query: 76  EDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLDGKQIEGNVIKI 135
           E+ L+QYFQVGG I+NVKV++DKNN  ANYAFVEY + HDAN+A QTL+GKQIE NV++I
Sbjct: 69  EEVLRQYFQVGGQISNVKVMIDKNNARANYAFVEYFKSHDANIALQTLNGKQIENNVVRI 128

Query: 136 NWAFQSQHVSSDD-TFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYG 194
           NWAFQSQ    D+ T+NLFVGDL+VDVDDETL   F+ FPSFIQ HVMWDM +G SRGYG
Sbjct: 129 NWAFQSQQALPDENTYNLFVGDLSVDVDDETLCNAFRSFPSFIQGHVMWDMQTGGSRGYG 188

Query: 195 FVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQXXXXXXXXXXXXXXXXXHQ 254
           FVSF +Q+ AQ AM+S Q   LNGR +RINWASKRE   +                    
Sbjct: 189 FVSFGDQEQAQLAMDSMQSQELNGRPLRINWASKRENHHNGNRRGGLAGNRNGGMRLFPN 248

Query: 255 QFRGIPQGHPMGSPN------------NAGPMGMAPQGMAXXXXXXXXXXXXXXXXXXAV 302
              G  +G PM  PN            NA PMG  P G A                  AV
Sbjct: 249 NNNGFGRGMPMPPPNSMGIPLGGTLPPNAQPMGAPPSGPAPTVPPPVNPQ--------AV 300

Query: 303 EAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQA 362
           EAMIRRAP RVTT+YIGNIPHFA + DLIPLLQNFGFI+DFKHYPEKGCCF+KYDTHEQA
Sbjct: 301 EAMIRRAPPRVTTSYIGNIPHFATDSDLIPLLQNFGFILDFKHYPEKGCCFVKYDTHEQA 360

Query: 363 AVCIVALANFPFQGRNLRTGWGKEKPAFIP 392
           AVCIVALANF FQGRNLRTGWGKE+  F+P
Sbjct: 361 AVCIVALANFFFQGRNLRTGWGKERTTFVP 390

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score =  448 bits (1152), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 223/367 (60%), Positives = 253/367 (68%), Gaps = 29/367 (7%)

Query: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107
           V P  A  GGRETSDR+LYVGNLDKAI ED LKQYFQVGGPIAN+K+++DKNN+  NYAF
Sbjct: 60  VVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAF 119

Query: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLT 167
           VEYHQ HDAN+A QTL+GKQIE N++KINWAFQSQ  SSDDTFNLFVGDLNV+VDDETL 
Sbjct: 120 VEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLR 179

Query: 168 GTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
             FK+FPS++  HVMWDM +G SRGYGFVSF+ QD AQ AM+S QG  LNGR +RINWA+
Sbjct: 180 NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAA 239

Query: 228 KREP---------------------QQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMG 266
           KR+                      Q +                      RG+P      
Sbjct: 240 KRDNNNNNNYQQRRNYGNNNRGGFRQYNSNNNNNMNMGMNMNMNMNMNNSRGMP------ 293

Query: 267 SPNNAG-PMGMAPQGMAXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFA 325
            P++ G P+G  P                      AV+ +IR AP RVTTAYIGNIPHFA
Sbjct: 294 -PSSMGMPIGAMPLPSQGQPQQSQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPHFA 352

Query: 326 QEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 385
            E DLIPL QNFGFI+DFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK
Sbjct: 353 TEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 412

Query: 386 EKPAFIP 392
           E+  F+P
Sbjct: 413 ERSNFMP 419

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score =  447 bits (1151), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 222/369 (60%), Positives = 255/369 (69%), Gaps = 31/369 (8%)

Query: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107
           V P  A  GGRETSD++LYVGNLDKAI ED LKQYFQVGGPIAN+K+++DKNN+  NYAF
Sbjct: 58  VVPANAITGGRETSDKVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAF 117

Query: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLT 167
           VEYHQ HDAN+A QTL+GKQIE N++KINWAFQSQ  SSDDTFNLFVGDLNV+VDDETL 
Sbjct: 118 VEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLR 177

Query: 168 GTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
             FK+FPS++  HVMWDM +G SRGYGFVSF+ QD AQ AM+S QG  LNGR +RINWA+
Sbjct: 178 NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDSMQGQDLNGRPLRINWAA 237

Query: 228 KREPQQHQXXXXXXXXXXXXXXXXXHQQF-----------------------RGIPQGHP 264
           KR+   +                   +Q+                       RG+P    
Sbjct: 238 KRDNNNNNNNNYPQRRNYGNNNRGGFRQYNNNNNNNMNMGMNMNMNMNMNTNRGMP---- 293

Query: 265 MGSPNNAG-PMGMAPQGMAXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPH 323
              P++ G P+G  P                      AV+ +IR AP RVTTAYIGNIPH
Sbjct: 294 ---PSSMGMPIGAMPLPSQGQPQQSQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIGNIPH 350

Query: 324 FAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGW 383
           FA E DLIPL QNFGFI+DFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGW
Sbjct: 351 FATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGW 410

Query: 384 GKEKPAFIP 392
           GKE+  F+P
Sbjct: 411 GKERSNFMP 419

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score =  448 bits (1152), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 224/353 (63%), Positives = 255/353 (72%), Gaps = 5/353 (1%)

Query: 44  DQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA 103
           + + V P  A +GGRETSD+ILYVGNLDK+INED+LKQYFQVGGPIANVK++VDKNN+  
Sbjct: 64  ESANVVPANAIRGGRETSDKILYVGNLDKSINEDSLKQYFQVGGPIANVKIIVDKNNKYC 123

Query: 104 NYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDD 163
           NYAFVEY + HDANVA QTL+GK IE  ++KINWAFQSQ  S+DDTFNLF+GDLN+DV+D
Sbjct: 124 NYAFVEYLKHHDANVALQTLNGKHIEKKIVKINWAFQSQQSSNDDTFNLFIGDLNIDVND 183

Query: 164 ETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
           E+LT  FK+FPSF+QAHVMWDM +GRSRGYGF SFS Q+ AQ AM+  QG  LNGR IRI
Sbjct: 184 ESLTAAFKDFPSFVQAHVMWDMQTGRSRGYGFASFSTQNDAQLAMDQMQGKELNGRPIRI 243

Query: 224 NWASKREPQQ--HQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGPMGMAP--Q 279
           NWASKR+ QQ   Q                    F         G P     MG+ P  Q
Sbjct: 244 NWASKRDNQQGQQQSHNNGGFQNRRNNNNNNPNMFGSRNTNQMQGPPPPNMQMGVPPPQQ 303

Query: 280 GM-AXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFG 338
           GM                    AVE MIRRAP RVTTAYIGN+P FA E DLIPLLQNFG
Sbjct: 304 GMNPVGPNGPHPPVVPLPVNPDAVEDMIRRAPPRVTTAYIGNLPRFATEADLIPLLQNFG 363

Query: 339 FIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPAFI 391
           FI+DFKHYP++G CFIKYDTHEQAAVCIVALANFP QGRNL+TGWGKEKP F+
Sbjct: 364 FILDFKHYPDRGICFIKYDTHEQAAVCIVALANFPLQGRNLKTGWGKEKPTFM 416

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score =  446 bits (1147), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 217/348 (62%), Positives = 249/348 (71%), Gaps = 11/348 (3%)

Query: 45  QSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN 104
           +S V P  AT+GGRETSDR+LYVGNLDK+INED LKQYFQVGG I +VK++VDK N   N
Sbjct: 65  ESSVVPASATQGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVN 124

Query: 105 YAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVS-SDDTFNLFVGDLNVDVDD 163
           YAF+EY + HDANVA QTL+G QIEG  ++INWAFQSQ  + SDDTFNLFVGDLNVDVDD
Sbjct: 125 YAFIEYLKSHDANVALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDD 184

Query: 164 ETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
           ETL+  F +FPS++QAHVMWDM +GRSRGYGFVSF++Q+ AQ+AM   QG  +NGRA+RI
Sbjct: 185 ETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244

Query: 224 NWASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGPMGMAPQGMAX 283
           NWA+KRE   +                    +   IP             +GM P     
Sbjct: 245 NWATKRENNNNNNGNGPRRGGFHNNNNMGGNRGGMIP----------PTALGMPPMDGMI 294

Query: 284 XXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDF 343
                            A++ MIRRAP RVTTAYIGNIPHFA E DLIPLLQNFGFI+DF
Sbjct: 295 PNPQQQAPVAPPPVNPQAIDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQNFGFILDF 354

Query: 344 KHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPAFI 391
            HYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKE+  FI
Sbjct: 355 SHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERNTFI 402

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score =  445 bits (1144), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 223/373 (59%), Positives = 254/373 (68%), Gaps = 35/373 (9%)

Query: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107
           V P  A  GGRETSDR+LYVGNLDKAI ED LKQYFQVGGPIAN+K+++DKNN+  NYAF
Sbjct: 60  VVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAF 119

Query: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLT 167
           VEYHQ HDAN+A QTL+GKQIE N++KINWAFQSQ  SSDDTFNLFVGDLNV+VDDETL 
Sbjct: 120 VEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLR 179

Query: 168 GTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
             FK+FPS++  HVMWDM +G SRGYGFVSF+ QD AQ AM++ QG  LNGR +RINWA+
Sbjct: 180 NAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQTAMDTMQGQDLNGRPLRINWAA 239

Query: 228 KRE-------------PQQHQXXXXXX--------------XXXXXXXXXXXHQQFRGIP 260
           KR+             PQ+                                     RG+P
Sbjct: 240 KRDNNNSNNNNNNNNYPQRRNYGNNNRGGFRQYNNNNNNNMNMGMNMNMNMNMNSSRGMP 299

Query: 261 QGHPMGSPNNAG-PMGMAPQGMAXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIG 319
                  P++ G P+G  P                      AV+ +IR AP RVTTAYIG
Sbjct: 300 -------PSSMGMPIGAMPLPSQGQPQQSQTIGLPPQVNPQAVDHIIRSAPPRVTTAYIG 352

Query: 320 NIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNL 379
           NIPHFA E DLIPL QNFGFI+DFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNL
Sbjct: 353 NIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNL 412

Query: 380 RTGWGKEKPAFIP 392
           RTGWGKE+  F+P
Sbjct: 413 RTGWGKERSNFMP 425

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  436 bits (1120), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 229/388 (59%), Positives = 258/388 (66%), Gaps = 16/388 (4%)

Query: 44  DQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA 103
           D S V P  A  GGRETSD+ILYVGNLDK+INE+TLKQYFQ+GGPI+NVKV+ DKNN   
Sbjct: 60  DDSDVVPANAINGGRETSDKILYVGNLDKSINEETLKQYFQIGGPISNVKVINDKNNS-V 118

Query: 104 NYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDT-FNLFVGDLNVDVD 162
           NYAFVEY Q HDA+VAF+ L+GK IE  V+KINWAFQSQ  +SD++ FNLFVGDLNVDVD
Sbjct: 119 NYAFVEYLQHHDADVAFKNLNGKTIETKVLKINWAFQSQQTTSDESLFNLFVGDLNVDVD 178

Query: 163 DETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIR 222
           DETL   F EFPSF+QAHVMWDM +GRSRGYGF+SFS Q+ AQ AM+  Q   LNGR IR
Sbjct: 179 DETLGHAFSEFPSFVQAHVMWDMQTGRSRGYGFISFSNQEDAQTAMDKMQSTELNGRQIR 238

Query: 223 INWASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGPMGMAPQGMA 282
           INWASKRE                      +      P+G      NN  P+   P G  
Sbjct: 239 INWASKRE--NATNGNGNNNNRNMNNRRNNNNSNSNGPRGGFRSYNNNMPPL---PMGNM 293

Query: 283 XXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIID 342
                             AV+ MIRRAP RVTT YIGNIPHFA E DLIPLLQNFGFI+D
Sbjct: 294 PMSAPPAGPAVLPPVNPQAVDDMIRRAPLRVTTVYIGNIPHFATEADLIPLLQNFGFILD 353

Query: 343 FKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEKPAFIP---------N 393
           FK+YPEKG CFIKYDTHEQAAVCIV LAN+PFQGRNL+TGWGKEK  FIP         +
Sbjct: 354 FKYYPEKGNCFIKYDTHEQAAVCIVVLANYPFQGRNLKTGWGKEKAVFIPMGQQQGMMMS 413

Query: 394 GMVXXXXXXXXXXXXXIDAPVPQEQEQQ 421
           GM                 P+P EQ+QQ
Sbjct: 414 GMPPPPPQQQQQFQQDASTPIPNEQQQQ 441

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score =  318 bits (815), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 166/187 (88%)

Query: 44  DQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA 103
           +Q Q+TP    +GGRETSD+ILYVGNLDK+I ED LKQYFQVGGP+ANVK+LVDKNN+EA
Sbjct: 25  EQPQITPANVARGGRETSDKILYVGNLDKSITEDLLKQYFQVGGPVANVKILVDKNNQEA 84

Query: 104 NYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDD 163
           NYAFVEYH+PHDANVAFQTLDGK IE N IKINWAFQS  V+SD++FNLFVGDLNVDVDD
Sbjct: 85  NYAFVEYHKPHDANVAFQTLDGKTIENNQIKINWAFQSHQVASDESFNLFVGDLNVDVDD 144

Query: 164 ETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
           ETL   F EF +FIQAHVMWDM SGRSRGYGFVSF EQ+ AQ+AME+KQGF LNGRAIRI
Sbjct: 145 ETLANAFSEFSAFIQAHVMWDMQSGRSRGYGFVSFGEQEQAQKAMETKQGFELNGRAIRI 204

Query: 224 NWASKRE 230
           NWASKRE
Sbjct: 205 NWASKRE 211

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score =  316 bits (809), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 169/188 (89%)

Query: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107
             PVLAT+GGRE SD+ILYVGNL K+I++D LKQYFQ+GG I++VK++ DKN++E NYAF
Sbjct: 82  AAPVLATQGGREKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAF 141

Query: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLT 167
           VEY +PHDANVA+QTL+GK++EG V+KINWAFQSQ V+SD+TFNLFVGDLNVDVDD TL 
Sbjct: 142 VEYFEPHDANVAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLA 201

Query: 168 GTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
           GTFKEFPSFIQAHVMWDM SGRSRGYGFVSF EQD AQ AME+KQGF LNGRA+RINWAS
Sbjct: 202 GTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWAS 261

Query: 228 KREPQQHQ 235
           KREPQQ Q
Sbjct: 262 KREPQQSQ 269

 Score =  188 bits (478), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 84/91 (92%), Positives = 86/91 (94%)

Query: 301 AVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 360
           AVE M+RRAP RVTTAYIGNIPHFAQE DLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE
Sbjct: 346 AVEDMMRRAPPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 405

Query: 361 QAAVCIVALANFPFQGRNLRTGWGKEKPAFI 391
           QAA+CIVAL NFPFQGRNLRTGWGKEKP FI
Sbjct: 406 QAALCIVALTNFPFQGRNLRTGWGKEKPTFI 436

>CAGL0H10604g Chr8 complement(1033488..1034738) [1251 bp, 416 aa]
           {ON} similar to uniprot|P32588 Saccharomyces cerevisiae
           YNL016w PUB1
          Length = 416

 Score =  282 bits (722), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 156/188 (82%), Gaps = 1/188 (0%)

Query: 44  DQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA 103
           D+  V P  ATKGGRETSDR+LYVGNLDK+I ED LKQYFQ GGPI NVK++ D  NE  
Sbjct: 39  DKPSVVPASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYV 98

Query: 104 NYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVS-SDDTFNLFVGDLNVDVD 162
           NYAFVEY + HDANVA QTL+G Q+E   +KINWAF++Q  + +DDTFNLFVGDLNVDVD
Sbjct: 99  NYAFVEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVD 158

Query: 163 DETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIR 222
           DETL GTF+EFP+FIQAHVMWDM +GRSRGYGFVSFS Q+ AQ+AM++ QG  L+GR IR
Sbjct: 159 DETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIR 218

Query: 223 INWASKRE 230
           INWA+KRE
Sbjct: 219 INWATKRE 226

 Score =  183 bits (465), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 80/92 (86%), Positives = 85/92 (92%)

Query: 301 AVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 360
           A+E MIRRAP RVTTAYIGNIPH+A E DLIPLLQNFGFI+DF HYPEKGCCFIKYDTHE
Sbjct: 302 AIEDMIRRAPPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 361

Query: 361 QAAVCIVALANFPFQGRNLRTGWGKEKPAFIP 392
           QAAVCIVALANFPFQGRNLRTGWGKE+  F+P
Sbjct: 362 QAAVCIVALANFPFQGRNLRTGWGKERTNFMP 393

>NDAI0B03440 Chr2 complement(872200..873699) [1500 bp, 499 aa] {ON}
           Anc_6.104 YBR212W
          Length = 499

 Score =  282 bits (721), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 158/188 (84%), Gaps = 1/188 (0%)

Query: 44  DQSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA 103
           ++  V P  AT GGRETSDR+LYVGNLDK+INED LKQYFQVGG I +VK++VDK N+  
Sbjct: 68  EEPNVVPASATHGGRETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNQNV 127

Query: 104 NYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQS-QHVSSDDTFNLFVGDLNVDVD 162
           NYAFVEY + HDANVA QTL+G QIE  +IKINWAFQS Q+++S+DTFNLFVGDLN+DVD
Sbjct: 128 NYAFVEYLKSHDANVALQTLNGIQIENKIIKINWAFQSQQNLNSNDTFNLFVGDLNIDVD 187

Query: 163 DETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIR 222
           DETL+  FK FPS+IQAHVMWDM + RSRGYGFVSF+++D AQ AM++ QG  +NGR IR
Sbjct: 188 DETLSSNFKNFPSYIQAHVMWDMQTSRSRGYGFVSFADRDQAQNAMDTMQGKEINGRPIR 247

Query: 223 INWASKRE 230
           INWA+KRE
Sbjct: 248 INWATKRE 255

 Score =  187 bits (475), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 85/93 (91%)

Query: 301 AVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 360
           AV+ MIRRAP RVTTAYIGNIPHFA E DLIPLLQ FGFI+DF HYPEKGCCFIKYDTHE
Sbjct: 353 AVDDMIRRAPPRVTTAYIGNIPHFATEADLIPLLQTFGFILDFSHYPEKGCCFIKYDTHE 412

Query: 361 QAAVCIVALANFPFQGRNLRTGWGKEKPAFIPN 393
           QAAVCIVALANFPFQGRNLRTGWGKE+  FIPN
Sbjct: 413 QAAVCIVALANFPFQGRNLRTGWGKERTTFIPN 445

>KNAG0A05440 Chr1 (805095..806423) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score =  271 bits (693), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 155/189 (82%), Gaps = 1/189 (0%)

Query: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107
           V P  AT GGRETSDR+LYVGNLDK+I ED LKQYFQV G I +VKV++DK +   NYAF
Sbjct: 64  VVPANATHGGRETSDRVLYVGNLDKSITEDILKQYFQVAGQIVDVKVMIDKKSNYVNYAF 123

Query: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDD-TFNLFVGDLNVDVDDETL 166
           VEY + HDA+VA QTL+G QIE N +KIN AFQSQ  ++DD TFNLFVGDLN+D+DD+TL
Sbjct: 124 VEYAKAHDASVALQTLNGIQIENNKVKINRAFQSQQSTTDDSTFNLFVGDLNIDIDDDTL 183

Query: 167 TGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
           + +FK+FPS+IQAHVMWDM +GRSRGYGFVSF++Q+ AQ+AME  QG  LNGR IRINWA
Sbjct: 184 SRSFKDFPSYIQAHVMWDMQTGRSRGYGFVSFADQEQAQKAMEEMQGKELNGRPIRINWA 243

Query: 227 SKREPQQHQ 235
           +KR+  Q Q
Sbjct: 244 TKRDNNQQQ 252

 Score =  175 bits (444), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 77/90 (85%), Positives = 82/90 (91%)

Query: 301 AVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 360
           AV+ MIRRAP RV+TAYIGNIPHFA E DLIPLLQ+FGFI+DF HYPEKGCCFIKYDTHE
Sbjct: 326 AVDDMIRRAPPRVSTAYIGNIPHFATEADLIPLLQSFGFILDFTHYPEKGCCFIKYDTHE 385

Query: 361 QAAVCIVALANFPFQGRNLRTGWGKEKPAF 390
           QAAVCIVALANF FQGRNLRTGWGKE+  F
Sbjct: 386 QAAVCIVALANFNFQGRNLRTGWGKERNTF 415

>KAFR0J01260 Chr10 complement(234244..235341) [1098 bp, 365 aa] {ON}
           Anc_2.306 YNL016W
          Length = 365

 Score =  257 bits (657), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 142/184 (77%), Gaps = 1/184 (0%)

Query: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107
           V P  A +GGRETSD++LY+GNLDK+INED LKQYFQV G I +VKV+VDK N   NYAF
Sbjct: 16  VIPASAKEGGRETSDKVLYIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYAF 75

Query: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDT-FNLFVGDLNVDVDDETL 166
           +EY   HDANVA QTL+G QIE   IKINWAFQSQ   +DDT FNLF+GDLNV+VDD TL
Sbjct: 76  IEYSTNHDANVALQTLNGIQIENKNIKINWAFQSQTNLNDDTSFNLFIGDLNVNVDDTTL 135

Query: 167 TGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
              FK  P F+QAHVMWDM + RSRGYGFVSF   + AQ AM+  QG  +NGRAIRINWA
Sbjct: 136 ANAFKSCPGFLQAHVMWDMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWA 195

Query: 227 SKRE 230
           +KRE
Sbjct: 196 TKRE 199

 Score =  184 bits (467), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 84/91 (92%)

Query: 301 AVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 360
           AVE MIRRAP RVTTAYIGNIPHFA EPDLIPLLQNFGFI+DF HYPEKGCCFIKYDTHE
Sbjct: 247 AVEDMIRRAPPRVTTAYIGNIPHFATEPDLIPLLQNFGFILDFTHYPEKGCCFIKYDTHE 306

Query: 361 QAAVCIVALANFPFQGRNLRTGWGKEKPAFI 391
           QAAVCIVAL+NF FQGRNLRTGWGKE+  FI
Sbjct: 307 QAAVCIVALSNFQFQGRNLRTGWGKERSTFI 337

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 5/73 (6%)

Query: 317 YIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEK-----GCCFIKYDTHEQAAVCIVALAN 371
           YIGN+     E  L    Q  G I+D K   +K        FI+Y T+  A V +  L  
Sbjct: 34  YIGNLDKSINEDALKQYFQVAGQIVDVKVMVDKKNNHVNYAFIEYSTNHDANVALQTLNG 93

Query: 372 FPFQGRNLRTGWG 384
              + +N++  W 
Sbjct: 94  IQIENKNIKINWA 106

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 21/46 (45%)

Query: 342 DFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEK 387
           D +    +G  F+ +DTHE A   +  +      GR +R  W  ++
Sbjct: 153 DMQTSRSRGYGFVSFDTHENAQAAMDQMQGHEINGRAIRINWATKR 198

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score =  181 bits (458), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 80/92 (86%), Positives = 84/92 (91%)

Query: 301 AVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 360
           AV+ MIRRAPQRVTT YIGNIPHFA E DLIPLLQNFGFI+DFKHYPEKG CFIKYDTHE
Sbjct: 311 AVDDMIRRAPQRVTTVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNCFIKYDTHE 370

Query: 361 QAAVCIVALANFPFQGRNLRTGWGKEKPAFIP 392
           QAAVCIV LANFPFQGRNL+TGWGKEK  F+P
Sbjct: 371 QAAVCIVVLANFPFQGRNLKTGWGKEKSTFMP 402

>KNAG0B04440 Chr2 complement(849093..850286) [1194 bp, 397 aa] {ON}
           Anc_5.382 YHR086W
          Length = 397

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 89/343 (25%), Positives = 144/343 (41%), Gaps = 53/343 (15%)

Query: 65  LYVGNLDKAINEDTLKQ-YFQVGGPIANVKVLVDKNNEEAN--------YAFVEYHQPHD 115
           LY+G+L+ + +E+ +K+ +  +G    +VK++   NN   N        Y F+++  P  
Sbjct: 56  LYMGDLEPSWDENVIKRIWSSIGEDNISVKMMWQNNNYMGNESGPRNQGYCFIDF--PTH 113

Query: 116 ANVAFQTLDGK-QIEGN---VIKINWAFQSQ------HVSSDDTFNLFVGDLNVDVDDET 165
            N +   L  K  I G+    +K+NWA  S         +  + F++FVGDL  +V +  
Sbjct: 114 FNASNALLKNKMSIPGHPHKKLKLNWASSSAPSTAGVSTTGGNNFSIFVGDLAPNVTEAQ 173

Query: 166 LTGTF-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRIN 224
           L   F   +PS   A V+ D+ +G S+GYGF+ F +    Q A+   QG  LNGRA+++ 
Sbjct: 174 LFDLFISRYPSTEHAKVVIDLSTGVSKGYGFIRFRDPADQQTALAEMQGVFLNGRALKVG 233

Query: 225 WASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGI-PQGHPMGSPNNAGPMGMAPQGMAX 283
            +S +                       H ++ G  P G    +PN+A    +  Q M  
Sbjct: 234 MSSGQS-----------NSGAGGSRQVGHDRYGGSKPAGGKSNTPNSA----LFSQFMYP 278

Query: 284 XXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDF 343
                               A+        TT +IG +    +E +L    Q FG I+  
Sbjct: 279 IQQQ---------------PALNHFTDPNNTTVFIGGLSPLVKEEELRQYFQPFGEIVYV 323

Query: 344 KHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKE 386
           K    KGC F++Y     A   I  +  FP     +R  WG+ 
Sbjct: 324 KIPVGKGCGFVQYIDRISAETAISQMQGFPISNSRVRLSWGRS 366

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 86/236 (36%), Gaps = 58/236 (24%)

Query: 49  TPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGP-IANVKVLVD-KNNEEANYA 106
           T  ++T GG   S   ++VG+L   + E  L   F    P   + KV++D        Y 
Sbjct: 147 TAGVSTTGGNNFS---IFVGDLAPNVTEAQLFDLFISRYPSTEHAKVVIDLSTGVSKGYG 203

Query: 107 FVEYHQPHDANVAFQTLDGKQIEGNVIKI------------------------------- 135
           F+ +  P D   A   + G  + G  +K+                               
Sbjct: 204 FIRFRDPADQQTALAEMQGVFLNGRALKVGMSSGQSNSGAGGSRQVGHDRYGGSKPAGGK 263

Query: 136 ----NWAFQSQ------------HVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQA 179
               N A  SQ            H +  +   +F+G L+  V +E L   F+ F   +  
Sbjct: 264 SNTPNSALFSQFMYPIQQQPALNHFTDPNNTTVFIGGLSPLVKEEELRQYFQPFGEIVYV 323

Query: 180 HVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQ 235
            +         +G GFV + ++  A+ A+   QGF ++   +R++W    + QQ Q
Sbjct: 324 KIP------VGKGCGFVQYIDRISAETAISQMQGFPISNSRVRLSWGRSAKQQQLQ 373

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 43/100 (43%), Gaps = 10/100 (10%)

Query: 142 QHVSSDDTFNLFVGDLNVDVDDETLTGTFKEF-PSFIQAHVMW-------DMLSGRSRGY 193
           Q++S+D    L++GDL    D+  +   +       I   +MW       +    R++GY
Sbjct: 46  QNMSNDAGVQLYMGDLEPSWDENVIKRIWSSIGEDNISVKMMWQNNNYMGNESGPRNQGY 105

Query: 194 GFVSFSEQDVAQQAMESKQGFILN--GRAIRINWASKREP 231
            F+ F     A  A+   +  I     + +++NWAS   P
Sbjct: 106 CFIDFPTHFNASNALLKNKMSIPGHPHKKLKLNWASSSAP 145

>Skud_8.147 Chr8 (252154..253695) [1542 bp, 513 aa] {ON} YHR086W
           (REAL)
          Length = 513

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 90/363 (24%), Positives = 146/363 (40%), Gaps = 62/363 (17%)

Query: 60  TSDRILYVGNLDKAINEDTLKQ-YFQVGGPIANVKVLVD-------------KNNEEANY 105
           T+   LY+G+LD   +++T++Q +  +G    NV+++ +             KNN+   Y
Sbjct: 41  TTGNQLYMGDLDPTWDKNTIRQIWTSLGEANVNVRMMWNNPSNSGSRPSVGPKNNQ--GY 98

Query: 106 AFVEYHQPHDANVAFQTLDGKQIEGNV----IKINWAFQS-------QHVSSDDTFNLFV 154
            F+++  P   + A   L    +  N     +K+NWA  S        ++ S +++++FV
Sbjct: 99  CFIDF--PSSTHAANALLKNGMLIPNFPNRKLKLNWATSSYSNNINGANMKSGNSYSIFV 156

Query: 155 GDLNVDVDDETLTGTF-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQG 213
           GDL  +V +  L   F   + S   A ++ D ++G S+GYGFV F+  D  Q A+   QG
Sbjct: 157 GDLAPNVTESQLFELFINRYASASHAKIVHDQVTGMSKGYGFVKFTNADEEQLALSEMQG 216

Query: 214 FILNGRAIRINWASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGP 273
             LNGRAI++   S ++ Q                          I QG    S NN   
Sbjct: 217 VFLNGRAIKVGPTSGQQQQNVHVNGN-------------------IDQGRSSSSLNNE-- 255

Query: 274 MGMAPQGMAXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVT----------TAYIGNIPH 323
               P+  +                   V   I    Q+ +          T +IG +  
Sbjct: 256 -NFDPRFHSKNQSLLGNVANNMSSKGNNVSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSS 314

Query: 324 FAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGW 383
              E +L    Q FG I+  K    KGC F++Y     A   I  +  FP     +R  W
Sbjct: 315 LVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSW 374

Query: 384 GKE 386
           G+ 
Sbjct: 375 GRS 377

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  +++G L   + ED L+ YFQ  G I  VK+ V K        FV+Y     A  A 
Sbjct: 303 NNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK-----GCGFVQYVDRLSAEAAI 357

Query: 121 QTLDGKQIEGNVIKINWAFQSQHVS 145
             + G  I  + ++++W   ++  +
Sbjct: 358 AGMQGFPIANSRVRLSWGRSAKQTA 382

>NCAS0H01810 Chr8 (349311..350642) [1332 bp, 443 aa] {ON} Anc_5.382
          Length = 443

 Score = 94.0 bits (232), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 91/348 (26%), Positives = 141/348 (40%), Gaps = 35/348 (10%)

Query: 52  LATKGG----RETSDRILYVGNLDKAINEDTLKQYFQ-VGGPIANVKVLVDKN-NEEANY 105
           LA  GG      T    LY+G+LD   +E+ ++Q ++ +G    +VK++ + N      Y
Sbjct: 32  LAYAGGGATDYNTGSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGY 91

Query: 106 AFVEYHQPHDANVAFQTLDGKQIEG---NVIKINWAFQSQHVSSDDTFNLFVGDLNVDVD 162
            FVE+      N A    +G  I G     +K+NWA    +  ++  F++FVGDL+ +V 
Sbjct: 92  CFVEFPSMEHGNNALLK-NGIVIPGFPQRRLKLNWASAGAN-GNNSGFSVFVGDLSPNVT 149

Query: 163 DETLTGTF-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAI 221
           +  L   F   +PS   A V+ D L+G S+ YGFV F+     Q+ +   QG  LNGR+I
Sbjct: 150 EAQLFELFIGRYPSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSI 209

Query: 222 RINWASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGPMGMAPQGM 281
           ++                               +F G+P       PN+A  +     G 
Sbjct: 210 KVGLTGGAHNDNSN----------TNSMAGGRSRFGGMP-------PNSASTV---SSGN 249

Query: 282 AXXXXXXXXXXXXXXXXXXAVEAMIRRA--PQRVTTAYIGNIPHFAQEPDLIPLLQNFGF 339
           +                    +  +     P   T  +IG +     E DL    Q FG 
Sbjct: 250 SNNRNMTPLLNSSQFMYPVQQQPTLNHLTDPNNTT-VFIGGLSSLVSEDDLRQYFQPFGD 308

Query: 340 IIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEK 387
           II  K    KGC F++Y     A + I  +  FP     +R  WG+  
Sbjct: 309 IIYVKIPTGKGCGFVQYVDRLSAELAISKMQGFPLANSRIRLSWGRSS 356

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 5/82 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  +++G L   ++ED L+QYFQ  G I  VK+   K        FV+Y     A +A 
Sbjct: 281 NNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIPTGK-----GCGFVQYVDRLSAELAI 335

Query: 121 QTLDGKQIEGNVIKINWAFQSQ 142
             + G  +  + I+++W   S+
Sbjct: 336 SKMQGFPLANSRIRLSWGRSSK 357

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 8/92 (8%)

Query: 143 HVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           H++  +   +F+G L+  V ++ L   F+ F   I   +         +G GFV + ++ 
Sbjct: 276 HLTDPNNTTVFIGGLSSLVSEDDLRQYFQPFGDIIYVKIP------TGKGCGFVQYVDRL 329

Query: 203 VAQQAMESKQGFILNGRAIRINWASKREPQQH 234
            A+ A+   QGF L    IR++W   R  +QH
Sbjct: 330 SAELAISKMQGFPLANSRIRLSWG--RSSKQH 359

>ZYRO0B11660g Chr2 (918547..920310) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 93.6 bits (231), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 96/178 (53%), Gaps = 1/178 (0%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDAN 117
           ETS   LYVG LD  ++E  L   F   G +++++V  D   + +  YA+V ++      
Sbjct: 36  ETSTASLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDYEAGR 95

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A + L+   I+G   +I W+ +   +    + N+F+ +L+ D+D++ L  TF  F + +
Sbjct: 96  QAIEKLNYTPIKGQPCRIMWSQRDPSLRKKGSGNIFIKNLHADIDNKALHDTFSVFGNIL 155

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQ 235
              +  D ++G S+G+GFV F   + A++A+++  G +LNG+ + +     R+ +Q +
Sbjct: 156 SCKIATDEVTGNSKGFGFVHFESDEAAREAIDAINGMLLNGQEVYVAPHVSRKDRQSK 213

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 86/187 (45%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +Y+ N+     E   +++F+   P+ +V +  D   +   + FV Y     A  A + L+
Sbjct: 224 VYIKNISLETPEQEFEEFFKKVAPVTSVHLEKDSEGKLRGFGFVNYETHAGAAKAVEELN 283

Query: 125 GKQIEGNVIKINWA-------------FQSQHVSSDDTF---NLFVGDLNVDVDDETLTG 168
           G +  G  + +  A             ++   +   + +   NLF+ +L+  +DDE L  
Sbjct: 284 GVEFHGQQLHVGRAQKKYERQQELRRQYEQSKLEKMEKYQGVNLFIKNLDDSIDDERLRE 343

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  F +     VM    +G+S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 344 EFSPFGTITSVKVMTTE-NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 402

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 403 KDVRRSQ 409

>TPHA0B03420 Chr2 complement(794369..796108) [1740 bp, 579 aa] {ON}
           Anc_8.229 YER165W
          Length = 579

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 91/166 (54%), Gaps = 2/166 (1%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDAN 117
           +T+   LYVG LD +++E  L   F   GP+ +++V  D   + +  YA+V ++      
Sbjct: 46  DTTSASLYVGELDPSVSEALLYDIFSPIGPVTSIRVCRDAITKTSLGYAYVNFNDHESGR 105

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A + L+   I+G   +I W+ +   +      N+F+ +L+ D+D++ L  TF  F + +
Sbjct: 106 TAIEKLNYSPIKGKPCRIMWSQRDPALRKKGAGNIFIKNLHPDIDNKALHDTFSVFGNIL 165

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
              +  D  +G+S+G+GFV F E + A +A+++  G +LNGR + +
Sbjct: 166 SCKIATDE-TGKSKGFGFVHFEEDNAAVEAVDAINGMMLNGREVYV 210

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 86/187 (45%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV N+D    ED     F   GPI ++ +  D   +   + F+ +    DA  A + L+
Sbjct: 233 VYVKNVDVDTPEDEFTALFSKYGPITSIAMEKDSEGKFRGFGFINFENHDDAAKAVEELN 292

Query: 125 GKQIEGNVIKINWA---------FQSQHVSSD-------DTFNLFVGDLNVDVDDETLTG 168
             + +G  + +  A          + Q+ +S           NLFV +L+  +DDE L  
Sbjct: 293 DLEFKGQKLYVGRAQKKYERLQELKKQYEASRLEKLAKYQGVNLFVKNLDDSIDDEKLEA 352

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  F S   A VM +   G+S+ +GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 353 EFAPFGSITSAKVMRNE-EGKSKNFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 411

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 412 KDVRRSQ 418

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           +L+VG+L+  V +  L   F          V  D ++  S GY +V+F++ +  + A+E 
Sbjct: 51  SLYVGELDPSVSEALLYDIFSPIGPVTSIRVCRDAITKTSLGYAYVNFNDHESGRTAIEK 110

Query: 211 KQGFILNGRAIRINWASKREP 231
                + G+  RI W S+R+P
Sbjct: 111 LNYSPIKGKPCRIMW-SQRDP 130

>Kpol_1032.49 s1032 (111076..112818) [1743 bp, 580 aa] {ON}
           (111076..112818) [1743 nt, 581 aa]
          Length = 580

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           LYVG LD +++E  L   F   GP+++++V  D   + +  YA+V ++      VA + L
Sbjct: 53  LYVGELDPSVSEALLYDIFSPIGPVSSIRVCRDAVTKTSLGYAYVNFNDHDSGKVAIEKL 112

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +   I+G   +I W+ +   +  + + N+F+ +L+ D+D++ L  TF  F + +   +  
Sbjct: 113 NYTPIKGKPCRIMWSQRDPSMRKNGSGNIFIKNLHADIDNKALHDTFSVFGNILSCKIAT 172

Query: 184 DMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQ 235
           D  +G+S+G+GFV F E   A +A+++  G +LNG  + +     R+ ++ +
Sbjct: 173 DE-TGKSKGFGFVHFEEDTAASEAIDAINGMMLNGLEVYVAAHVSRKDRESK 223

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 87/187 (46%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV N+D    E+  ++ F+  GPI ++ +  D   +   + FV Y     A  A   L+
Sbjct: 234 VYVKNVDLEATEEEFEELFKKFGPITSISMEKDSEGKFRGFGFVNYENHESAAKAVDELN 293

Query: 125 GKQIEGNVIKINWAFQS----------------QHVSSDDTFNLFVGDLNVDVDDETLTG 168
             + +   + +  A +                 + ++     NLFV +L+  +DDE L  
Sbjct: 294 DLEFKSQKLYVGRAQKKYERLQELKKQYEEAKLEKMAKYQGVNLFVKNLDDTIDDELLKK 353

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F+ F +     VM +  +G+S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 354 EFESFGTITSVKVMRNE-TGKSKGFGFVCFSSPEEATRAITEKNQQIVAGKPLYVALAQR 412

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 413 KDVRRSQ 419

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 1/88 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D+ +L+VG+L+  V +  L   F          V  D ++  S GY +V+F++ D  + A
Sbjct: 49  DSASLYVGELDPSVSEALLYDIFSPIGPVSSIRVCRDAVTKTSLGYAYVNFNDHDSGKVA 108

Query: 208 MESKQGFILNGRAIRINWASKREPQQHQ 235
           +E      + G+  RI W S+R+P   +
Sbjct: 109 IEKLNYTPIKGKPCRIMW-SQRDPSMRK 135

>KNAG0G01810 Chr7 (401679..403469) [1791 bp, 596 aa] {ON} Anc_8.229
           YER165W
          Length = 596

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 92/169 (54%), Gaps = 2/169 (1%)

Query: 56  GGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPH 114
           G  + +   LYVG LD +++E  L   F   G +A+++V  D   + +  YA+V +    
Sbjct: 40  GDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVNFSDHE 99

Query: 115 DANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFP 174
               A + L+   I+G + +I W+ +   +      N+F+ +LN D+D++ L  TF  F 
Sbjct: 100 AGKQAIEKLNYTPIKGKLCRIMWSQRDPSLRKKGHGNIFIKNLNQDIDNKALFDTFSVFG 159

Query: 175 SFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
           + + + +  D  +G+S+G+GFV F E+  A +A+++  G +LNG+ I +
Sbjct: 160 NILSSKIATDE-TGKSKGFGFVHFEEESAANEAIDALNGMLLNGQEIYV 207

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 87/187 (46%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV N+D    ++  K++F   G + +V +    + +   + FV Y   +DA  A + L+
Sbjct: 230 VYVKNIDLETTDEEFKEFFGKIGTVTSVALERGPDGKLKGFGFVNYEDHNDAVKAVEELN 289

Query: 125 GKQIE------GNVIKINWAFQSQHVSSDDT----------FNLFVGDLNVDVDDETLTG 168
           G + +      G   K     QS     + T           NLFV +L+  +DDE L  
Sbjct: 290 GAEFKDQELFVGRAQKKYERIQSLKKQYESTRLEKMAKYQGVNLFVKNLDDSIDDEKLQE 349

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  F +     VM    +G+S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 350 EFAPFGNITSVKVMR-TENGKSKGFGFVCFSSPEEATKAITEKNQQIVAGKPLYVAIAQR 408

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 409 KDVRRSQ 415

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 140 QSQHVSSDD--TFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVS 197
           +SQ    +D  + +L+VG+L+  V +  L   F    S     V  D ++  S GY +V+
Sbjct: 35  ESQQAGDNDVTSTSLYVGELDPSVSEALLYDLFSPIGSVASIRVCRDAITKTSLGYAYVN 94

Query: 198 FSEQDVAQQAMESKQGFILNGRAIRINWASKREP 231
           FS+ +  +QA+E      + G+  RI W S+R+P
Sbjct: 95  FSDHEAGKQAIEKLNYTPIKGKLCRIMW-SQRDP 127

>CAGL0L11792g Chr12 (1261571..1263310) [1740 bp, 579 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165w PAB1 mRNA polyadenylate-binding protein
          Length = 579

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 98/174 (56%), Gaps = 3/174 (1%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDAN 117
           ET    LYVG+LD +++E  L   F   G +++++V  D   + +  YA+V ++    A 
Sbjct: 31  ETVSASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAK 90

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A + L+   I+G + +I W+ +   +      N+F+ +L+ D+D++ L  TF  F + +
Sbjct: 91  TAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNLHPDIDNKALYDTFSVFGNIL 150

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRIN-WASKRE 230
            + V  D  +G+S+G+G+V F E + A +A+++  G +LNG+ I +    SK+E
Sbjct: 151 SSKVATDE-TGKSKGFGYVHFEEDESASEAIDALNGMLLNGQEIYVGPHLSKKE 203

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 83/187 (44%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +Y+ N++    +   ++     G   +V +      E   + FV +    DA    + L+
Sbjct: 218 VYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELN 277

Query: 125 GKQIEGNVIKINWA----------------FQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
             + +G  + +N A                 + + ++     NLF+ +L+  +DD+ L  
Sbjct: 278 NTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEE 337

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  + +   A VM    +G+S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 338 EFAPYGTITSAKVMTTE-NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 397 KDVRRSQ 403

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 49/92 (53%), Gaps = 5/92 (5%)

Query: 140 QSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFS 199
           QS+ VS+    +L+VGDL+  V +  L   F    +     V  D ++  S GY +V+F+
Sbjct: 29  QSETVSA----SLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFN 84

Query: 200 EQDVAQQAMESKQGFILNGRAIRINWASKREP 231
           + D A+ A+E      + G+  RI W S+R+P
Sbjct: 85  DHDAAKTAIEKLNFTPIKGKLCRIMW-SQRDP 115

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFI--IDFKHYPE---KGCCFIKYDTHEQAAVCIVA 368
           T  YI NI     + +   L+  FG    +  +  PE   KG  F+ +  HE A  C+  
Sbjct: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEE 275

Query: 369 LANFPFQGRNLRTGWGKEK 387
           L N  F+G+ L     ++K
Sbjct: 276 LNNTEFKGQPLYVNRAQKK 294

>YHR086W Chr8 (278153..279724) [1572 bp, 523 aa] {ON}  NAM8RNA
           binding protein, component of the U1 snRNP protein;
           mutants are defective in meiotic recombination and in
           formation of viable spores, involved in the formation of
           DSBs through meiosis-specific splicing of REC107
           pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs
           of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA
           binding domains RRM2 and RRM3 are required for Nam8p
           meiotic function
          Length = 523

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 94/366 (25%), Positives = 144/366 (39%), Gaps = 48/366 (13%)

Query: 51  VLATKGGRE----TSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-- 104
           VL+ +G       T+   LY+G+LD   +++T++Q +   G  AN+ V +  NN   N  
Sbjct: 38  VLSLQGASNVSLGTTGNQLYMGDLDPTWDKNTVRQIWASLGE-ANINVRMMWNNTLNNGS 96

Query: 105 -----------YAFVEY-HQPHDANVAFQTLDGKQIEG---NVIKINWA--------FQS 141
                      Y FV++    H AN   +  +G  I       +K+NWA           
Sbjct: 97  RSSMGPKNNQGYCFVDFPSSTHAANALLK--NGMLIPNFPNKKLKLNWATSSYSNSNNSL 154

Query: 142 QHVSSDDTFNLFVGDLNVDVDDETLTGTF-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSE 200
            +V S +  ++FVGDL  +V +  L   F   + S   A ++ D ++G S+GYGFV F+ 
Sbjct: 155 NNVKSGNNCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTN 214

Query: 201 QDVAQQAMESKQGFILNGRAIRINWASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGIP 260
            D  Q A+   QG  LNGRAI++   S    QQ                   +   R + 
Sbjct: 215 SDEQQLALSEMQGVFLNGRAIKVGPTSG---QQQHVSGNNDYNRSSSSLNNENVDSRFLS 271

Query: 261 QGHPMGSPNNAGPMGMAPQGMAXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGN 320
           +G    S N    MG     M+                     ++        TT +IG 
Sbjct: 272 KGQSFLS-NGNNNMGFKRNHMSQFIYPVQQQ-----------PSLNHFTDPNNTTVFIGG 319

Query: 321 IPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLR 380
           +     E +L    Q FG I+  K    K C F++Y     A   I  +  FP     +R
Sbjct: 320 LSSLVTEDELRAYFQPFGTIVYVKIPVGKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVR 379

Query: 381 TGWGKE 386
             WG+ 
Sbjct: 380 LSWGRS 385

>NDAI0C06100 Chr3 (1406421..1408178) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 102/188 (54%), Gaps = 5/188 (2%)

Query: 49  TPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAF 107
           TP  AT    E S   LYVG+LD +++E  L   F   G +++++V  D   + +  YA+
Sbjct: 29  TPSSATT---ENSSASLYVGDLDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAY 85

Query: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLT 167
           V ++       A + L+   I+G + +I W+ +   +    + N+F+ +L+ D+D++ L 
Sbjct: 86  VNFNDHEAGKKAIEKLNYTPIKGRLCRIMWSQRDPALRKKGSANIFIKNLHSDIDNKALY 145

Query: 168 GTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
            TF  F + + + +  D  +G+S+G+GFV F +   A++A+++  G +LNG+ I +    
Sbjct: 146 DTFSVFGNILSSKIATDE-TGKSKGFGFVHFEDDTAAKEAIDALNGMLLNGQEIFVGPHL 204

Query: 228 KREPQQHQ 235
            R+ +  Q
Sbjct: 205 SRKERDSQ 212

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 88/187 (47%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV N++    ++   + F   G + +  +   ++ +   + FV++    DA  A + L+
Sbjct: 223 IYVKNINLETTDEEFTELFSKYGKVLSAALEKTEDGKLKGFGFVDFENHEDAAKAVEELN 282

Query: 125 GKQIEGNVIKINWA---------FQSQHVSSD-------DTFNLFVGDLNVDVDDETLTG 168
           G Q +   + ++ A          + Q+ +S           NLF+ +L+  +DDE L  
Sbjct: 283 GSQFKDQELFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFIKNLDDSIDDEKLKE 342

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  + +     VM    +G+SRG+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 343 EFAPYGNITSVRVMR-TENGKSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 402 KDVRRSQ 408

>KLLA0C17600g Chr3 (1553322..1555100) [1779 bp, 592 aa] {ON} similar
           to uniprot|P04147 Saccharomyces cerevisiae YER165W PAB1
           Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 592

 Score = 90.5 bits (223), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 86/166 (51%), Gaps = 2/166 (1%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDAN 117
           E ++  LYVG LD  I E  L   F   GPI++++V  D   + +  YA+V Y       
Sbjct: 46  ENNNASLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGK 105

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A Q L+  +I G   +I W+ +   +    + N+F+ +L+  +D++ L  TF  F   +
Sbjct: 106 KAIQELNYAEINGRPCRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVL 165

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
              V  D  +G SRG+GFV F E+  A+ A+E+  G ++NG  + +
Sbjct: 166 SCKVALDE-NGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYV 210

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 57/245 (23%), Positives = 101/245 (41%), Gaps = 35/245 (14%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV N+D    ++  +Q F   G I +  +  D   +   + FV +   + A  A + L+
Sbjct: 233 IYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELN 292

Query: 125 GKQIEGNVIKINWA----------------FQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
           GK+ +   + +  A                ++ + ++     NLF+ +L+  +DDE L  
Sbjct: 293 GKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKE 352

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  + +   A VM D   G S+G+GFV FS  + A +AM  K   I+ G+ + +  A +
Sbjct: 353 EFAPYGTITSARVMRDQ-EGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQR 411

Query: 229 REPQQHQXXXXXXXXXXXXXXXXXH----------------QQFRGI--PQGHPMGSPNN 270
           ++ ++ Q                                  Q F G+  P+G P  +P  
Sbjct: 412 KDVRRSQLAQQIQARNQIRFQQQQQQQAAAAAAGMPGQYMPQMFYGVMAPRGFPGPNPGM 471

Query: 271 AGPMG 275
            GPMG
Sbjct: 472 NGPMG 476

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 46/85 (54%), Gaps = 1/85 (1%)

Query: 147 DDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQ 206
           ++  +L+VG+L+ ++ +  L   F          V  D ++  S GY +V++++ +  ++
Sbjct: 47  NNNASLYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKK 106

Query: 207 AMESKQGFILNGRAIRINWASKREP 231
           A++      +NGR  RI W S+R+P
Sbjct: 107 AIQELNYAEINGRPCRIMW-SERDP 130

>Ecym_5562 Chr5 (1143566..1145308) [1743 bp, 580 aa] {ON} similar to
           Ashbya gossypii AGR122C
          Length = 580

 Score = 90.5 bits (223), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 94/178 (52%), Gaps = 2/178 (1%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDAN 117
           ETS   LYVG LD +++E  L   F   G +++++V  D   N    YA+V +H      
Sbjct: 34  ETSGASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGR 93

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A + L+   I+G   +I W+ +   +    + N+++ +L+  +D+++L  TF  F + +
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNIL 153

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQ 235
              V  D  +G SRG+GFV F  +  A+ A+E+  G ++N + + + W   ++ +Q +
Sbjct: 154 SCKVATDD-NGVSRGFGFVHFENESDARDAIEAVNGMLMNDQEVYVAWHVSKKDRQSK 210

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 86/201 (42%), Gaps = 22/201 (10%)

Query: 46  SQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANY 105
           SQ  P L  KG        +Y+ NL  AI+  +L + F   G I + KV  D N     +
Sbjct: 114 SQRDPSLRKKGSGN-----IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDDNGVSRGF 168

Query: 106 AFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDT-----------FNLFV 154
            FV +    DA  A + ++G  +    + + W     HVS  D             N++V
Sbjct: 169 GFVHFENESDARDAIEAVNGMLMNDQEVYVAW-----HVSKKDRQSKLEEVKAKFTNIYV 223

Query: 155 GDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGF 214
            +++++   E     F ++     A +  D   G+ RG+GF++F +   A +A++     
Sbjct: 224 KNIDLETSQEEFEQLFSKYGKITSAVLEKDS-EGKLRGFGFINFEDHSTAARAVDELNES 282

Query: 215 ILNGRAIRINWASKREPQQHQ 235
              G+ + +  A K+  +Q +
Sbjct: 283 DFRGQTLYVGRAQKKHERQQE 303

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 84/188 (44%), Gaps = 19/188 (10%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV N+D   +++  +Q F   G I +  +  D   +   + F+ +     A  A   L+
Sbjct: 221 IYVKNIDLETSQEEFEQLFSKYGKITSAVLEKDSEGKLRGFGFINFEDHSTAARAVDELN 280

Query: 125 GKQIEGNVIKINWAFQSQH-----------------VSSDDTFNLFVGDLNVDVDDETLT 167
                G  + +  A Q +H                 ++     NLF+ +L+  +DDE L 
Sbjct: 281 ESDFRGQTLYVGRA-QKKHERQQELKKQYETARLEKLAKYQGVNLFIKNLDDSIDDEKLK 339

Query: 168 GTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
             F  F +     VM D  +G SRG+GFV FS  + A +A+  K   ++ G+ + +  A 
Sbjct: 340 DEFAPFGTITSVKVMKDE-AGSSRGFGFVCFSTPEEATKAITEKNQQLVAGKPLYVAIAQ 398

Query: 228 KREPQQHQ 235
           ++E +++Q
Sbjct: 399 RKEVRRNQ 406

>TDEL0A01350 Chr1 complement(240288..242054) [1767 bp, 588 aa] {ON}
           Anc_8.229 YER165W
          Length = 588

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 97/176 (55%), Gaps = 3/176 (1%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDAN 117
           ETS   LYVG LD +++E  L   F   G +++++V  D   + +  YA+V ++      
Sbjct: 38  ETSSASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGK 97

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A + L+   I+G   +I W+ +   +    + N+F+ +L+ D+D++ L  TF  F + +
Sbjct: 98  TAIEKLNYAPIKGVPCRIMWSQRDPSMRKKGSGNIFIKNLHPDIDNKALHDTFSVFGNIL 157

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI-NWASKREPQ 232
              +  D  +G SRG+GFV F + + A++A+++  G +LNG+ + +    SK++ Q
Sbjct: 158 SCKIATDE-AGNSRGFGFVHFEDDEAAKEAIDAINGMLLNGQEVYVAQHVSKKDRQ 212

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 86/187 (45%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV N+     ++  +++F   GPI +  +  D   +   + FV Y   +DA  A + L+
Sbjct: 225 VYVKNIHPDTGDEEFEEFFTKVGPITSAHLEKDNEGKLRGFGFVNYENHNDAAKAVEELN 284

Query: 125 GKQIEGNVIKINW----------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
               +G  + +                  AF+ + +      NLFV +L+  +DD+ L  
Sbjct: 285 ETDFKGQTLHVGRAQKKHERLQELKKQYEAFRLEKLEKYQGVNLFVKNLDDTIDDQKLEE 344

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  + +     VM    +G+S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 345 EFAPYGTITSVKVMRSE-NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 403

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 404 KDVRRSQ 410

>YER165W Chr5 (510373..512106) [1734 bp, 577 aa] {ON}  PAB1Poly(A)
           binding protein, part of the 3'-end RNA-processing
           complex, mediates interactions between the 5' cap
           structure and the 3' mRNA poly(A) tail, involved in
           control of poly(A) tail length, interacts with
           translation factor eIF-4G
          Length = 577

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 94/166 (56%), Gaps = 2/166 (1%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDAN 117
           E S   LYVG+L+ +++E  L   F   G +++++V  D   + +  YA+V ++      
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A + L+   I+G + +I W+ +   +    + N+F+ +L+ D+D++ L  TF  F   +
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDIL 153

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
            + +  D  +G+S+G+GFV F E+  A++A+++  G +LNG+ I +
Sbjct: 154 SSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 93/187 (49%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           LYV N++    ++  ++ F   GPI +  +  D + +   + FV Y +  DA  A + L+
Sbjct: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALN 280

Query: 125 GKQIEG---------------NVIKINW-AFQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
             ++ G               +V+K  + A++ + ++     NLFV +L+  VDDE L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  + +   A VM    +G+S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 400 KDVRRSQ 406

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 2/92 (2%)

Query: 140 QSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFS 199
           +SQ V  + + +L+VGDL   V +  L   F    S     V  D ++  S GY +V+F+
Sbjct: 29  ESQSVE-NSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFN 87

Query: 200 EQDVAQQAMESKQGFILNGRAIRINWASKREP 231
           + +  ++A+E      + GR  RI W S+R+P
Sbjct: 88  DHEAGRKAIEQLNYTPIKGRLCRIMW-SQRDP 118

>Smik_5.337 Chr5 (509907..511640) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 94/166 (56%), Gaps = 2/166 (1%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDAN 117
           E S   LYVG+L+ +++E  L   F   G +++++V  D   + +  YA+V ++      
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A + L+   I+G + +I W+ +   +    + N+F+ +L+ D+D++ L  TF  F   +
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDIL 153

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
            + +  D  +G+S+G+GFV F E+  A++A+++  G +LNG+ I +
Sbjct: 154 SSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 93/187 (49%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           LYV N++    ++  ++ F   GPI +  +  D + +   + FV Y    DA  A +TL+
Sbjct: 221 LYVKNINSETTDEQFQELFAQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVETLN 280

Query: 125 GKQIEG---------------NVIKINW-AFQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
             ++ G               +V+K  + A++ + ++     NLFV +L+  VDDE L  
Sbjct: 281 DSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  + +   A VM    +G+S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 400 KDVRRSQ 406

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 147 DDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQ 206
           + + +L+VGDL   V +  L   F    S     V  D ++  S GY +V+F++ +  ++
Sbjct: 35  NSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRK 94

Query: 207 AMESKQGFILNGRAIRINWASKREP 231
           A+E      + GR  RI W S+R+P
Sbjct: 95  AIEQLNYTPIKGRLCRIMW-SQRDP 118

>Ecym_8010 Chr8 (22168..23976) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii ADR307W
          Length = 602

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 100/181 (55%), Gaps = 11/181 (6%)

Query: 57  GRETSDRILYVGNLDKAINEDTLKQ-YFQVGGPIANVKVLVDKNNEEAN---YAFVEYHQ 112
           G ET+   LY+G+LD +  E+ +KQ +  +G P  NV+V + KN+   N   Y FVE+  
Sbjct: 47  GPETTSTQLYMGDLDASWTENDIKQIWATLGEP--NVQVKLIKNSGPMNNSGYCFVEFPS 104

Query: 113 PHDA-NVAFQTLDGKQIE-GNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF 170
              A N   +T     ++    +K+NWA  S   +    F++FVGDL  +V +  L   F
Sbjct: 105 NLSATNALLKTGLPIPVDPSRSLKLNWA--SFATAPGTEFSIFVGDLAPNVSESQLFELF 162

Query: 171 -KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
              + S + A +++D ++G S+GYGFV F  +   Q+++   QG  LNGRAIR++  SK 
Sbjct: 163 ISRYSSTLNAKIVFDQVTGVSKGYGFVKFGNEAEQQRSLVEMQGVFLNGRAIRVSTTSKN 222

Query: 230 E 230
           +
Sbjct: 223 K 223

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  +  FP
Sbjct: 286 TTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAKMQGFP 345

Query: 374 FQGRNLRTGWGKE 386
                +R  WG+ 
Sbjct: 346 IGNSRIRLSWGRS 358

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           +  +++G L   + E+ L+ YFQ  G I  VK+ V K        FV+Y     A  A  
Sbjct: 285 NTTVFIGGLSSLVTEEELRAYFQPFGQIVYVKIPVGK-----GCGFVQYVDRSSAENAIA 339

Query: 122 TLDGKQIEGNVIKINWA 138
            + G  I  + I+++W 
Sbjct: 340 KMQGFPIGNSRIRLSWG 356

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 7/86 (8%)

Query: 141 SQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSE 200
           SQ    ++T  +F+G L+  V +E L   F+ F   +   +         +G GFV + +
Sbjct: 278 SQFTDPNNT-TVFIGGLSSLVTEEELRAYFQPFGQIVYVKIP------VGKGCGFVQYVD 330

Query: 201 QDVAQQAMESKQGFILNGRAIRINWA 226
           +  A+ A+   QGF +    IR++W 
Sbjct: 331 RSSAENAIAKMQGFPIGNSRIRLSWG 356

>Skud_5.304 Chr5 (495460..497193) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 94/166 (56%), Gaps = 2/166 (1%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDAN 117
           E S   LYVG+L+ +++E  L   F   G +++++V  D   + +  YA+V ++      
Sbjct: 34  ENSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A + L+   I+G + +I W+ +   +    + N+F+ +L+ D+D++ L  TF  F   +
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDIL 153

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
            + +  D  +G+S+G+GFV F E+  A++A+++  G +LNG+ I +
Sbjct: 154 SSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYV 198

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 90/187 (48%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           LYV N++    ++  +  F   GPI +  +  D + +   + FV Y    DA  A + L+
Sbjct: 221 LYVKNINSETTDEQFQDLFIQFGPIVSASLEKDADGKLKGFGFVNYENHEDAVKAVEALN 280

Query: 125 GKQIEG---------------NVIKINW-AFQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
              + G               +V+K  + A++ + ++     NLFV +L+  VDDE L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEE 340

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  + +   A VM    +G+S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 341 EFTPYGTITSAKVMR-TENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 400 KDVRRSQ 406

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 147 DDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQ 206
           + + +L+VGDL   V +  L   F    S     V  D ++  S GY +V+F++ +  ++
Sbjct: 35  NSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRK 94

Query: 207 AMESKQGFILNGRAIRINWASKREP 231
           A+E      + GR  RI W S+R+P
Sbjct: 95  AIEQLNYTPIKGRLCRIMW-SQRDP 118

>TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.229
           YER165W
          Length = 577

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 91/160 (56%), Gaps = 2/160 (1%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           LYVG LD +++E  L   F   G +++++V  D   + +  YA+V ++       A + L
Sbjct: 45  LYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAIEKL 104

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +   I+G   +I W+ +   +    + N+F+ +L+ D+D++TL  TF  F + +   +  
Sbjct: 105 NYTAIKGRPCRIMWSQRDPSMRKKGSGNIFIKNLHPDIDNKTLYETFSVFGNILSCKIAN 164

Query: 184 DMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
           D  +G+S+G+GFV F  ++ A++A+++  G +LNG+ + +
Sbjct: 165 DE-TGKSKGFGFVHFENEEAAREAIDAINGMLLNGQEVYV 203

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 89/187 (47%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV NLD    E+  +  F+  G I +V +  D   +   + FV++    DA  A + L+
Sbjct: 226 VYVKNLDLEATEEDFENLFKPYGTITSVALEKDAEGKSRGFGFVDFENHEDAVKAVEALN 285

Query: 125 GKQIEGNVIKINWA---------FQSQHVSSD-------DTFNLFVGDLNVDVDDETLTG 168
             + +G  + +  A          + Q+ +S           NLF+ +L+  +DDE L  
Sbjct: 286 DTEYKGQTLYVGRAQKKYERLQELKKQYQASKLEKLAKYQGINLFIKNLDDSIDDEKLKE 345

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  F +   A VM    +G+S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 346 EFAPFGTITSARVMR-TENGKSKGFGFVCFSTPEEATRAITEKNQQIVAGKPLYVAIAQR 404

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 405 KDVRRSQ 411

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 149 TFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAM 208
           T +L+VG+L+  V +  L   F    S     V  D ++  S GY +V+F++ +  + A+
Sbjct: 42  TASLYVGELDPSVSEALLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGKTAI 101

Query: 209 ESKQGFILNGRAIRINWASKREPQQHQ 235
           E      + GR  RI W S+R+P   +
Sbjct: 102 EKLNYTAIKGRPCRIMW-SQRDPSMRK 127

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 89/166 (53%), Gaps = 2/166 (1%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDAN 117
           +TS   LYVG LD  + E  L   F   G +++++V  D   + +  YA+V +H      
Sbjct: 36  DTSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGR 95

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A Q L+   I+G   +I W+ +   +    + N+F+ +L+  +D++ L  TF  F + +
Sbjct: 96  TAIQKLNYTTIKGRPCRIMWSQRDPSLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNIL 155

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
              +  D  +G S+G+GFV F E+  A++A+++  G +LNG+ + +
Sbjct: 156 SCKIATDE-AGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 81/187 (43%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV N+D    ++  +  F   G I +  +  D   +   + F+ +     A  A   L+
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELN 282

Query: 125 GKQIEGNVIKINWAFQS----------------QHVSSDDTFNLFVGDLNVDVDDETLTG 168
               +   + +  A +                 + ++     NLFV +L+  +DDE L  
Sbjct: 283 DTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRD 342

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  F +   A VM D  +G S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 343 EFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 402 KDVRRSQ 408

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 1/81 (1%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           +L+VG+L+  V +  L   F    S     V  D ++  S GY +V+F + D  + A++ 
Sbjct: 41  SLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQK 100

Query: 211 KQGFILNGRAIRINWASKREP 231
                + GR  RI W S+R+P
Sbjct: 101 LNYTTIKGRPCRIMW-SQRDP 120

>ADR307W Chr4 (1238221..1239921) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR086W (NAM8)
          Length = 566

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 98/180 (54%), Gaps = 9/180 (5%)

Query: 57  GRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNE---EANYAFVEYHQP 113
           G +TS   LY+G+LD +  E  +KQ +   G  ANV+V + KN+     + Y FVE+   
Sbjct: 46  GADTSSTQLYMGDLDPSWTEGDIKQIWATLGE-ANVQVKLIKNSSGGGNSGYCFVEFPSN 104

Query: 114 HDA-NVAFQTLDGKQIEGN-VIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF- 170
             A N   +T     ++ +  +K+NWA  S   +    F++FVGDL  +V +  L   F 
Sbjct: 105 LAATNALLKTGLPIPVDASRTLKLNWA--SFATTPGSEFSIFVGDLAPNVTESQLFELFI 162

Query: 171 KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKRE 230
             + S + A +++D  +G S+GYGFV F  +   Q+++   QG  LNGRAIR++  SK +
Sbjct: 163 SRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNK 222

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  +  FP
Sbjct: 282 TTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGKGCGFVQYVDRSSAENAIAKMQGFP 341

Query: 374 FQGRNLRTGWGKE 386
                +R  WG+ 
Sbjct: 342 IGNSRVRLSWGRS 354

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           +  +++G L   + ED L+ YFQ  G I  VK+ V K        FV+Y     A  A  
Sbjct: 281 NTTVFIGGLSSLVTEDELRAYFQPFGQIVYVKIPVGK-----GCGFVQYVDRSSAENAIA 335

Query: 122 TLDGKQIEGNVIKINWAFQSQHVSS 146
            + G  I  + ++++W   ++  ++
Sbjct: 336 KMQGFPIGNSRVRLSWGRSAKQTAA 360

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +F+G L+  V ++ L   F+ F   +   +         +G GFV + ++  A+ A+   
Sbjct: 284 VFIGGLSSLVTEDELRAYFQPFGQIVYVKIP------VGKGCGFVQYVDRSSAENAIAKM 337

Query: 212 QGFILNGRAIRINWA 226
           QGF +    +R++W 
Sbjct: 338 QGFPIGNSRVRLSWG 352

>Suva_5.299 Chr5 (478113..479846) [1734 bp, 577 aa] {ON} YER165W
           (REAL)
          Length = 577

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 93/166 (56%), Gaps = 2/166 (1%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDAN 117
           E S   LYVG+L+ A++E  L   F   G +++++V  D   + +  YA+V ++      
Sbjct: 34  ENSSASLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGR 93

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A + L+   I+G + +I W+ +   +    + N+F+ +L+ D+D++ L  TF  F   +
Sbjct: 94  KAIEQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDIL 153

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
            + +  D  +G S+G+GFV F E+  A++A+++  G +LNG+ I +
Sbjct: 154 SSKIATDE-NGNSKGFGFVHFEEEVAAKEAIDALNGMLLNGQEIYV 198

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 91/187 (48%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           LYV N++    ++  ++ F   GPI +  +  D + +   + FV Y    DA  A + L+
Sbjct: 221 LYVKNINSETTDEQFQEMFVKFGPIVSASLEKDADGQLKGFGFVNYENHEDAVKAVEALN 280

Query: 125 GKQIEG---------------NVIKINW-AFQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
              + G               +V+K  + A++ + ++     NLFV +L+  VDDE L  
Sbjct: 281 ESDLNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDTVDDEKLEE 340

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  + +   A VM    +G+S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 341 EFAPYGTITSAKVMRSE-NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 400 KDVRRSQ 406

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 147 DDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQ 206
           + + +L+VGDL   V +  L   F    S     V  D ++  S GY +V+F++ +  ++
Sbjct: 35  NSSASLYVGDLEPAVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRK 94

Query: 207 AMESKQGFILNGRAIRINWASKREP 231
           A+E      + GR  RI W S+R+P
Sbjct: 95  AIEQLNYTPIKGRLCRIMW-SQRDP 118

>NDAI0C01820 Chr3 complement(398027..399523) [1497 bp, 498 aa] {ON}
           Anc_5.382
          Length = 498

 Score = 87.8 bits (216), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/338 (24%), Positives = 134/338 (39%), Gaps = 27/338 (7%)

Query: 65  LYVGNLDKAINEDTLKQYFQ-VGGPIANVKVLVDKN-NEEANYAFVEY-HQPHDANVAFQ 121
           +Y+G LD    E T+K  ++ +G  + NVK++ +KN      Y F+E+  + H +N   +
Sbjct: 72  IYMGELDPTWTEATIKSIWKSLGEELINVKLIWNKNLGLNQGYCFIEFPSEQHASNALLK 131

Query: 122 T-LDGKQIEGNVIKINWAF-----------QSQHVSSDDTFNLFVGDLNVDVDDETLTGT 169
             ++  +     +K+NW               Q  S+   +++FVGDL  +V +  L   
Sbjct: 132 NGINIPEFPRKKVKLNWTSSSSASLQGSSNSGQVPSTSTNYSVFVGDLAANVTEGQLFDL 191

Query: 170 F-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
           F   F S   A ++ D ++  S+ YGFV F++    Q+A+   QG  LNGRAI+I   + 
Sbjct: 192 FISRFQSTCHAKIVHDPVTRASKCYGFVKFNDLRDQQRALVEMQGIFLNGRAIKIGTTTG 251

Query: 229 REPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGPMGMAPQGMAXXXXXX 288
                +                    +F+G     P  SP N G    +   +       
Sbjct: 252 GSAHTN---TDNNALAPNIANSGGKSRFQGTTTNSP-SSPANIGRGNTSNYRLTSLSSQF 307

Query: 289 XXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPE 348
                         +          TT ++G +     E  L    Q FG II  K    
Sbjct: 308 IFPVQQQPPLNHFTDP-------NNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIG 360

Query: 349 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKE 386
           KGC F++Y     A   I+ +  FP     +R  WG+ 
Sbjct: 361 KGCGFVQYFDRISAETAILRMQGFPIGNSRIRLSWGRS 398

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 143 HVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           H +  +   +FVG L+  V +E L   F+ F + I   +         +G GFV + ++ 
Sbjct: 319 HFTDPNNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPI------GKGCGFVQYFDRI 372

Query: 203 VAQQAMESKQGFILNGRAIRINWASKREPQ 232
            A+ A+   QGF +    IR++W      Q
Sbjct: 373 SAETAILRMQGFPIGNSRIRLSWGRSSRQQ 402

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  ++VG L   + E+ L+  FQ  G I  VK+ + K        FV+Y     A  A 
Sbjct: 324 NNTTVFVGGLSSMVTEEQLRHCFQPFGTIIYVKIPIGK-----GCGFVQYFDRISAETAI 378

Query: 121 QTLDGKQIEGNVIKINWAFQSQ 142
             + G  I  + I+++W   S+
Sbjct: 379 LRMQGFPIGNSRIRLSWGRSSR 400

>NCAS0A03680 Chr1 complement(738305..740032) [1728 bp, 575 aa] {ON}
           Anc_8.229
          Length = 575

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 90/160 (56%), Gaps = 2/160 (1%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           LYVG LD  ++E  L   F   G +++++V  D   + +  YA+V ++       A + L
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +   I+G + +I W+ +   +    + N+F+ +L+ D+D++ L  TF  F + + + +  
Sbjct: 97  NYTPIKGRLCRIMWSQRDPALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIAT 156

Query: 184 DMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
           D  +G+S+G+GFV F  +  A++A+++  G +LNG+ I +
Sbjct: 157 DE-TGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 89/187 (47%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV N++    ++   + F   G + +  +   ++ +   + FV++ +  DA  A + L+
Sbjct: 218 VYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELN 277

Query: 125 GKQIEGNVIKINWA---------FQSQHVSSD-------DTFNLFVGDLNVDVDDETLTG 168
           G + +   + ++ A          + Q+ +S           NLFV +L+  +DDE L  
Sbjct: 278 GTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKE 337

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  + +     VM    +G+S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 338 EFAPYGTITSVRVMR-TDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 396

Query: 229 REPQQHQ 235
           ++ ++ Q
Sbjct: 397 KDVRRSQ 403

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           +L+VG+L+  V +  L   F    S     V  D ++  S GY +V+F++ +  ++A+E 
Sbjct: 36  SLYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQ 95

Query: 211 KQGFILNGRAIRINWASKREP 231
                + GR  RI W S+R+P
Sbjct: 96  LNYTPIKGRLCRIMW-SQRDP 115

>Kwal_55.20154 s55 complement(274557..276125) [1569 bp, 522 aa] {ON}
           YHR086W (NAM8) - putative RNA binding protein, involved
           in meiosis-specific splicing of the REC107 transcripts
           in cooperation with the Mer1 protein [contig 153] FULL
          Length = 522

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 97/182 (53%), Gaps = 12/182 (6%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQ-YFQVGGPIANVKVLVDKNN--EEANYAFVEYHQPHD 115
            T    LY+G+LD   +E  ++  +  +G P   +K++    +    + Y FVE+  P  
Sbjct: 41  STRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEF--PSH 98

Query: 116 ANVAFQTLDGKQI---EGN-VIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF- 170
            N +   L    +    GN ++K+NWA  S   +  + +++FVGD+  +V +  L   F 
Sbjct: 99  TNASNALLKNGLVIPNTGNRILKLNWA--SFATTPGNEYSVFVGDVAPNVTEAQLFELFI 156

Query: 171 KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKRE 230
             + S + A +++D ++G S+GYGFV F ++   Q+++   QG  LNGRAIR++  SK  
Sbjct: 157 SRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSKNR 216

Query: 231 PQ 232
           P+
Sbjct: 217 PK 218

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  +  FP
Sbjct: 273 TTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGKGCGFVQYVDRLSAETAIAKMQGFP 332

Query: 374 FQGRNLRTGWGKE 386
                +R  WG+ 
Sbjct: 333 IGNSRIRLSWGRS 345

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           +  +++G L   + ED L+ +FQ  G I  VK+ V K        FV+Y     A  A  
Sbjct: 272 NTTVFIGGLSSLVTEDELRAFFQPFGSIVYVKIPVGK-----GCGFVQYVDRLSAETAIA 326

Query: 122 TLDGKQIEGNVIKINWA 138
            + G  I  + I+++W 
Sbjct: 327 KMQGFPIGNSRIRLSWG 343

 Score = 37.0 bits (84), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 141 SQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSE 200
           +Q+   ++T  +F+G L+  V ++ L   F+ F S +   +         +G GFV + +
Sbjct: 265 TQYTDPNNT-TVFIGGLSSLVTEDELRAFFQPFGSIVYVKI------PVGKGCGFVQYVD 317

Query: 201 QDVAQQAMESKQGFILNGRAIRINWA 226
           +  A+ A+   QGF +    IR++W 
Sbjct: 318 RLSAETAIAKMQGFPIGNSRIRLSWG 343

>CAGL0H02123g Chr8 complement(188454..190121) [1668 bp, 555 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086w NAM8 meiotic recombination protein
          Length = 555

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 66/191 (34%), Positives = 99/191 (51%), Gaps = 22/191 (11%)

Query: 57  GRETSDRILYVGNLDKAINEDTLKQ-YFQVGGPIANVKVL----VDKNNEEANYAFVEYH 111
           G  T    LY+G+LD + +E  +K  +  +G     V+++     D + +   Y FVE+ 
Sbjct: 78  GASTPGSQLYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFP 137

Query: 112 QPHDANVAFQTLDGKQIEGNV---IKINWAFQSQH-----------VSSDDTFN-LFVGD 156
            P  A+ A    +G +I G V   +K+NW+ QS +           V++  T N +FVGD
Sbjct: 138 SPAHASNALMK-NGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGD 196

Query: 157 LNVDVDDETLTGTF-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI 215
           L   V +  L   F  ++PS + A VM+D L+G S+GYGFV F      Q+A+   QG  
Sbjct: 197 LAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCF 256

Query: 216 LNGRAIRINWA 226
           LNGRAI+I  A
Sbjct: 257 LNGRAIKIGIA 267

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT ++G +     E +L    + FG II  K    KGC F++Y     A   I  +  FP
Sbjct: 327 TTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAETAITKMQGFP 386

Query: 374 FQGRNLRTGWGK--EKPAFIPNGMV 396
                +R  WG+  +K A I   ++
Sbjct: 387 IANSRVRLSWGRSAKKTALIQKALL 411

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 143 HVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           H +  +   +FVG L+  V ++ L   F+ F + I   +         +G GFV + E+ 
Sbjct: 320 HFTDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIP------AGKGCGFVQYVERS 373

Query: 203 VAQQAMESKQGFILNGRAIRINWA 226
            A+ A+   QGF +    +R++W 
Sbjct: 374 SAETAITKMQGFPIANSRVRLSWG 397

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  ++VG L   + ED L+ YF+  G I  VK+   K        FV+Y +   A  A 
Sbjct: 325 NNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPAGK-----GCGFVQYVERSSAETAI 379

Query: 121 QTLDGKQIEGNVIKINWAFQSQHVS 145
             + G  I  + ++++W   ++  +
Sbjct: 380 TKMQGFPIANSRVRLSWGRSAKKTA 404

>KAFR0B02500 Chr2 (494025..495773) [1749 bp, 582 aa] {ON} Anc_8.229
           YER165W
          Length = 582

 Score = 84.3 bits (207), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 99/183 (54%), Gaps = 4/183 (2%)

Query: 44  DQSQVTPVLATKGGR--ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNE 101
           D+ Q  P      G+  +++   LYVG+LD +++E  L   F   G + +++V  D   +
Sbjct: 19  DEQQNAPSSTGSEGQQSDSNSTSLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITK 78

Query: 102 EA-NYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVD 160
            +  YA+V +       VA + L+   I+G + +I W+ +   +      N+F+ +LN D
Sbjct: 79  TSLGYAYVNFADHEAGKVAIERLNYTPIKGRLCRIMWSQRDPALRKKGNGNIFIKNLNAD 138

Query: 161 VDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRA 220
           +D++ L  TF  F + + + +  D  +G S+G+GFV F E+  A++A+++  G +LNG+ 
Sbjct: 139 IDNKALYDTFSVFGNILSSKIATDE-NGNSKGFGFVHFEEEAAAKEAIDALNGMLLNGQE 197

Query: 221 IRI 223
           I +
Sbjct: 198 IYV 200

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 68/147 (46%), Gaps = 17/147 (11%)

Query: 105 YAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQS----------------QHVSSDD 148
           + FV Y    DA  A + L+  + +G  + +  A +                 + ++   
Sbjct: 263 FGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKKYERMQALKQQYEATRLEKMAKYQ 322

Query: 149 TFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAM 208
             NLF+ +L+  +DDE L   F  F +     VM    +G+S+G+GFV FS  + A +A+
Sbjct: 323 GVNLFIKNLDDSIDDEKLKEEFAPFGTITSTKVMRTE-NGKSKGFGFVCFSSPEEATKAI 381

Query: 209 ESKQGFILNGRAIRINWASKREPQQHQ 235
             K   I+ G+ + +  A ++E ++ Q
Sbjct: 382 TEKNQQIVAGKPLYVAIAQRKEVRRSQ 408

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 145 SSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVA 204
           S  ++ +L+VGDL+  V +  L   F    S     V  D ++  S GY +V+F++ +  
Sbjct: 35  SDSNSTSLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKTSLGYAYVNFADHEAG 94

Query: 205 QQAMESKQGFILNGRAIRINWASKREP 231
           + A+E      + GR  RI W S+R+P
Sbjct: 95  KVAIERLNYTPIKGRLCRIMW-SQRDP 120

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (52%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           L++ NLD +I+++ LK+ F   G I + KV+  +N +   + FV +  P +A  A    +
Sbjct: 326 LFIKNLDDSIDDEKLKEEFAPFGTITSTKVMRTENGKSKGFGFVCFSSPEEATKAITEKN 385

Query: 125 GKQIEGNVIKINWA 138
            + + G  + +  A
Sbjct: 386 QQIVAGKPLYVAIA 399

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 33/87 (37%), Gaps = 6/87 (6%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEK------GCCFIKYDTHEQAAVCIV 367
           T+ Y+G++     E  L  +    G +   +   +       G  ++ +  HE   V I 
Sbjct: 40  TSLYVGDLDPSVSEALLYDIFSPIGSVTSIRVCRDAITKTSLGYAYVNFADHEAGKVAIE 99

Query: 368 ALANFPFQGRNLRTGWGKEKPAFIPNG 394
            L   P +GR  R  W +  PA    G
Sbjct: 100 RLNYTPIKGRLCRIMWSQRDPALRKKG 126

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 349 KGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKEK 387
           KG  F+ Y+ HE A   +  L N  F+G+ L  G  ++K
Sbjct: 261 KGFGFVNYENHEDALKAVEELNNTEFKGQELYVGRAQKK 299

>AGR122C Chr7 complement(978628..980385) [1758 bp, 585 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER165W
           (PAB1)
          Length = 585

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 92/178 (51%), Gaps = 2/178 (1%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDAN 117
           ETS   LYVG L+  ++E  L   F   G +++++V  D   N    YA+V +H      
Sbjct: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
            A + L+   I+G   +I W+ +   +    + N+++ +L+  +D+++L  TF  F + +
Sbjct: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNIL 153

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQ 235
              V  D  +G SRG+GFV F  +  A+ A+E+  G ++N + + +     ++ +Q +
Sbjct: 154 SCKVATDE-NGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSK 210

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 87/187 (46%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV N+D+  +++  ++ F   G I +  +  D   +   + FV +     A  A   L+
Sbjct: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280

Query: 125 GKQIEGNVIKINWAFQS----------------QHVSSDDTFNLFVGDLNVDVDDETLTG 168
             + +G  + +  A +                 + ++     NLFV +L+  +DDE L  
Sbjct: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  F +   A VM D  +G SRG+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 341 EFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399

Query: 229 REPQQHQ 235
           +E +++Q
Sbjct: 400 KEVRRNQ 406

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 83/195 (42%), Gaps = 22/195 (11%)

Query: 46  SQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANY 105
           SQ  P L  KG        +Y+ NL  AI+  +L + F   G I + KV  D+N     +
Sbjct: 114 SQRDPSLRKKGSGN-----IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGF 168

Query: 106 AFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDT-----------FNLFV 154
            FV +    DA  A + +DG  +    + +     + HVS  D             N++V
Sbjct: 169 GFVHFENESDARDAIEAVDGMLMNDQEVYV-----ALHVSKKDRQSKLEEVKAKFTNVYV 223

Query: 155 GDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGF 214
            +++ +   E     F ++     A +  D   G+ RG+GFV+F +   A +A++     
Sbjct: 224 KNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNFEDHAAAAKAVDELNEL 282

Query: 215 ILNGRAIRINWASKR 229
              G+ + +  A K+
Sbjct: 283 EFKGQKLYVGRAQKK 297

>SAKL0G08118g Chr7 complement(689908..691545) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q759G9 Ashbya gossypii ADR307W
           ADR307Wp and some similarites with YHR086W
           uniprot|Q00539 Saccharomyces cerevisiae YHR086W NAM8 RNA
           binding protein component of the U1 snRNP protein
           mutants are defective in meiotic recombination and in
           formation of viable spores involved in the formation of
           DSBs through meiosis-specific splicing of MER2 pre-mRNA
          Length = 545

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 96/176 (54%), Gaps = 12/176 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKN----NEEANYAFVEYHQPHDANVAF 120
           LY+G+LD + +E ++K  +   G   N+ V + +N       + + FVE+    +A+ A 
Sbjct: 57  LYMGDLDPSWDESSIKSIWSSLGE-QNILVKLIRNAGTTTTNSGFCFVEFPSHLNASNAL 115

Query: 121 QTLDGKQIEGNV---IKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF-KEFPSF 176
              +G  +   V   +K+NWA  S   +  + +++FVGDL  +V +  L   F   + S 
Sbjct: 116 LK-NGLPVPNAVNKFLKLNWA--SISTTPGNEYSIFVGDLAPNVTEAQLFELFISRYSST 172

Query: 177 IQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQ 232
           + + +++D L+G S+GYGFV F  +    +A+   QG  LNGRAIR++  SK +P+
Sbjct: 173 LNSKIVFDQLTGVSKGYGFVKFGNEAEQHRALLEMQGVFLNGRAIRVSTTSKNKPK 228

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  +  FP
Sbjct: 281 TTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGKGCGFVQYIDRISAETAIAKMQGFP 340

Query: 374 FQGRNLRTGWGKE 386
                +R  WG+ 
Sbjct: 341 IGNSRIRLSWGRS 353

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           +  +++G L   + ED L+ YFQ  G I  VK+ V K        FV+Y     A  A  
Sbjct: 280 NTTVFIGGLSSLVTEDELRTYFQPFGSIVYVKIPVGK-----GCGFVQYIDRISAETAIA 334

Query: 122 TLDGKQIEGNVIKINWA 138
            + G  I  + I+++W 
Sbjct: 335 KMQGFPIGNSRIRLSWG 351

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 9/86 (10%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +F+G L+  V ++ L   F+ F S +   +         +G GFV + ++  A+ A+   
Sbjct: 283 VFIGGLSSLVTEDELRTYFQPFGSIVYVKI------PVGKGCGFVQYIDRISAETAIAKM 336

Query: 212 QGFILNGRAIRINW---ASKREPQQH 234
           QGF +    IR++W   A +    QH
Sbjct: 337 QGFPIGNSRIRLSWGRSAKQTAAMQH 362

>AAR151W Chr1 (617434..618879) [1446 bp, 481 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR212W (NGR1)
          Length = 481

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 87/384 (22%), Positives = 142/384 (36%), Gaps = 69/384 (17%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNN---------------------- 100
           R L++G+LD + +E T++  +   G    VK++  K N                      
Sbjct: 22  RTLWMGDLDPSFDEATIQHVWLTVGHQVQVKLIRAKKNLLIPCSTSSTLSASHVDEERIQ 81

Query: 101 --------------EEANYAFVEYHQPHDANVAFQTLDGKQIEGNV-------------- 132
                           A Y FV++    +A    Q L+   +   V              
Sbjct: 82  INGVSFIDPNTTQLHHAGYCFVQFANLQEAQAGLQ-LNATPLPNVVSPTTRNPTNPTGKR 140

Query: 133 -IKINWA----FQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFK-EFPSFIQAHVMWDML 186
             ++NWA     QS  + +   F+LFVGDL+    +  L   F+ +F S     VM D +
Sbjct: 141 NFRLNWASGATLQSD-IPATPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPI 199

Query: 187 SGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQXXXXXXXXXXX 246
           +G SR +GFV F+++   ++A+    G    GR +R+ +A+ R     Q           
Sbjct: 200 TGASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVAYATPRNNLLQQQQAHPAPPAPP 259

Query: 247 XXXXXXHQQF---RGIPQGHPMGSPNNAGPMGMAPQGMAXXXXXXXXXXXXXXXXXXAVE 303
                  Q      G+  G P  +  +A  +G A Q +                      
Sbjct: 260 SPPAPPAQTLPDSLGLLVGVPSLAQLDAASLGRAQQPLLLGAAGSLVGSNSLPL------ 313

Query: 304 AMIRRAPQRV--TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQ 361
           A  R+ P     TT +IG + +   E  L  L   FG I+  K  P +GC F++++    
Sbjct: 314 AAPRQLPADTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRGCGFVRFENRMD 373

Query: 362 AAVCIVALANFPFQGRNLRTGWGK 385
           A   I  +  F   G  +R  WG+
Sbjct: 374 AEAAIQGMQGFIVGGNAIRLSWGR 397

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANV 118
           +T++  +++G L   I+E  L   F   G I +VKV   +        FV +    DA  
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKVPPGRG-----CGFVRFENRMDAEA 376

Query: 119 AFQTLDGKQIEGNVIKINW 137
           A Q + G  + GN I+++W
Sbjct: 377 AIQGMQGFIVGGNAIRLSW 395

>TDEL0E02450 Chr5 complement(475232..476650) [1419 bp, 472 aa] {ON}
           Anc_5.382 YHR086W
          Length = 472

 Score = 81.3 bits (199), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 94/181 (51%), Gaps = 13/181 (7%)

Query: 57  GRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN------YAFVEY 110
           G ++ +  LY+G+LD + +E+ ++  +   G  +NV++ +  NN  A       Y FV++
Sbjct: 42  GSQSRNNQLYMGDLDPSWDENVIRSIWNSLGE-SNVEIKLMWNNRNAGVRTHLGYCFVQF 100

Query: 111 HQPHDANVAFQTLDGKQIEG---NVIKINWAFQS-QHVSSDDTFNLFVGDLNVDVDDETL 166
                A+ A    +G  I G     +++NW+  S       +  ++FVGDL  +V +  L
Sbjct: 101 SSRSQASNALLK-NGMAIPGYPSKTLRLNWSSASGNSADGSNEISVFVGDLAPNVTESDL 159

Query: 167 TGTF-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINW 225
              F  + PS   A VM+D ++G S+GY FV F  Q+  Q+A++   G  L GRAIR+  
Sbjct: 160 FELFISKCPSTSNAKVMYDQVTGVSKGYAFVRFGNQEDQQRALQEMTGTFLKGRAIRVGS 219

Query: 226 A 226
           A
Sbjct: 220 A 220

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 1/79 (1%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT ++ ++ H   E +L    Q FG +I  K    K C F++Y     A + I+ L  FP
Sbjct: 279 TTLFVSSLSHMVTENELKAFFQPFGNVIYAKLPENKQCGFVQYVDRASAEMAILKLQGFP 338

Query: 374 FQGRNLRTGWGK-EKPAFI 391
            +G  ++  WG+  KPA +
Sbjct: 339 IRGSRIKISWGRPAKPAVV 357

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 81/216 (37%), Gaps = 55/216 (25%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGP-IANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQT 122
           ++VG+L   + E  L + F    P  +N KV+ D+       YAFV +    D   A Q 
Sbjct: 145 VFVGDLAPNVTESDLFELFISKCPSTSNAKVMYDQVTGVSKGYAFVRFGNQEDQQRALQE 204

Query: 123 LDGKQIEGNVIKINWA-----------------------------------------FQS 141
           + G  ++G  I++  A                                           +
Sbjct: 205 MTGTFLKGRAIRVGSAGHQNQRNRNGPGLENKLKGLNATVSSPKPANISSTNFSQFILPT 264

Query: 142 QHVSSDDTFN------LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGF 195
           Q +   ++F       LFV  L+  V +  L   F+ F + I A +        ++  GF
Sbjct: 265 QQLPPLNSFTDRNNTTLFVSSLSHMVTENELKAFFQPFGNVIYAKLP------ENKQCGF 318

Query: 196 VSFSEQDVAQQAMESKQGFILNGRAIRINWASKREP 231
           V + ++  A+ A+   QGF + G  I+I+W    +P
Sbjct: 319 VQYVDRASAEMAILKLQGFPIRGSRIKISWGRPAKP 354

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANV 118
           + ++  L+V +L   + E+ LK +FQ   P  NV  +  K  E     FV+Y     A +
Sbjct: 275 DRNNTTLFVSSLSHMVTENELKAFFQ---PFGNV--IYAKLPENKQCGFVQYVDRASAEM 329

Query: 119 AFQTLDGKQIEGNVIKINWA 138
           A   L G  I G+ IKI+W 
Sbjct: 330 AILKLQGFPIRGSRIKISWG 349

>Smik_8.164 Chr8 (254903..256477) [1575 bp, 524 aa] {ON} YHR086W
           (REAL)
          Length = 524

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 100/205 (48%), Gaps = 33/205 (16%)

Query: 57  GRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN------------ 104
           G  T+   LY+G+LD   +++T++Q +   G  AN+ V +  NN   N            
Sbjct: 48  GSGTTGNQLYMGDLDPTWDKNTVRQIWASLGE-ANINVRMMWNNSLNNGSRSPMGSKNNQ 106

Query: 105 -YAFVEY-HQPHDANVAFQTLDGKQIEG---NVIKINWAFQSQHVSSDDTFN-------- 151
            Y FV++    H AN   +  +G  I       +K+NWA  S + S + TFN        
Sbjct: 107 GYCFVDFPSSTHAANALLK--NGMLIPNFPNRKLKLNWA-TSSYSSGNSTFNNVKSSNNC 163

Query: 152 -LFVGDLNVDVDDETLTGTF-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAME 209
            +FVGDL  +V +  L   F   + S   A V+ D ++G S+GYGFV F+  D  Q A+ 
Sbjct: 164 SVFVGDLAPNVTESQLFELFINRYASVAHAKVVHDQVTGISKGYGFVKFANSDEQQSALL 223

Query: 210 SKQGFILNGRAIRINWASKREPQQH 234
             QG  LNGRAI++   S +  QQH
Sbjct: 224 EMQGVFLNGRAIKVGPTSGQ--QQH 246

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  +  FP
Sbjct: 313 TTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIARMQGFP 372

Query: 374 FQGRNLRTGWGKE 386
                +R  WG+ 
Sbjct: 373 IANSRVRLSWGRS 385

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  +++G L   + ED L+ YFQ  G I  VK+ V K        FV+Y     A  A 
Sbjct: 311 NNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK-----GCGFVQYVDRLSAETAI 365

Query: 121 QTLDGKQIEGNVIKINWA 138
             + G  I  + ++++W 
Sbjct: 366 ARMQGFPIANSRVRLSWG 383

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 143 HVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           H +  +   +F+G L+  V ++ L   F+ F + +   +         +G GFV + ++ 
Sbjct: 306 HFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIP------VGKGCGFVQYVDRL 359

Query: 203 VAQQAMESKQGFILNGRAIRINWA 226
            A+ A+   QGF +    +R++W 
Sbjct: 360 SAETAIARMQGFPIANSRVRLSWG 383

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 94/172 (54%), Gaps = 4/172 (2%)

Query: 53  ATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYH 111
           +TKG  E S   LYVG LD ++ E  L   F   G +++++V  D   + +  YA+V +H
Sbjct: 32  STKG--EASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFH 89

Query: 112 QPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFK 171
             +    A + L+   I+G   +I W+ +   +    + N+F+ +L+  +D++ L  TF 
Sbjct: 90  DHNAGTTAIEKLNYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFS 149

Query: 172 EFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
            F + +   +  D  +G+SR +GFV F E++ A++A+++  G +LNG  + +
Sbjct: 150 VFGNILSCKIATDE-TGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYV 200

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 84/187 (44%), Gaps = 17/187 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +YV N+D    +D  ++ F   G I +  +  D   +   + FV +   + A  A + L+
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELN 282

Query: 125 GKQIEGNVIKINWA---------FQSQHVSSD-------DTFNLFVGDLNVDVDDETLTG 168
                G  + +  A          + Q+ SS           NLFV +L+  +DDE L  
Sbjct: 283 DTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQE 342

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F  F +     VM D  +G S+G+GFV FS  + A +A+  K   I+ G+ + +  A +
Sbjct: 343 EFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 401

Query: 229 REPQQHQ 235
           +E ++ Q
Sbjct: 402 KEVRRSQ 408

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 1/81 (1%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           +L+VG+L+  V +  L   F    S     V  D ++  S GY +V+F + +    A+E 
Sbjct: 41  SLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEK 100

Query: 211 KQGFILNGRAIRINWASKREP 231
                + GR  RI W S+R+P
Sbjct: 101 LNYTPIKGRPCRIMW-SQRDP 120

>Ecym_6201 Chr6 (375019..376365) [1347 bp, 448 aa] {ON} similar to
           Ashbya gossypii AFR107W
          Length = 448

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 111/236 (47%), Gaps = 25/236 (10%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK  F+  G + + +V+ ++  E +  Y +V++     A  A + 
Sbjct: 212 TIFVGRLSWSIDDEWLKTEFEHIGGVISARVIYERGTERSRGYGYVDFEDKSYAEKAIKE 271

Query: 123 LDGKQIEGNVIKINW-------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGT 169
           + GK+I+G  I ++              A +   V S  +  LF+G+L+ + D + +   
Sbjct: 272 MQGKEIDGRPINVDMSTSKPASNPKEDRAKKFGDVPSQPSDTLFLGNLSFNADRDNIFEL 331

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           FK++ S I   +     + + +G+G+V ++  + AQ+A++  QG  ++ R +R++++S R
Sbjct: 332 FKDYGSIISVRIPTHPETNQPKGFGYVQYASIEEAQKALDKLQGEYIDNRPVRLDFSSPR 391

Query: 230 EPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHP---MGSPNNAGPMGMAPQGMA 282
            PQ                        R  P+G P    GS  N+ P+G   Q  A
Sbjct: 392 PPQSGNGGNSGFRGGRGGA--------RFTPRGGPTARTGSGANSAPLGKGRQSAA 439

>KLLA0F14861g Chr6 (1375042..1376811) [1770 bp, 589 aa] {ON} some
           similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein
          Length = 589

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 93/176 (52%), Gaps = 12/176 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQ-VGGPIANVKVLVDKNNEEAN------YAFVEY-HQPHDA 116
           LY+G+L+    E+ +K  +  +G P   VK++   N  +++      Y FVE+ +Q   +
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAAS 117

Query: 117 NVAFQTLDGKQIEGN-VIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF-KEFP 174
           N   ++     ++ N  +K+NWA  S   +    F LFVGDL  +V +  L   F   + 
Sbjct: 118 NALMKSGLRVPMDSNYALKLNWA--SFATAPGSEFTLFVGDLAPNVTEAQLFELFISRYS 175

Query: 175 SFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKRE 230
           S + A +++D  +G S+GYGFV F  +   Q+A+   QG  LNGRAIR+   SK +
Sbjct: 176 STLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGTTSKNK 231

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  +  FP
Sbjct: 316 TTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGKGCGFVQYVDRISAETAISKMQGFP 375

Query: 374 FQGRNLRTGWGKE 386
                +R  WG+ 
Sbjct: 376 IGNSRIRLSWGRS 388

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           +  +++G L   I ED L+ YFQ  G I  VK+ V K        FV+Y     A  A  
Sbjct: 315 NTTVFIGGLSTLITEDELRSYFQPFGQIVYVKIPVGK-----GCGFVQYVDRISAETAIS 369

Query: 122 TLDGKQIEGNVIKINWA 138
            + G  I  + I+++W 
Sbjct: 370 KMQGFPIGNSRIRLSWG 386

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 7/86 (8%)

Query: 141 SQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSE 200
           SQ    ++T  +F+G L+  + ++ L   F+ F   +   +         +G GFV + +
Sbjct: 308 SQFTDPNNT-TVFIGGLSTLITEDELRSYFQPFGQIVYVKI------PVGKGCGFVQYVD 360

Query: 201 QDVAQQAMESKQGFILNGRAIRINWA 226
           +  A+ A+   QGF +    IR++W 
Sbjct: 361 RISAETAISKMQGFPIGNSRIRLSWG 386

>KLTH0E03520g Chr5 complement(317318..318868) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q00539 Saccharomyces cerevisiae
           YHR086W NAM8 RNA binding protein component of the U1
           snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 516

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 95/176 (53%), Gaps = 12/176 (6%)

Query: 65  LYVGNLDKAINEDTLKQ-YFQVGGPIANVKVLVDKNNEEAN--YAFVEYHQPHDANVAFQ 121
           LY+G+LD + +E+ ++  +  +G P   VK++ +  +   +  Y FVE+  P   N +  
Sbjct: 45  LYMGDLDPSWDENAIRAVWANLGEPNVQVKLIRNSGSTGGSSGYCFVEF--PSHLNASNA 102

Query: 122 TLDGKQIEGNV----IKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF-KEFPSF 176
            L    +  N     +K+NWA  S   +  +  ++FVGD+  +V +  L   F   + S 
Sbjct: 103 LLKNGLLIPNARNRYLKLNWA--SFATAPGNEHSVFVGDIAPNVSEAQLFELFISRYAST 160

Query: 177 IQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQ 232
           + A +++D ++G S+GYGFV F ++   Q+A+   QG  LNGRA+R++  SK   +
Sbjct: 161 LNAKIVFDQMTGVSKGYGFVKFGQESEQQRALLEMQGVFLNGRAVRVSTTSKNRSK 216

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  +  +P
Sbjct: 273 TTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGKGCGFVQYVDRISAETAIAKMQGYP 332

Query: 374 FQGRNLRTGWGKE 386
                +R  WG+ 
Sbjct: 333 IGNSRIRLSWGRS 345

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           +  +++G L   ++ED L+ YFQ  G I  VK+ V K        FV+Y     A  A  
Sbjct: 272 NTTVFIGGLSSLVSEDELRAYFQPFGSIVYVKIPVGK-----GCGFVQYVDRISAETAIA 326

Query: 122 TLDGKQIEGNVIKINWA 138
            + G  I  + I+++W 
Sbjct: 327 KMQGYPIGNSRIRLSWG 343

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 141 SQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSE 200
           +Q+   ++T  +F+G L+  V ++ L   F+ F S +   +         +G GFV + +
Sbjct: 265 TQYTDPNNT-TVFIGGLSSLVSEDELRAYFQPFGSIVYVKIP------VGKGCGFVQYVD 317

Query: 201 QDVAQQAMESKQGFILNGRAIRINWA 226
           +  A+ A+   QG+ +    IR++W 
Sbjct: 318 RISAETAIAKMQGYPIGNSRIRLSWG 343

>TDEL0E00600 Chr5 (129602..131245) [1644 bp, 547 aa] {ON} Anc_3.49
           YOL123W
          Length = 547

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 87/176 (49%), Gaps = 14/176 (7%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQT- 122
           +++G L+    EDTL+ YF   G + ++K++ D N   +  + F+ + +P   +   +T 
Sbjct: 159 MFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVDEVVKTQ 218

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 219 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQ 271

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQHQ 235
           +M D  +GRSRG+GFV++   D   +  ++K  FI   G+ I I  A  R  Q+ Q
Sbjct: 272 LMLDKDTGRSRGFGFVTYDSPDAVDRVCQNK--FIDFKGKKIEIKRAEPRHMQKQQ 325

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D   +F+G LN +  ++TL   F ++   I   +M D  +GRSRG+GF++F E     
Sbjct: 153 SRDICKMFIGGLNWETTEDTLRDYFSKYGKVIDLKIMKDTNTGRSRGFGFLTFDEPSSVD 212

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 213 EVVKTQH--ILDGKVIDPKRAIPREEQ 237

>CAGL0M03795g Chr13 complement(428607..430148) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 513

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 84/173 (48%), Gaps = 12/173 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L++YF   G +  +K++ D N   +  + F+ +  P   +   +T 
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVVKTQ 191

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG L  DV  +     F ++ + I A 
Sbjct: 192 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQ 244

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQ 233
           +M D  +GRSRG+GFV++   D A++  ES+      G+ I I  A  R  Q+
Sbjct: 245 LMLDKDTGRSRGFGFVTYDSPDAAEKVCESRY-REFKGKQIEIKRAEPRHQQK 296

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S +   +F+G LN +  ++ L   F ++ + ++  +M D  +GRSRG+GF+SF       
Sbjct: 126 SRENCKMFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVD 185

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 186 EVVKTQH--ILDGKVIDPKRAIPREEQ 210

>TBLA0H01790 Chr8 complement(415969..417993) [2025 bp, 674 aa] {ON}
           Anc_5.382 YHR086W
          Length = 674

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 93/187 (49%), Gaps = 31/187 (16%)

Query: 65  LYVGNLDKAINEDTLKQYFQ-VGGPIANVKVLVDKN-----NEEANYAFVEYHQPHDANV 118
           LY+G+LD   +E T+KQ +  +G     VK++ + N          Y F+E+   ++A+ 
Sbjct: 64  LYMGDLDPMWDESTIKQIWNSLGENNIVVKIITNSNMTSMGRNNPGYCFIEFSNYNNASN 123

Query: 119 AFQTLDGKQIEG---NVIKINWAFQSQHVSSDDT------------------FNLFVGDL 157
           A    +G  I G    V+K+NWA  S H  S+                    F++FVGDL
Sbjct: 124 ALLK-NGLVIPGYNSKVLKLNWA--SMHTRSNGNTNCTANNNTSSNNSTNNDFSVFVGDL 180

Query: 158 NVDVDDETLTGTF-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFIL 216
             +V +  L   F   + S I A +++D ++  S+GYGFV F+     Q+++   QG  L
Sbjct: 181 APNVTEAQLFDLFINRYSSTIHAKIVYDQMTNVSKGYGFVRFNNSADQQRSLNEMQGVFL 240

Query: 217 NGRAIRI 223
           NGR+IR+
Sbjct: 241 NGRSIRV 247

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 32/72 (44%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  +  FP
Sbjct: 340 TTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGKGCGFVQYVDRSAAETAISKMQGFP 399

Query: 374 FQGRNLRTGWGK 385
                +R  WG+
Sbjct: 400 IGNSRIRLSWGR 411

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  +++G L   ++E  L+ YFQ  G I  VK+ V K        FV+Y     A  A 
Sbjct: 338 NNTTVFIGGLSSLVSEGELRSYFQPFGTIVYVKIPVGK-----GCGFVQYVDRSAAETAI 392

Query: 121 QTLDGKQIEGNVIKINWA 138
             + G  I  + I+++W 
Sbjct: 393 SKMQGFPIGNSRIRLSWG 410

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +F+G L+  V +  L   F+ F + +   +         +G GFV + ++  A+ A+   
Sbjct: 342 VFIGGLSSLVSEGELRSYFQPFGTIVYVKI------PVGKGCGFVQYVDRSAAETAISKM 395

Query: 212 QGFILNGRAIRINWA 226
           QGF +    IR++W 
Sbjct: 396 QGFPIGNSRIRLSWG 410

>KAFR0C01680 Chr3 complement(342688..344127) [1440 bp, 479 aa] {ON}
           Anc_3.49 YOL123W
          Length = 479

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 86/175 (49%), Gaps = 12/175 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT- 122
           +++G L+    E+TL+ YF   G + ++K++ D N   +  + F+ +  P   +   +T 
Sbjct: 96  MFIGGLNWETTEETLRDYFNKYGHVTDLKIMKDSNTGRSRGFGFLTFEHPSSVDEVVKTQ 155

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK I+    K +   + Q    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 156 HILDGKVID---PKRSIPREEQ----DKTGKIFVGGIGADVRPKEFEEFFSQYGNIIDAQ 208

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQ 235
           +M D  +GRSRG+GFV++   D   +  +SK      G+ I I  A  R  Q+ Q
Sbjct: 209 LMLDKDTGRSRGFGFVTYDSPDAVDRVCQSKY-IEFKGKQIEIKRAQPRHLQKGQ 262

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 5/93 (5%)

Query: 143 HVSSD---DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFS 199
           HV +D   D   +F+G LN +  +ETL   F ++       +M D  +GRSRG+GF++F 
Sbjct: 84  HVKADISKDNCKMFIGGLNWETTEETLRDYFNKYGHVTDLKIMKDSNTGRSRGFGFLTFE 143

Query: 200 EQDVAQQAMESKQGFILNGRAIRINWASKREPQ 232
                 + ++++   IL+G+ I    +  RE Q
Sbjct: 144 HPSSVDEVVKTQH--ILDGKVIDPKRSIPREEQ 174

>NDAI0D02840 Chr4 complement(656261..657541) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 96/177 (54%), Gaps = 12/177 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           ++VG L  +I+++ LK+ F+  G +   +V+ ++  + +  Y +V++     A  A Q +
Sbjct: 173 IFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDKSYAEKAIQEM 232

Query: 124 DGKQIEGNVIKINW-----------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKE 172
            GK+I+G  I ++            A +   V S+ +  LF+G+L+ + D + +  TF +
Sbjct: 233 QGKEIDGRPINVDMSTSKPAGGNDRAKKFGDVPSEPSDTLFLGNLSFNADKDNIYETFSK 292

Query: 173 FPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           +   I   +     + + +G+G+V FS  + A++A+E  QG  ++ RA+R+++++ R
Sbjct: 293 YGEIISVRIPTHPETEQPKGFGYVQFSNIEDAKKALEGLQGEYIDNRAVRLDYSTPR 349

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 52/88 (59%)

Query: 142 QHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQ 201
           Q  S  +   +FVG L+  +DDE L   F+     + A V+++  + RSRGYG+V F ++
Sbjct: 163 QKTSGGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVGARVIYERGTDRSRGYGYVDFEDK 222

Query: 202 DVAQQAMESKQGFILNGRAIRINWASKR 229
             A++A++  QG  ++GR I ++ ++ +
Sbjct: 223 SYAEKAIQEMQGKEIDGRPINVDMSTSK 250

>KLTH0G14344g Chr7 (1248269..1250032) [1764 bp, 587 aa] {ON} highly
           similar to uniprot|P04147 Saccharomyces cerevisiae
           YER165W PAB1 Poly(A) binding protein part of the 3'-end
           RNA-processing complex mediates interactions between the
           5' cap structure and the 3' mRNA poly(A) tail involved
           in control of poly(A) tail length interacts with
           translation factor eIF-4G
          Length = 587

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 88/160 (55%), Gaps = 2/160 (1%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           LYVG LD ++ E  L   F   G +++++V  D   + +  YA+V +H  +    A + L
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +   I+G   +I W+ +   +    + N+F+ +L+  +D++ L  TF  F + +   +  
Sbjct: 102 NYTPIKGRPCRIMWSQRDPSLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIAT 161

Query: 184 DMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
           D  +G+SR +GFV F E++ A++A+++  G +LNG  + +
Sbjct: 162 DE-TGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYV 200

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 93/210 (44%), Gaps = 23/210 (10%)

Query: 48  VTPVLATKGGRETSDRI------LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNE 101
           V P ++ K  +   D +      +YV N+D    ++  ++ F   G I +  +  D   +
Sbjct: 200 VAPHVSKKDRQSKLDEVKSNFTNVYVKNIDSETTQEEFEKMFSNYGAITSAVLERDNEGK 259

Query: 102 EANYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWA---------FQSQHVSSD----- 147
              + FV +   + A  A + L+    +G  + +  A          + Q+ SS      
Sbjct: 260 LRGFGFVNFEDHNAALKACEELNDTDFKGQKLYVGRAQKKYERLQELKKQYESSRMEKLA 319

Query: 148 --DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
                NLFV +L+  VDD+ L   F  F +     VM D  +G S+G+GFV FS  + A 
Sbjct: 320 KYQGVNLFVKNLDDSVDDQKLEEEFAPFGTITSVKVMRDE-AGNSKGFGFVCFSTPEEAT 378

Query: 206 QAMESKQGFILNGRAIRINWASKREPQQHQ 235
           +A+  K   I+ G+ + +  A ++E ++ Q
Sbjct: 379 KAITEKNQQIVAGKPLYVAIAQRKEVRRSQ 408

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           L+VG+L+  V +  L   F    S     V  D ++  S GY +V+F + +  + A+E  
Sbjct: 42  LYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGRTAIEKL 101

Query: 212 QGFILNGRAIRINWASKREP 231
               + GR  RI W S+R+P
Sbjct: 102 NYTPIKGRPCRIMW-SQRDP 120

>KAFR0D04830 Chr4 (947731..948951) [1221 bp, 406 aa] {ON} Anc_5.382
           YHR086W
          Length = 406

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 89/165 (53%), Gaps = 15/165 (9%)

Query: 64  ILYVGNLDKAINEDTLKQ-YFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           +LY+G+LD + +E  + Q +  +G P  +VK++         Y F+ +     A+ A   
Sbjct: 33  VLYMGDLDLSWDERVVSQIWASLGEPNVSVKMM-------NRYCFITFLDSLTASNALLK 85

Query: 123 LDGKQIEG---NVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF-KEFPSFIQ 178
            +G  I G     +K+NWA  S + S  + +++FVGDL+ +V +  L   F  ++ S   
Sbjct: 86  -NGMLIPGYGGKRLKLNWAQASSNAS--NGYSIFVGDLSPNVTEAQLFDLFINKYASTDH 142

Query: 179 AHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
           A +++D  +G SRGYGFV F+     Q A+   QG  LNGRAI+I
Sbjct: 143 AKIVYDQATGVSRGYGFVRFNSLMDQQHALLEMQGIFLNGRAIKI 187

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 32/73 (43%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT ++G +     E +L    + FG I+  K    KGC F++Y     A   I  +  FP
Sbjct: 244 TTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGKGCGFVQYIDRVSAENAISKMQGFP 303

Query: 374 FQGRNLRTGWGKE 386
                +R  WG+ 
Sbjct: 304 IANSRIRLSWGRS 316

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  ++VG L   + ED L++YF+  G I  VK+ V K        FV+Y     A  A 
Sbjct: 242 NNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKIPVGK-----GCGFVQYIDRVSAENAI 296

Query: 121 QTLDGKQIEGNVIKINWA 138
             + G  I  + I+++W 
Sbjct: 297 SKMQGFPIANSRIRLSWG 314

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 143 HVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           H +  +   +FVG L+  V ++ L   FK F + +   +         +G GFV + ++ 
Sbjct: 237 HFTDPNNTTVFVGGLSSLVTEDELREYFKPFGTIVYVKI------PVGKGCGFVQYIDRV 290

Query: 203 VAQQAMESKQGFILNGRAIRINWA 226
            A+ A+   QGF +    IR++W 
Sbjct: 291 SAENAISKMQGFPIANSRIRLSWG 314

>TPHA0H01520 Chr8 (343322..344806) [1485 bp, 494 aa] {ON} Anc_5.382
           YHR086W
          Length = 494

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 95/189 (50%), Gaps = 29/189 (15%)

Query: 62  DRILYVGNLDKAINEDTLKQYF-QVGGPIANVKVLVDKNNEEAN-----------YAFVE 109
           + +LY+G LD + NE  +K  + +VG P  NV+++ +   +  N           Y FVE
Sbjct: 42  NNVLYMGGLDYSWNEAVIKDIWNKVGEPATNVRMMWNMQFQHNNAGPTEGKSNLGYCFVE 101

Query: 110 YHQPHDANVAFQTLDGKQI---EGNVIKINWAF-----------QSQHVSSDDTFNLFVG 155
           +     A+ A    +G  I   +G   K+NW+            ++Q   S+D +++FVG
Sbjct: 102 FSTHETASNAIMK-NGTMIPGYKGRYFKLNWSSGSSLSSSATHTENQGPQSND-YSVFVG 159

Query: 156 DLNVDVDDETLTGTFKE-FPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGF 214
           DL  +V +  L   FK  + S + + ++ D L+  S+GYGF+ F +Q+    A+   Q  
Sbjct: 160 DLGQNVTESQLYNLFKSHYASTLSSKIIHDPLTYISKGYGFIKFHDQNDYNDALSKMQNK 219

Query: 215 ILNGRAIRI 223
           ILNGR I++
Sbjct: 220 ILNGRGIKV 228

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 41/92 (44%), Gaps = 7/92 (7%)

Query: 47  QVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYA 106
           QV PVL      + +   L V N  K I+ +  K YF   G +  +++  D N    N  
Sbjct: 287 QVLPVLNDSTNPDNT--TLVVSNASKDISMNEFKSYFLPFGNL--IEISKDPN---TNIL 339

Query: 107 FVEYHQPHDANVAFQTLDGKQIEGNVIKINWA 138
           FV Y     A  + + L GK I GN I+I W 
Sbjct: 340 FVTYVDRICAENSMRILQGKVIRGNKIQIAWG 371

>ZYRO0C02574g Chr3 complement(203808..205439) [1632 bp, 543 aa] {ON}
           weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 543

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 85/176 (48%), Gaps = 14/176 (7%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQT- 122
           +++G L+    EDTL+ YF   G + ++K++ D N   +  + F+ +      +   +T 
Sbjct: 161 MFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTFDSSSSVDEVVKTQ 220

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 221 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGADVRPKEFEEFFAQWGTIIDAQ 273

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQHQ 235
           +M D  +GRSRG+GFV++   D   +  ++K  FI   G+ I I  A  R  Q+ Q
Sbjct: 274 LMLDKDTGRSRGFGFVTYDSPDAVDRVCQNK--FIDFKGKKIEIKRAEPRHMQKQQ 327

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D   +F+G LN +  ++TL   F ++   I   +M D  +GRSRG+GF++F       
Sbjct: 155 SRDICKMFIGGLNWETTEDTLRDYFSKYGRVIDLKIMKDTNTGRSRGFGFLTFDSSSSVD 214

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 215 EVVKTQH--ILDGKVIDPKRAIPREEQ 239

>KNAG0A01370 Chr1 (41785..43422) [1638 bp, 545 aa] {ON} Anc_3.49
           YOL123W
          Length = 545

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 88/175 (50%), Gaps = 12/175 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L++YF   G + ++K++ D N+  +  + F+ + +P   +   +T 
Sbjct: 159 MFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTFEEPSSVDEVVKTQ 218

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK I+    K +   + Q    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 219 HILDGKVID---PKRSIPREEQ----DKTGKIFVGGIGADVRPKEFEEFFSQYGTIIDAQ 271

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQ 235
           +M D  +GRSRG+GFV++   +   +  ++K      G+ I I  A  R  Q+ Q
Sbjct: 272 LMLDKDTGRSRGFGFVTYDSPEAVDRVCQNKY-IDFKGKQIEIKRAEPRHMQKGQ 325

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 5/93 (5%)

Query: 143 HVSSD---DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFS 199
           HV +D   D   +F+G LN +  ++ L   F ++   I   +M D  SGRSRG+GF++F 
Sbjct: 147 HVKADISKDNCKMFIGGLNWETTEDGLREYFNKYGHVIDLKIMKDPNSGRSRGFGFLTFE 206

Query: 200 EQDVAQQAMESKQGFILNGRAIRINWASKREPQ 232
           E     + ++++   IL+G+ I    +  RE Q
Sbjct: 207 EPSSVDEVVKTQH--ILDGKVIDPKRSIPREEQ 237

>TPHA0P01310 Chr16 complement(265254..266810) [1557 bp, 518 aa] {ON}
           Anc_3.49 YOL123W
          Length = 518

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 83/174 (47%), Gaps = 14/174 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT- 122
           +++G L+    EDTL+ YF   G +  +K++ D N   +  + F+ +      +   +T 
Sbjct: 166 MFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTFENASSVDEVVKTQ 225

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 226 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGADVRPKEFEEFFAQYGTIIDAQ 278

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQ 233
           +M D  +GRSRG+GFV++   D   +  +SK  +I   G+ I I  A  R  Q+
Sbjct: 279 LMLDKDTGRSRGFGFVTYDSPDAVDRVCQSK--YIEFKGKQIEIKRAEPRNNQK 330

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D+  +F+G LN +  ++TL   F ++ S ++  +M D  +GRSRG+GF++F       
Sbjct: 160 SKDSCKMFIGGLNWETTEDTLRDYFNKYGSVVELKIMKDNNTGRSRGFGFLTFENASSVD 219

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 220 EVVKTQH--ILDGKVIDPKRAIPREEQ 244

>TBLA0A07810 Chr1 (1923979..1925397) [1419 bp, 472 aa] {ON} Anc_3.49
           YOL123W
          Length = 472

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 85/170 (50%), Gaps = 14/170 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L+QYF   G + +VK++ D +N ++  + F+ +      +   +T 
Sbjct: 152 MFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTFENSSSVDEVVKTQ 211

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ S I A 
Sbjct: 212 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQ 264

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKR 229
           +M D  +GRSRG+GFV++   D   +  ++K  FI   G+ I I  A +R
Sbjct: 265 LMLDKDTGRSRGFGFVTYDSPDAVDKVCQNK--FIEFKGKTIEIKRAEQR 312

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D+  +F+G LN D  ++ L   F ++ + I   +M D  +G+SRG+GF++F       
Sbjct: 146 SKDSCKMFIGGLNWDTTEDVLRQYFNKYGNVIDVKIMTDGHNGKSRGFGFLTFENSSSVD 205

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 206 EVVKTQH--ILDGKVIDPKRAIPREEQ 230

>Suva_15.280 Chr15 (480600..482225) [1626 bp, 541 aa] {ON} YHR086W
           (REAL)
          Length = 541

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 104/219 (47%), Gaps = 39/219 (17%)

Query: 49  TPVLATKGGRE----TSDRILYVGNLDKAINEDTLKQYF-QVGGPIANVKVLVD------ 97
           T VL  +G  +    T+   LY+G+LD   +++T+ Q +  +G    NV+++ +      
Sbjct: 39  TKVLNVQGASDINTGTAGNQLYMGDLDPTWDKNTISQIWGSLGEANINVRMMWNNPSNSS 98

Query: 98  -------KNNEEANYAFVEY-HQPHDANVAFQTLDGKQIEG---NVIKINWA-------- 138
                  KNN+   Y FV++    H AN   +  +G  I       +K+NWA        
Sbjct: 99  SRPSMGPKNNQ--GYCFVDFPSSTHAANALLK--NGMIIPSFPNKKLKLNWATSSYSNGN 154

Query: 139 ----FQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF-KEFPSFIQAHVMWDMLSGRSRGY 193
                   +  S + +++FVGDL  +V +  L   F   + S   A ++ D ++G S+GY
Sbjct: 155 NGGNNSISNSKSGNNYSIFVGDLAPNVTESQLFDLFITRYASAFHAKIVHDQVTGMSKGY 214

Query: 194 GFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQ 232
           GFV FS  D  Q A+   QG  LNGRAI++   S ++ Q
Sbjct: 215 GFVKFSNADEQQLALSEMQGVFLNGRAIKVGPTSGQQQQ 253

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E +L    Q FG I+  K    KGC F++Y     A   I  +  FP
Sbjct: 323 TTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRLSAETAIAGMQGFP 382

Query: 374 FQGRNLRTGWGKE 386
                +R  WG+ 
Sbjct: 383 IANSRVRLSWGRS 395

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  +++G L   + ED L+ YFQ  G I  VK+ V K        FV+Y     A  A 
Sbjct: 321 NNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVGK-----GCGFVQYVDRLSAETAI 375

Query: 121 QTLDGKQIEGNVIKINWA 138
             + G  I  + ++++W 
Sbjct: 376 AGMQGFPIANSRVRLSWG 393

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 143 HVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           H +  +   +F+G L+  V ++ L   F+ F + +   +         +G GFV + ++ 
Sbjct: 316 HFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIP------VGKGCGFVQYVDRL 369

Query: 203 VAQQAMESKQGFILNGRAIRINWA 226
            A+ A+   QGF +    +R++W 
Sbjct: 370 SAETAIAGMQGFPIANSRVRLSWG 393

>CAGL0E03245g Chr5 complement(299473..300750) [1278 bp, 425 aa] {ON}
           similar to uniprot|P27476 Saccharomyces cerevisiae
           YGR159c NSR1 nuclear localization sequence binding
           protein
          Length = 425

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 94/177 (53%), Gaps = 14/177 (7%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQTL 123
           ++VG L  +I+++ LKQ F+  G +   +V+ ++  + +  Y +V++     A  A + +
Sbjct: 178 VFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKEM 237

Query: 124 DGKQIEGNVIKINWAFQSQHVS-------------SDDTFNLFVGDLNVDVDDETLTGTF 170
            GK+I+G  I ++ +     V+             S+ +  LF+G+L+ + D + +   F
Sbjct: 238 HGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYEIF 297

Query: 171 KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
            +F   I   +     + + +G+G+V ++  D A++A+E+ QG  ++ R +R+++++
Sbjct: 298 GKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPVRLDYST 354

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 48/79 (60%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
            +FVG L+  +DDE L   F+     + A VM++  + RSRGYG+V F ++  A++A++ 
Sbjct: 177 TVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKE 236

Query: 211 KQGFILNGRAIRINWASKR 229
             G  ++GR I ++ ++ +
Sbjct: 237 MHGKEIDGRPINVDMSTSK 255

>Ecym_2050 Chr2 (79607..81232) [1626 bp, 541 aa] {ON} similar to
           Ashbya gossypii ADL160W
          Length = 541

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 84/176 (47%), Gaps = 14/176 (7%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L++YF   G +  VK++ D     +  + F+ +      +   +T 
Sbjct: 173 MFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 232

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F E+ S I A 
Sbjct: 233 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSEWGSIIDAQ 285

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQHQ 235
           +M D  +GRSRG+GF+++   D   +  ++K  FI   G+ I I  A  R+ Q+ +
Sbjct: 286 LMLDKDTGRSRGFGFITYDSPDAVDRVCQNK--FIEFKGKRIEIKRAEPRQVQKQR 339

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 49/87 (56%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D   +F+G LN +  ++ L   F ++ +  +  +M D  +GRSRG+GF+SF++     
Sbjct: 167 SRDINKMFIGGLNWETTEDNLREYFSKYGTVTEVKIMRDGTTGRSRGFGFLSFADASSVD 226

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 227 EVVKTQH--ILDGKVIDPKRAIPREEQ 251

>KNAG0D03220 Chr4 (576080..577279) [1200 bp, 399 aa] {ON} Anc_4.61
           YGR159C
          Length = 399

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 95/180 (52%), Gaps = 14/180 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            L+VG L  +++++ LK  F   G + + +V++++  + +  Y +V++     A  A + 
Sbjct: 150 TLFVGRLSWSVDDEWLKNEFAPIGGVVSARVIMERGTDRSRGYGYVDFEDISYAEKALKE 209

Query: 123 LDGKQIEGNVIKINW-------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGT 169
           + GK+I+G  I ++              A +   V S+ +  LF+G+L+ D D + L   
Sbjct: 210 MQGKEIDGRPINVDMSTSKPAGGASNDRAKKFGDVPSEPSDTLFLGNLSFDADRDNLYEI 269

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           F +F   I   +     + + +G+G+V ++  + A++A+++ QG  +N R +R+++++ R
Sbjct: 270 FGKFGEIISVRIPTHPETEQPKGFGYVQYTNTEDAKKALDALQGESINDRPVRLDFSTPR 329

>NCAS0C04600 Chr3 (940040..941785) [1746 bp, 581 aa] {ON} Anc_3.49
          Length = 581

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 83/174 (47%), Gaps = 14/174 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED LK YF   G +  +K++ D        + F+ +  P   +   +T 
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK I+    K +   + Q    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 258 HILDGKVID---PKRSIPREEQ----DKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQ 310

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQ 233
           +M D  +GRSRG+GFV++   D   +  ++K  +I   G+ I I  A  R  Q+
Sbjct: 311 LMLDKDTGRSRGFGFVTYDSGDAVDRVCQNK--YIEFKGKQIEIKRAEPRHNQR 362

>ZYRO0A07018g Chr1 complement(573135..574811) [1677 bp, 558 aa] {ON}
           some similarities with uniprot|Q00539 Saccharomyces
           cerevisiae YHR086W NAM8 RNA binding protein component of
           the U1 snRNP protein mutants are defective in meiotic
           recombination and in formation of viable spores involved
           in the formation of DSBs through meiosis-specific
           splicing of MER2 pre-mRNA
          Length = 558

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 92/178 (51%), Gaps = 18/178 (10%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN----------YAFVEY-HQP 113
           LY+G+LD + +E+T++Q +   G    V  L+  NN   +          Y F+E+    
Sbjct: 47  LYMGDLDPSWDENTIRQIWGSLGESNVVIRLMLHNNVSGSGTMGPRNNLGYCFLEFPSTV 106

Query: 114 HDANVAFQTLDGKQIEGNV---IKINWAFQSQHVSSD-DTFNLFVGDLNVDVDDETLTGT 169
           H +N   +  +G QI   V   +K+NWA  S   +   + +++FVGDL  +V +  L   
Sbjct: 107 HASNALLK--NGMQIPNFVHKRLKLNWASSSHSSAGAFNEYSVFVGDLAPNVTESQLFEL 164

Query: 170 F-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
           F   F S     +++D L+G S+GY FV F+     Q+A+   QG  L+GRAIR++ A
Sbjct: 165 FISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLEMQGIFLSGRAIRVSNA 222

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 32/73 (43%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT ++G +     E +L    Q FG I+  K    KGC F++Y     A   I  +  FP
Sbjct: 283 TTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRISAETAIAKMQGFP 342

Query: 374 FQGRNLRTGWGKE 386
                +R  WG+ 
Sbjct: 343 IGNSRVRLSWGRS 355

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 45/99 (45%), Gaps = 5/99 (5%)

Query: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAF 107
           V P  A     + ++  ++VG L   + ED L+ YFQ  G I  VK+ V K        F
Sbjct: 268 VQPQPALNSFTDPNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGK-----GCGF 322

Query: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSS 146
           V+Y     A  A   + G  I  + ++++W   ++  ++
Sbjct: 323 VQYVDRISAETAIAKMQGFPIGNSRVRLSWGRSAKQAAT 361

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +FVG L+  V ++ L   F+ F + +   +         +G GFV + ++  A+ A+   
Sbjct: 285 VFVGGLSSLVAEDELRAYFQPFGTIVYVKIP------VGKGCGFVQYVDRISAETAIAKM 338

Query: 212 QGFILNGRAIRINWA 226
           QGF +    +R++W 
Sbjct: 339 QGFPIGNSRVRLSWG 353

>NCAS0A05890 Chr1 (1156718..1157965) [1248 bp, 415 aa] {ON} 
          Length = 415

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 96/179 (53%), Gaps = 13/179 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK+ F+  G + + +V++++  + +  Y +V++     A  A + 
Sbjct: 163 TIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKE 222

Query: 123 LDGKQIEGNVIKINWAFQSQHVSSDD------------TFNLFVGDLNVDVDDETLTGTF 170
           + GK+I+G  I ++ +       ++D            +  LF+G+L+ + D + ++  F
Sbjct: 223 MQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELF 282

Query: 171 KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
            ++   I   +     + + +G+G+V ++  + A++A+E  QG  ++ R +R+++++ R
Sbjct: 283 SKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRLDYSTPR 341

>KAFR0F03120 Chr6 (620250..621488) [1239 bp, 412 aa] {ON} Anc_4.61
           YGR159C
          Length = 412

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/184 (20%), Positives = 96/184 (52%), Gaps = 13/184 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK  F+  G +   +V+ ++  + +  Y +V++     A  A + 
Sbjct: 166 TIFVGRLSWSIDDEWLKNEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKEYAEKAVKE 225

Query: 123 LDGKQIEGNVIKINWAFQSQHVSSDD------------TFNLFVGDLNVDVDDETLTGTF 170
           + GK+I+G  I  + +       ++D            +  LF+G+L+ + D + ++  F
Sbjct: 226 MHGKEIDGREINCDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDNISEMF 285

Query: 171 KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKRE 230
            +F   +   +     + + +G+G+V ++  + A++A+++ QG  ++ R +R+++++ R 
Sbjct: 286 SKFGEIVSVRIPTHPETEQPKGFGYVQYTNVEDAKKALDALQGEYIDNRPVRLDFSTPRP 345

Query: 231 PQQH 234
           PQ +
Sbjct: 346 PQNN 349

>AFR107W Chr6 (628898..630088) [1191 bp, 396 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR159C (NSR1)
          Length = 396

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 92/184 (50%), Gaps = 14/184 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +++++ LK  F   G +   +V+ ++  +++  Y +V++     A  A + 
Sbjct: 168 TIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSYAEKAVKE 227

Query: 123 LDGKQIEGNVIKINW-------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGT 169
           + GK+I+G  I  +              A +     S  +  LF+G+L+ + D + L   
Sbjct: 228 MHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALFEL 287

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           F +  + I   +     S + +G+G+V +   + AQ A+++ QG  ++ R +RI+++S R
Sbjct: 288 FSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRIDFSSPR 347

Query: 230 EPQQ 233
            PQQ
Sbjct: 348 PPQQ 351

>Kwal_55.21960 s55 complement(1055849..1057642) [1794 bp, 597 aa]
           {ON} YOL123W (HRP1) - putative
           polyadenylated-RNA-binding protein [contig 124] FULL
          Length = 597

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 80/170 (47%), Gaps = 14/170 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED LK YF   G + ++K++ D        + F+ + +    +   +T 
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 271 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 323

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKR 229
           +M D  +GRSRG+GF+++   D   +  E+K  FI   G+ I I  A  R
Sbjct: 324 LMLDKDTGRSRGFGFITYDTPDAVDRVCENK--FIEFKGKRIEIKRAEPR 371

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D   +F+G LN +  ++ L   F ++       +M D  +GRSRG+GF++F+E     
Sbjct: 205 SRDICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVD 264

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 265 EVVKTQH--ILDGKVIDPKRAIPREEQ 289

>KLTH0F18766g Chr6 complement(1521018..1522784) [1767 bp, 588 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 588

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 80/170 (47%), Gaps = 14/170 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED LK YF   G + ++K++ D        + F+ + +    +   +T 
Sbjct: 210 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 269

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 270 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 322

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKR 229
           +M D  +GRSRG+GF+++   D   +  E+K  FI   G+ I I  A  R
Sbjct: 323 LMLDKDTGRSRGFGFITYDTPDAVDRVCENK--FIEFKGKRIEIKRAEPR 370

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D   +F+G LN +  ++ L   F ++       +M D  +GRSRG+GF++F+E     
Sbjct: 204 SRDICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVD 263

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 264 EVVKTQH--ILDGKVIDPKRAIPREEQ 288

>Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {ON}
           complement(24646..26226) [1581 nt, 527 aa]
          Length = 526

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 81/170 (47%), Gaps = 14/170 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT- 122
           +++G L+    E+TL+ YF   G +  +K++ D N   +  + F+ +      +   +T 
Sbjct: 158 MFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTFEDATSVDEVVKTQ 217

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 218 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGADVRPKEFEDFFAQYGTIIDAQ 270

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKR 229
           +M D  +GRSRG+GFV++   D   +  ++K  FI   G+ I I  A  R
Sbjct: 271 LMLDKDTGRSRGFGFVTYDSPDAVDRVCQNK--FIEFKGKQIEIKRAEPR 318

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D+  +F+G LN +  +ETL   F ++   ++  +M D  +GRSRG+GF++F +     
Sbjct: 152 SKDSCKMFIGGLNWETTEETLRDYFNKYGKVVELKIMKDNNTGRSRGFGFLTFEDATSVD 211

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 212 EVVKTQH--ILDGKVIDPKRAIPREEQ 236

>TBLA0C04360 Chr3 complement(1046454..1047665) [1212 bp, 403 aa]
           {ON} Anc_4.61 YGR159C
          Length = 403

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 93/179 (51%), Gaps = 13/179 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK  F+  G + + +V+ +K  + +  Y +V++     A  A + 
Sbjct: 162 TIFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDFKNKTFAEKAIKE 221

Query: 123 LDGKQIEGNVIKINW------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF 170
           + GK+I+G  I  +             A +     S+ +  LF+G+L+ D D + +   F
Sbjct: 222 MQGKEIDGRPINCDMSTSKPASNGGDRAKKFGDTPSEPSETLFLGNLSFDADRDNIYEVF 281

Query: 171 KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
            ++   I   +     + + +G+G+V + + + A++A+++ QG  +N R +R+++++ R
Sbjct: 282 SKYGEIISVRIPTHPETEQPKGFGYVQYGDVESAKKALDALQGEYINNRPVRLDFSTPR 340

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 50/84 (59%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S++   +FVG L+  +DDE L   F+     + A V+++  + RSRGYG+V F  +  A+
Sbjct: 157 SEEPATIFVGRLSWSIDDEWLKTEFEPIGGVLSARVIYEKGTDRSRGYGYVDFKNKTFAE 216

Query: 206 QAMESKQGFILNGRAIRINWASKR 229
           +A++  QG  ++GR I  + ++ +
Sbjct: 217 KAIKEMQGKEIDGRPINCDMSTSK 240

>Skud_6.107 Chr6 (195514..197349) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 50/72 (69%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+GDL+  V +ETL G F +FPSF+ A V  D ++ +S G+G+++F +++ A++AME  
Sbjct: 93  LFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAERAMEEL 152

Query: 212 QGFILNGRAIRI 223
               +NGR IRI
Sbjct: 153 NYTDVNGREIRI 164

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 31/158 (19%), Positives = 69/158 (43%), Gaps = 4/158 (2%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           L++G+L + + E+TLK  F       + KV +D   +++  + ++ +    +A  A + L
Sbjct: 93  LFIGDLHETVTEETLKGIFGKFPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAERAMEEL 152

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +   + G  I+I  + ++     +   N+F  +L ++    T    +  F  +    ++ 
Sbjct: 153 NYTDVNGREIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRY--GKILS 210

Query: 184 DMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAI 221
             L  R +  GFV F  +  A+  ++        G+ I
Sbjct: 211 CKLDSR-KDIGFVYFENEKTARNVIKMYNNTSFFGKKI 247

>SAKL0A07370g Chr1 complement(652628..654100) [1473 bp, 490 aa] {ON}
           weakly similar to uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 490

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 95/231 (41%), Gaps = 67/231 (29%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNN---------------------- 100
           R L++G+LD A +E +++Q +   G   +VK++  K N                      
Sbjct: 29  RTLWMGDLDPAFDESSIQQIWAALGKSVSVKLIRAKKNLLIPCSTSSTFNAGEDASTAQL 88

Query: 101 ---------------------EEANYAFVEYHQPHDANVAFQTLDGKQIEGNVI------ 133
                                  A Y FVE+ +  DA  A  TL+   +  N++      
Sbjct: 89  TDPQKIKINGVSFIDPNTTQLHHAGYCFVEFQKLEDAQWAL-TLNSTPLP-NILSNSTHS 146

Query: 134 ----------KINWA----FQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF-KEFPSFIQ 178
                     ++NWA     QS  + S   F+LFVGDL+    +  L   F K F S   
Sbjct: 147 QTNPTLQRSFRLNWASGATLQSA-IPSTPEFSLFVGDLSPSATEAHLLSLFQKNFKSVKT 205

Query: 179 AHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
             VM D ++G SR +GFV F+++   ++A+    G    GR +R+ +A+ R
Sbjct: 206 VRVMTDPITGASRCFGFVRFADEQERRRALVEMNGVWCQGRCLRVAYATPR 256

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     EP L  L   FG I + +    KGC F+K+++   A   I  +  F 
Sbjct: 367 TTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKGCGFVKFESRIDAEAAIQGMQGFI 426

Query: 374 FQGRNLRTGWGKEK 387
             G  +R  WG+  
Sbjct: 427 VGGNPIRLSWGRSS 440

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 10/87 (11%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +F+G L   + +  L   F  F S     +       + +G GFV F  +  A+ A++  
Sbjct: 369 VFIGGLASQISEPQLYSLFLPFGSITNVRI------PQGKGCGFVKFESRIDAEAAIQGM 422

Query: 212 QGFILNGRAIRINW----ASKREPQQH 234
           QGFI+ G  IR++W      K   QQH
Sbjct: 423 QGFIVGGNPIRLSWGRSSGEKTPTQQH 449

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           +  +++G L   I+E  L   F   G I NV++   K        FV++    DA  A Q
Sbjct: 366 NTTVFIGGLASQISEPQLYSLFLPFGSITNVRIPQGKG-----CGFVKFESRIDAEAAIQ 420

Query: 122 TLDGKQIEGNVIKINWAFQS 141
            + G  + GN I+++W   S
Sbjct: 421 GMQGFIVGGNPIRLSWGRSS 440

>Smik_15.30 Chr15 (55895..57505) [1611 bp, 536 aa] {ON} YOL123W
           (REAL)
          Length = 536

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 82/174 (47%), Gaps = 14/174 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L++YF   G + ++K++ D        + F+ + +P   +   +T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A        D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 221 HILDGK-----VIDPKRAIPRDE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 273

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQ 233
           +M D  +G+SRG+GFV++   D   +  ++K  FI    R I I  A  R  QQ
Sbjct: 274 LMLDKDTGQSRGFGFVTYDSADAVDRVCQNK--FIDFKDRKIEIKRAEPRHMQQ 325

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S ++  +F+G LN D  ++ L   F ++ +     +M D  +GRSRG+GF+SF +     
Sbjct: 155 SKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVD 214

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  R+ Q
Sbjct: 215 EVVKTQH--ILDGKVIDPKRAIPRDEQ 239

>Skud_15.30 Chr15 (52950..54569) [1620 bp, 539 aa] {ON} YOL123W
           (REAL)
          Length = 539

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 82/174 (47%), Gaps = 14/174 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L++YF   G + ++K++ D        + F+ + +P   +   +T 
Sbjct: 164 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 223

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A        D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 224 HILDGK-----VIDPKRAIPRDE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 276

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQ 233
           +M D  +G+SRG+GFV++   D   +  ++K  FI    R I I  A  R  QQ
Sbjct: 277 LMLDKDTGQSRGFGFVTYDSADAVDRVCQNK--FIDFKDRKIEIKRAEPRHMQQ 328

>YOL123W Chr15 (87844..89448) [1605 bp, 534 aa] {ON}  HRP1Subunit of
           cleavage factor I, a five-subunit complex required for
           the cleavage and polyadenylation of pre-mRNA 3' ends;
           RRM-containing heteronuclear RNA binding protein and
           hnRNPA/B family member that binds to poly (A) signal
           sequences
          Length = 534

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 82/174 (47%), Gaps = 14/174 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L++YF   G + ++K++ D        + F+ + +P   +   +T 
Sbjct: 161 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 220

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A        D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 221 HILDGK-----VIDPKRAIPRDE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 273

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQ 233
           +M D  +G+SRG+GFV++   D   +  ++K  FI    R I I  A  R  QQ
Sbjct: 274 LMLDKDTGQSRGFGFVTYDSADAVDRVCQNK--FIDFKDRKIEIKRAEPRHMQQ 325

>TBLA0B08590 Chr2 complement(2052809..2054680) [1872 bp, 623 aa]
           {ON} Anc_3.49 YOL123W
          Length = 623

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 84/176 (47%), Gaps = 14/176 (7%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L+ YF   G + ++K++ D N  ++  + F+ + +    +   +T 
Sbjct: 172 MFIGGLNWETTEDGLRDYFNKYGNVVDLKIMKDNNTGKSRGFGFLTFEKSSSVDEVVKTQ 231

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +F+G +  DV  +     F ++ + I A 
Sbjct: 232 HILDGK-----VIDPKRAIPREE--QDKTGKIFIGGIGADVRPKEFEEFFAKYGNIIDAQ 284

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQHQ 235
           +M D  +GRSRG+GFV++   D   +  + K  FI   G+ I I  A  R  Q  Q
Sbjct: 285 LMLDKDTGRSRGFGFVTYDSPDAVDRVCQHK--FIEFKGKQIEIKRAQPRHNQPRQ 338

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 54/95 (56%), Gaps = 5/95 (5%)

Query: 141 SQHVSSD---DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVS 197
           ++HV +D   D+  +F+G LN +  ++ L   F ++ + +   +M D  +G+SRG+GF++
Sbjct: 158 TEHVRADLSKDSCKMFIGGLNWETTEDGLRDYFNKYGNVVDLKIMKDNNTGKSRGFGFLT 217

Query: 198 FSEQDVAQQAMESKQGFILNGRAIRINWASKREPQ 232
           F +     + ++++   IL+G+ I    A  RE Q
Sbjct: 218 FEKSSSVDEVVKTQH--ILDGKVIDPKRAIPREEQ 250

>KLTH0D03916g Chr4 (378839..380356) [1518 bp, 505 aa] {ON} some
           similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre- rRNA
           processing and ribosome biogenesis
          Length = 505

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 91/178 (51%), Gaps = 14/178 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +++++ LK  F+  G + + +V++++  + +  Y +V++     A  A + 
Sbjct: 257 TIFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKAVKE 316

Query: 123 LDGKQIEGNVIKINW-------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGT 169
           + GK+I+G  I  +              A Q     S  +  LF+G+L+ + D + +  T
Sbjct: 317 MHGKEIDGRPINCDMSTSKPAGNPRNDRAKQFGDTPSQPSDTLFLGNLSFNADRDNIFET 376

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
           F E    +   +     + + +G+G+V +S  D AQ+A E+ QG  ++ R +R+++++
Sbjct: 377 FAEHGEVVSVRLPTHPETNQPKGFGYVQYSSVDEAQKAFEALQGHYIDNRPVRLDFST 434

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 45/78 (57%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +FVG L+  VDDE L   F+     I A V+ +  + RSRGYG+V F  +  A++A++  
Sbjct: 258 IFVGRLSWSVDDEWLKTEFEPIGGVISARVIMERGTDRSRGYGYVDFENKFYAEKAVKEM 317

Query: 212 QGFILNGRAIRINWASKR 229
            G  ++GR I  + ++ +
Sbjct: 318 HGKEIDGRPINCDMSTSK 335

>Suva_15.37 Chr15 (65421..67076) [1656 bp, 551 aa] {ON} YOL123W
           (REAL)
          Length = 551

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 82/174 (47%), Gaps = 14/174 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L++YF   G + ++K++ D        + F+ + +P   +   +T 
Sbjct: 163 MFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ 222

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A        D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 223 HILDGK-----VIDPKRAIPRDE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 275

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQ 233
           +M D  +G+SRG+GFV++   D   +  ++K  FI    R I I  A  R  QQ
Sbjct: 276 LMLDKDTGQSRGFGFVTYDSADAVDRVCQNK--FIDFKDRKIEIKRAEPRHMQQ 327

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S ++  +F+G LN D  ++ L   F ++ +     +M D  +GRSRG+GF+SF +     
Sbjct: 157 SKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVD 216

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  R+ Q
Sbjct: 217 EVVKTQH--ILDGKVIDPKRAIPRDEQ 241

>SAKL0C12672g Chr3 complement(1130702..1132357) [1656 bp, 551 aa]
           {ON} weakly similar to uniprot|Q99383 Saccharomyces
           cerevisiae YOL123W HRP1 Subunit of cleavage factor I a
           five-subunit complex required for the cleavage and
           polyadenylation of pre-mRNA 3' ends RRM-containing
           heteronuclear RNA binding protein and hnRNPA/B family
           member that binds to poly (A) signal sequences
          Length = 551

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 97/223 (43%), Gaps = 21/223 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L+ YF   G + ++K++ D        + F+ + +    +   +T 
Sbjct: 184 MFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVDEVVKTQ 243

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 244 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSQYGTIIDAQ 296

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQHQXXXX 239
           +M D  +GRSRG+GF+++   D   +  ++K  FI   G+ I I  A   EP+  Q    
Sbjct: 297 LMLDKDTGRSRGFGFITYDTPDAVDRVCQNK--FIEFKGKRIEIKRA---EPRHLQKQQQ 351

Query: 240 XXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGPMGMAPQGMA 282
                          QF G+ Q   MG  N   PM   PQ MA
Sbjct: 352 QQQQKQQHDGGSSTGQFNGMFQNPMMGGFN---PM-FNPQAMA 390

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D   +F+G LN +  ++ L   F ++ +     +M D  +GRSRG+GF++F+E     
Sbjct: 178 SRDMCKMFIGGLNWETTEDNLRDYFSKYGAVTDLKIMRDNATGRSRGFGFLTFAESSSVD 237

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 238 EVVKTQH--ILDGKVIDPKRAIPREEQ 262

>Kpol_224.1 s224 complement(931..1584) [654 bp, 217 aa] {ON}
           complement(931..1584) [654 nt, 218 aa]
          Length = 217

 Score = 65.9 bits (159), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 91/187 (48%), Gaps = 17/187 (9%)

Query: 56  GGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKN-NEEANYAFVEYHQPH 114
            G +  D  +YVGN+D +I ++ L + F    PIA +    DK       YAF++++   
Sbjct: 6   SGFKNPDLSVYVGNIDPSITKELLYELFVQISPIAKINYPKDKVLQTHQGYAFIDFYTEE 65

Query: 115 DANVAFQTLDGK-QIEGNVIKINWAFQSQHVSSDDTFNL------------FVGDLNVDV 161
           DAN A Q  +   Q+   V+K+     + ++SS  + NL            FV +L+  V
Sbjct: 66  DANYAIQAFNNNVQLNNRVLKVRKT--NNNISSKSSTNLSQATSVTPYAKIFVKNLDSSV 123

Query: 162 DDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAI 221
           D   L+  FK+F S  +   ++ + +G  R   +V F + + A +A++S  G ++  + I
Sbjct: 124 DVAYLSKLFKKFGSLARESEIFHLSNGELRC-AYVYFKDYEKADEAIKSLDGQLVTNKRI 182

Query: 222 RINWASK 228
            I +A K
Sbjct: 183 NIEYAFK 189

>Skud_7.483 Chr7 complement(790010..791191) [1182 bp, 393 aa] {ON}
           YGR159C (REAL)
          Length = 393

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 94/180 (52%), Gaps = 14/180 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK+ F+  G + + +V+ ++  + +  Y +V++     A  A Q 
Sbjct: 142 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVINERGTDRSRGYGYVDFENKSYAEKAIQE 201

Query: 123 LDGKQIEGNVIKINW-------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGT 169
           + GK+I+G  I  +              A +     S+ +  LF+G+L+ + D +T+   
Sbjct: 202 MQGKEIDGRPINCDLSTSKPAGNNTNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIFEL 261

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           F +    +   +     + + +G+G+V FS  + +++A+ES QG  ++ R +R++++S R
Sbjct: 262 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSSLEDSKKALESLQGEYIDNRPVRLDYSSPR 321

>NDAI0G03970 Chr7 (945738..947561) [1824 bp, 607 aa] {ON} Anc_3.49
           YOL123W
          Length = 607

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 79/169 (46%), Gaps = 12/169 (7%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L+ YF   G +  +K++ D        + F+ +  P   +   +T 
Sbjct: 199 MFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGFLTFEHPSSVDEVVKTQ 258

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK I+    K +   + Q    D    +FVG +  DV  +     F +F + I A 
Sbjct: 259 HILDGKVID---PKRSIPKEEQ----DKIGKIFVGGIGTDVRPKEFEEFFAQFGTIIDAQ 311

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           +M D  +GRSRG+GF+++   D   +  ++K      G+ I +  A +R
Sbjct: 312 LMLDKDTGRSRGFGFITYDSADAVDKVCQNKY-IDFKGKQIEVKRAQQR 359

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 49/87 (56%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D+  +F+G LN +  ++ L   F ++ + I+  +M D  +GRSRG+GF++F       
Sbjct: 193 SKDSCKMFIGGLNWETTEDGLRNYFNKYGNVIELKIMKDGATGRSRGFGFLTFEHPSSVD 252

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    +  +E Q
Sbjct: 253 EVVKTQH--ILDGKVIDPKRSIPKEEQ 277

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 100/239 (41%), Gaps = 60/239 (25%)

Query: 50  PVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNN--------- 100
           P  AT    +   R L++G+LD   +E T+K+ ++  G   ++K++  K N         
Sbjct: 24  PPFATVSTSDEPPRTLWMGDLDPTFDELTIKEIWKRLGKNVSIKLVRAKKNLLIPCSSFT 83

Query: 101 -------------------------------EEANYAFVEYHQPHDANVAFQTLDGK--- 126
                                            A Y F+E+    DA     +L+ K   
Sbjct: 84  NNSGGNSKNETEESSITINGISFIDPMTTQLHHAGYCFIEFDSLKDAQFGL-SLNSKPIP 142

Query: 127 -------QIEGN-----VIKINWAFQSQHVSSDDT---FNLFVGDLNVDVDDETLTGTF- 170
                  ++E N       ++NWA  +   SS  T   ++LFVGDL+    +  L   F 
Sbjct: 143 NFKSISTELETNPSGQRTFRLNWASGATLQSSIPTTPEYSLFVGDLSPMTTEADLLKLFQ 202

Query: 171 KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           K F S     VM D ++G SR +GF+  S++   ++A++   G +L+GR +R+  A+ R
Sbjct: 203 KTFKSVKTVRVMTDPITGESRCFGFIRLSDEFEREEALDKMNGTLLHGRQLRVALANPR 261

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  ++VGNL+  I ED L++ F+  G I  VK+   K        FV++    DA  + 
Sbjct: 320 TNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGK-----KCGFVKFCNKIDAEASM 374

Query: 121 QTLDGKQIEGNVIKINW 137
             L G  + G+ I+I+W
Sbjct: 375 YGLQGYFVAGSPIRISW 391

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 60/131 (45%), Gaps = 12/131 (9%)

Query: 101 EEANYAFVEYHQPHDANVAFQT----LDGKQIEGNVIKINWAFQSQHVSSDDTFN--LFV 154
           E+A    VE  + H+  +  +T       + ++ +   +N    ++  S +D  N  +FV
Sbjct: 267 EQAPSQVVEDKKKHNEPLLLETAKKLFSKELLKNSSSNVNDVKSNEDHSDNDPTNTTVFV 326

Query: 155 GDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGF 214
           G+LN  + ++ L   F+ F +  +  +         +  GFV F  +  A+ +M   QG+
Sbjct: 327 GNLNCKITEDELQKVFEPFGAIEKVKI------PPGKKCGFVKFCNKIDAEASMYGLQGY 380

Query: 215 ILNGRAIRINW 225
            + G  IRI+W
Sbjct: 381 FVAGSPIRISW 391

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 31/70 (44%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT ++GN+     E +L  + + FG I   K  P K C F+K+     A   +  L  + 
Sbjct: 322 TTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGLQGYF 381

Query: 374 FQGRNLRTGW 383
             G  +R  W
Sbjct: 382 VAGSPIRISW 391

>KLLA0C12925g Chr3 (1094574..1096286) [1713 bp, 570 aa] {ON} weakly
           similar to uniprot|Q99383 Saccharomyces cerevisiae
           YOL123W HRP1 Subunit of cleavage factor I a five-subunit
           complex required for the cleavage and polyadenylation of
           pre-mRNA 3' ends RRM-containing heteronuclear RNA
           binding protein and hnRNPA/B family member that binds to
           poly (A) signal sequences
          Length = 570

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 14/176 (7%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQT- 122
           +++G L+    E+ L+ YF   G +A VK++ D        + F+ +      +   +T 
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQ 247

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ S I A 
Sbjct: 248 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQ 300

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQHQ 235
           +M D  +GRSRG+GF+++   D   +  ++K  FI   G+ I I  A  R+ Q+ +
Sbjct: 301 LMLDKDTGRSRGFGFITYDTPDAVDRVCQNK--FIEFKGKQIEIKRAEPRQLQKQK 354

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D   +F+G LN +  +E L   F ++ +  +  +M D  +GRSRG+GF++F       
Sbjct: 182 SRDINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFENASSVD 241

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 242 EVVKTQH--ILDGKVIDPKRAIPREEQ 266

>CAGL0E01947g Chr5 (193462..194820) [1359 bp, 452 aa] {ON} some
           similarities with uniprot|Q99383 Saccharomyces
           cerevisiae YOL123w HRP1
          Length = 452

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 81/174 (46%), Gaps = 14/174 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L+ YF   G +  +K++ D        + F+ +      +   +T 
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 184 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 236

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQ 233
           +M D  +GRSRG+GF+++   D   +  ++K  FI   GR I I  A+ R  Q+
Sbjct: 237 LMLDKDTGRSRGFGFITYDTPDAVDKVCQNK--FIDFKGRKIEIKRAAPRHLQK 288

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D+  +F+G LN +  ++ L   F ++    +  +M D  +GRSRG+GF++F       
Sbjct: 118 SKDSCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVD 177

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 178 EVVKTQH--ILDGKVIDPKRAIPREEQ 202

>TDEL0F02910 Chr6 complement(525879..527189) [1311 bp, 436 aa] {ON}
           Anc_4.61 YGR159C
          Length = 436

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 92/180 (51%), Gaps = 14/180 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK  F   G + + +V+ ++  + +  Y +V++     A  A + 
Sbjct: 188 TIFVGRLSWSIDDEWLKNEFDHIGGVVSARVIYERGTDRSRGYGYVDFEDKSYAEKAVKE 247

Query: 123 LDGKQIEGNVIKINW-------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGT 169
           + GK+I+G  I  +              A +   + S+ +  LF+G+L+ + D + +   
Sbjct: 248 MHGKEIDGRPINCDLSTSKPAGNPRDDRAKKFGDLPSEPSETLFLGNLSFNADRDNIYEM 307

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           F +F   +   +     + + +G+G+V +   D A++A+++ QG  ++ R +R+++++ R
Sbjct: 308 FSKFGEIVSVRIPTHPETEQPKGFGYVQYGNVDDAKKALDALQGEYIDNRPVRLDYSTPR 367

>Ecym_3082 Chr3 complement(152514..154274) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii AAR151W
          Length = 586

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 95/231 (41%), Gaps = 62/231 (26%)

Query: 59  ETSD---RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNN--------------- 100
           +TSD   R L++G+LD + +E T++Q +   G    VK++  K N               
Sbjct: 15  QTSDEPPRTLWMGDLDPSFDETTIQQIWMTLGHQVQVKLIRAKKNLLIPCSTSSTLASSQ 74

Query: 101 ----------------------EEANYAFVEYHQPHDANVAFQTLDGKQIEGNV------ 132
                                   A Y FV++    +A    Q L+   +   +      
Sbjct: 75  HVEDERIQINGVSFIDPNTTQLHHAGYCFVQFPSLQEAQAGLQ-LNSTPLPNLISSTTHN 133

Query: 133 ---------IKINWA----FQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFK-EFPSFIQ 178
                     ++NWA     QS  + +   F+LFVGDL+    +  L   F+ +F S   
Sbjct: 134 PTNPTAKRNFRLNWASGATLQS-DIPTTPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKT 192

Query: 179 AHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
             VM D ++G SR +GFV F+++   ++A+    G    GR +R+ +A+ R
Sbjct: 193 VRVMTDPITGASRCFGFVRFADEQERRRALVEMNGIWCQGRQLRVAYATPR 243

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG + +   E  L  L   FG I+  K  P KGC F+K++    A   I  +  F 
Sbjct: 398 TTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGKGCGFVKFEHRLDAEAAIQGMQGFI 457

Query: 374 FQGRNLRTGWGK 385
                +R  WG+
Sbjct: 458 VGNSAIRLSWGR 469

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
            +F+G LN  + +  L   F  F + +   V         +G GFV F  +  A+ A++ 
Sbjct: 399 TVFIGGLNNQITESQLQSLFMPFGNILSVKV------PPGKGCGFVKFEHRLDAEAAIQG 452

Query: 211 KQGFILNGRAIRINW 225
            QGFI+   AIR++W
Sbjct: 453 MQGFIVGNSAIRLSW 467

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 56  GGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHD 115
           G  + S+  +++G L+  I E  L+  F   G I +VKV   K        FV++    D
Sbjct: 391 GYTDPSNTTVFIGGLNNQITESQLQSLFMPFGNILSVKVPPGKG-----CGFVKFEHRLD 445

Query: 116 ANVAFQTLDGKQIEGNVIKINW 137
           A  A Q + G  +  + I+++W
Sbjct: 446 AEAAIQGMQGFIVGNSAIRLSW 467

>NDAI0A06170 Chr1 complement(1403026..1404684) [1659 bp, 552 aa]
           {ON} Anc_3.49
          Length = 552

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 85/174 (48%), Gaps = 14/174 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT- 122
           L++G L+    E+ LK YF   G + ++K++ D N+  +  + F+ +  P   +   ++ 
Sbjct: 231 LFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSFEHPSSVDEVVKSQ 290

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 291 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 343

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQQ 233
           +M D  +GRSRG+GF+++   +   +  ++K  +I    + I I  A+ R  Q+
Sbjct: 344 LMLDKDTGRSRGFGFITYDSGEAVDRVCQNK--YIQFKDKQIEIKRAAPRHNQR 395

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S ++  LF+G LN +  +E L   F ++ + +   +M D  SGRSRG+GF+SF       
Sbjct: 225 SKESCKLFIGGLNWETTEEKLKDYFSKYGNVVDLKIMKDANSGRSRGFGFLSFEHPSSVD 284

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++S+   IL+G+ I    A  RE Q
Sbjct: 285 EVVKSQH--ILDGKVIDPKRAIPREEQ 309

>Suva_7.450 Chr7 complement(775898..777073) [1176 bp, 391 aa] {ON}
           YGR159C (REAL)
          Length = 391

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 95/181 (52%), Gaps = 15/181 (8%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK+ F+  G + + +V++++  + +  Y +V++     A  A Q 
Sbjct: 138 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVILERGTDRSRGYGYVDFENQSYAEKAIQE 197

Query: 123 LDGKQIEGNVIKIN--------------WAFQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
           + GK+I+G  I  +               A +     S+ +  LF+G+L+ + D +T+  
Sbjct: 198 MQGKEIDGRPINCDISTSKPAGNNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDTIFE 257

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F +    +   +     + + +G+G+V ++  D A++A+++ QG  ++ R +R++++S 
Sbjct: 258 MFAKHGEVVSVRIPTHPETEQPKGFGYVQYTNLDDAKKALDALQGEYIDNRPVRLDYSSP 317

Query: 229 R 229
           R
Sbjct: 318 R 318

>YGR159C Chr7 complement(806412..807656) [1245 bp, 414 aa] {ON}
           NSR1Nucleolar protein that binds nuclear localization
           sequences, required for pre-rRNA processing and ribosome
           biogenesis
          Length = 414

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 92/178 (51%), Gaps = 12/178 (6%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK+ F+  G +   +V+ ++  + +  Y +V++     A  A Q 
Sbjct: 169 TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 228

Query: 123 LDGKQIEGNVIKINW-----------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFK 171
           + GK+I+G  I  +            A +     S+ +  LF+G+L+ + D + +   F 
Sbjct: 229 MQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFA 288

Query: 172 EFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           +    +   +     + + +G+G+V FS  + A++A+++ QG  ++ R +R++++S R
Sbjct: 289 KHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPR 346

>NCAS0A10010 Chr1 complement(2003039..2004559) [1521 bp, 506 aa]
           {ON} Anc_3.49
          Length = 506

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 12/173 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQT- 122
           L++G L+    ED LK YF   G + ++K++ D        + F+ +      +   +T 
Sbjct: 195 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 254

Query: 123 --LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
             LDGK     VI    A   +    D T  +FVG +  DV  +     F ++ + I A 
Sbjct: 255 HILDGK-----VIDPKRAIPREE--QDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 307

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQ 233
           +M D  +GRSRG+GF+++   +   +  ++K      G+ I I  A+ R  Q+
Sbjct: 308 LMLDKDTGRSRGFGFITYDSSEAVDRVCQNKY-IDFKGKQIEIKRAAPRHMQK 359

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S +   LF+G LN +  ++ L   F ++ + +   +M D  +GRSRG+GF++F       
Sbjct: 189 SKECCKLFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVD 248

Query: 206 QAMESKQGFILNGRAIRINWASKREPQ 232
           + ++++   IL+G+ I    A  RE Q
Sbjct: 249 EVVKTQH--ILDGKVIDPKRAIPREEQ 273

>YBR212W Chr2 (647886..649904) [2019 bp, 672 aa] {ON}  NGR1RNA
           binding protein that negatively regulates growth rate;
           interacts with the 3' UTR of the mitochondrial porin
           (POR1) mRNA and enhances its degradation; overexpression
           impairs mitochondrial function; interacts with Dhh1p to
           mediate POR1 mRNA decay; expressed in stationary phase
          Length = 672

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 68/147 (46%), Gaps = 22/147 (14%)

Query: 103 ANYAFVEYHQPHDANVAFQTLDGKQIEG---------------NVIKINWA----FQSQH 143
           A Y FVE+    DA  A  +L+   +                    ++NWA     QS  
Sbjct: 128 AGYCFVEFETQKDAKFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSS- 185

Query: 144 VSSDDTFNLFVGDLNVDVDDETLTGTFK-EFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           + S   F+LFVGDL+    +  L   F+  F S     VM D L+G SR +GFV F ++D
Sbjct: 186 IPSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDED 245

Query: 203 VAQQAMESKQGFILNGRAIRINWASKR 229
             ++A+    G    GRA+R+ +A+ R
Sbjct: 246 ERRRALIEMSGKWFQGRALRVAYATPR 272

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  ++VG L     E  L+  F+  GPI NV++   KN       FV++ +  DA  + 
Sbjct: 358 TNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKN-----CGFVKFEKRIDAEASI 412

Query: 121 QTLDGKQIEGNVIKINWA 138
           Q L G  + G+ I+++W 
Sbjct: 413 QGLQGFIVGGSPIRLSWG 430

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 7/95 (7%)

Query: 133 IKINWAFQSQHVSSDDT-FNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSR 191
           +++N +  S   ++D T   +FVG L     +  L   FK F   +   +         +
Sbjct: 342 MRVNDSLPSNTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI------PNGK 395

Query: 192 GYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
             GFV F ++  A+ +++  QGFI+ G  IR++W 
Sbjct: 396 NCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 430

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L  F 
Sbjct: 360 TTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQGFI 419

Query: 374 FQGRNLRTGWGK 385
             G  +R  WG+
Sbjct: 420 VGGSPIRLSWGR 431

>Smik_6.264 Chr6 complement(425625..426812) [1188 bp, 395 aa] {ON}
           YGR159C (REAL)
          Length = 395

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 93/180 (51%), Gaps = 14/180 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK+ F+  G + + +V+ ++  + +  Y +V++     A  A Q 
Sbjct: 148 TIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDFENKSYAEKAIQE 207

Query: 123 LDGKQIEGNVIKINW-------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGT 169
           + GK+I+G  I  +              A +     S+ +  LF+G+L+ + D + +   
Sbjct: 208 MQGKEIDGRPINCDMSTSKPASNNNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDVIFEL 267

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           F +    +   +     + + +G+G+V FS  + A++A+++ QG  ++ R +R++++S R
Sbjct: 268 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPR 327

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 53/90 (58%)

Query: 140 QSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFS 199
           + ++  S++   +FVG L+  +DDE L   F+     I A V+++  + RSRGYG+V F 
Sbjct: 137 KQKNEESEEPATIFVGRLSWSIDDEWLKKEFEHIGGVISARVIYERGTDRSRGYGYVDFE 196

Query: 200 EQDVAQQAMESKQGFILNGRAIRINWASKR 229
            +  A++A++  QG  ++GR I  + ++ +
Sbjct: 197 NKSYAEKAIQEMQGKEIDGRPINCDMSTSK 226

>SAKL0D09680g Chr4 (803363..805381) [2019 bp, 672 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 672

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 55/93 (59%)

Query: 131 NVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRS 190
           +++K++    S ++SS     LF+GDL+  V ++ L  TF ++PS +   +  D +S RS
Sbjct: 83  DIVKLDKLKDSLYLSSKRLVALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRS 142

Query: 191 RGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
            GYG+++FS  + A++A E      L G+ +RI
Sbjct: 143 LGYGYINFSNDEDAEKATEEFNYVPLFGKEVRI 175

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 69/153 (45%), Gaps = 10/153 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           L++G+LD+ + E  L+  F     + +VK+ VD  ++ +  Y ++ +    DA  A +  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDL---NVDVDDETLTGTFKEFPSFIQAH 180
           +   + G  ++I  + ++     +   N+F  +L   N+ +       TFK++   +   
Sbjct: 164 NYVPLFGKEVRIMPSLRNSFYRKNIGTNVFFSNLPLENLSLTTRAFYDTFKKYGKILSCK 223

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQG 213
           +       R +  GF+ F +   A+ A++   G
Sbjct: 224 L------DRRKNIGFIYFDKDTSAKSAIDDFNG 250

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANV-KVLVDKNNEEANYAFVEYHQPHDANVAFQTL 123
           ++V NL    NED +  +F   GP+ +V    V K N  +++AFV Y +  D + A + L
Sbjct: 314 IFVKNLPVNANEDDILDFFSRIGPVKSVFTSKVPKYN--SSWAFVTYKKGSDTSEAIEKL 371

Query: 124 DGKQIEGNVIKINWA 138
           +G+  +   I++  A
Sbjct: 372 NGEIFKHRKIEVARA 386

>TPHA0K01910 Chr11 complement(401616..402866) [1251 bp, 416 aa] {ON}
           Anc_4.61 YGR159C
          Length = 416

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 92/179 (51%), Gaps = 15/179 (8%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK  F   G +   +V++++  + +  Y +V++     A  A + 
Sbjct: 158 TIFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKE 217

Query: 123 LDGKQIEGNVIKINW--------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
           + GK+I+G  I  +               A +   + S+ +  LF+G+L+ + D +++  
Sbjct: 218 MHGKEIDGREINCDMSTSKPAGSNNGADRAKKFGDIPSEPSETLFLGNLSFNADRDSIWE 277

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
            F +F   +   +     + + +G+G+V +   D A++A+E+ QG  ++ R +R+++++
Sbjct: 278 MFSKFGEIVSVRLPTHPETEQPKGFGYVQYGNIDDAKKALEALQGEYIDNRPVRLDYST 336

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 46/78 (58%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +FVG L+  +DDE L   F      I A VM +  + RSRGYG+V FS++  A++A++  
Sbjct: 159 IFVGRLSWSIDDEWLKNEFDHIGGVIGARVMLERGTDRSRGYGYVDFSDKSYAEKAIKEM 218

Query: 212 QGFILNGRAIRINWASKR 229
            G  ++GR I  + ++ +
Sbjct: 219 HGKEIDGREINCDMSTSK 236

>Skud_2.345 Chr2 (616731..618725) [1995 bp, 664 aa] {ON} YBR212W
           (REAL)
          Length = 664

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 67/147 (45%), Gaps = 22/147 (14%)

Query: 103 ANYAFVEYHQPHDANVAFQTLDGKQIEG---------------NVIKINWA----FQSQH 143
           A Y FVE+    DA  A  +L+   +                    ++NWA     QS  
Sbjct: 127 AGYCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNAQTNPTFKRTFRLNWASGATLQSS- 184

Query: 144 VSSDDTFNLFVGDLNVDVDDETLTGTFK-EFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           + S   F+LFVGDL+    +  L   F+  F S     VM D L+G SR +GFV F  +D
Sbjct: 185 IPSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNED 244

Query: 203 VAQQAMESKQGFILNGRAIRINWASKR 229
             ++A+    G    GRA+R+ +A+ R
Sbjct: 245 ERRRALIEMSGKWFQGRALRVAYATPR 271

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  ++VG L     E  L+  F+  GPI NV++   KN       FV++ +  DA  + 
Sbjct: 357 TNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGKN-----CGFVKFEKRIDAEASI 411

Query: 121 QTLDGKQIEGNVIKINWA 138
           Q L G  + G+ I+++W 
Sbjct: 412 QGLQGFIVGGSPIRLSWG 429

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L  F 
Sbjct: 359 TTVFVGGLVPKTAEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQGFI 418

Query: 374 FQGRNLRTGWGK 385
             G  +R  WG+
Sbjct: 419 VGGSPIRLSWGR 430

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 7/95 (7%)

Query: 133 IKINWAFQSQHVSSDDT-FNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSR 191
           ++ N    S   +SD T   +FVG L     +  L   FK F   +   +         +
Sbjct: 341 VRANEFLPSNTYNSDPTNTTVFVGGLVPKTAEFQLRSLFKPFGPILNVRI------PNGK 394

Query: 192 GYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
             GFV F ++  A+ +++  QGFI+ G  IR++W 
Sbjct: 395 NCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

>KLLA0C11495g Chr3 complement(990832..992169) [1338 bp, 445 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 445

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 88/177 (49%), Gaps = 14/177 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK  F+  G + + +V+ ++  + +  Y +V++     A  A + 
Sbjct: 197 TIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKE 256

Query: 123 LDGKQIEGNVIKINW-------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGT 169
           + GK+I+G  I  +              A +   V S+ +  LF+G+L+ + D + L   
Sbjct: 257 MHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFEADRDNLYEI 316

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
           F ++   +   +     + + +G+G+V +   + A +A E  QG  +N R +R++++
Sbjct: 317 FGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRPVRLDYS 373

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 47/78 (60%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +FVG L+  +DDE L   F+     I A VM++  + RSRGYG+V F ++  A++A++  
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 212 QGFILNGRAIRINWASKR 229
            G  ++GR I  + ++ +
Sbjct: 258 HGKEIDGRPINCDMSTSK 275

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 2/86 (2%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEE-ANYAFVEYHQPHDAN 117
           E SD  L++GNL    + D L + F   G I +V++      E+   + +V+Y    DA 
Sbjct: 294 EPSD-TLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDAT 352

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQH 143
            AF+ L G+ I    ++++++   Q+
Sbjct: 353 KAFEGLQGEYINNRPVRLDYSIPKQN 378

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 78/168 (46%), Gaps = 25/168 (14%)

Query: 87  GPIANVK--VLVDKNNEE---ANYAFVEYHQPHDANVAFQTLDGKQI------EGNV--- 132
           GP  N+     +D N  +   A Y FVE+    DA  A  TL+   +       G+V   
Sbjct: 89  GPKININGVSFIDPNTTQLHHAGYCFVEFESLADAQWAL-TLNSSPLPDITCGNGHVSTN 147

Query: 133 ------IKINWAFQSQHVS---SDDTFNLFVGDLNVDVDDETLTGTF-KEFPSFIQAHVM 182
                  ++NWA  +  +S   S   F+LFVGDL+    +  L   F K+F S     VM
Sbjct: 148 PSGLRNFRLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVM 207

Query: 183 WDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKRE 230
            D ++G SR +GFV F ++   ++A+    G    GR +R+ +A+ R 
Sbjct: 208 TDPITGASRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYATPRN 255

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 33/72 (45%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E  L  L   FG II+ K  P KGC F+KY     A   I  +  F 
Sbjct: 396 TTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQGFI 455

Query: 374 FQGRNLRTGWGK 385
             G  +R  WG+
Sbjct: 456 VGGNPIRLSWGR 467

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +F+G L   + +  L   F  F + I   +         +G GFV ++ +  A+ A++  
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAIINVKI------PPGKGCGFVKYAYRIDAEAAIQGM 451

Query: 212 QGFILNGRAIRINW 225
           QGFI+ G  IR++W
Sbjct: 452 QGFIVGGNPIRLSW 465

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           +  +++G L   I+E  L   F   G I NVK+   K        FV+Y    DA  A Q
Sbjct: 395 NTTVFIGGLTSQISERQLHSLFSPFGAIINVKIPPGKG-----CGFVKYAYRIDAEAAIQ 449

Query: 122 TLDGKQIEGNVIKINWAFQS 141
            + G  + GN I+++W   S
Sbjct: 450 GMQGFIVGGNPIRLSWGRTS 469

>Suva_6.95 Chr6 (165163..167004) [1842 bp, 613 aa] {ON} YFR023W
           (REAL)
          Length = 613

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 48/72 (66%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+GDL+  V +ETL   F ++PSF+ A V  D +S +S G+G+++F +++ A +AME  
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 212 QGFILNGRAIRI 223
               +NG+ IRI
Sbjct: 153 NYTEVNGKEIRI 164

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/146 (19%), Positives = 69/146 (47%), Gaps = 4/146 (2%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           L++G+L + + E+TLK  F       + KV +D  ++++  + ++ +    +A  A + L
Sbjct: 93  LFIGDLHETVTEETLKDVFGKYPSFVSAKVCLDSVSKKSLGHGYLNFEDKEEAGKAMEEL 152

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +  ++ G  I+I  + ++     +   N+F  +L ++    T    +  F  +    ++ 
Sbjct: 153 NYTEVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPQLTTRAFYDTFSRY--GKILS 210

Query: 184 DMLSGRSRGYGFVSFSEQDVAQQAME 209
             L  R +  GFV F ++  A+  ++
Sbjct: 211 CKLDSR-KDIGFVYFEDEKTARNVIK 235

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 67/147 (45%), Gaps = 22/147 (14%)

Query: 103 ANYAFVEYHQPHDANVAFQTLDGKQIEG---------------NVIKINWA----FQSQH 143
           A Y FVE+    DA  A  +L+   +                    ++NWA     QS  
Sbjct: 127 AGYCFVEFETQKDAQFAL-SLNATPLPNFYSPTTNSQTNSTFKRTFRLNWASGATLQSS- 184

Query: 144 VSSDDTFNLFVGDLNVDVDDETLTGTFK-EFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           + S   F+LFVGDL+    +  L   F+  F S     VM D L+G SR +GFV F  +D
Sbjct: 185 IPSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNED 244

Query: 203 VAQQAMESKQGFILNGRAIRINWASKR 229
             ++A+    G    GRA+R+ +A+ R
Sbjct: 245 ERRRALIEMSGKWFQGRALRVAYATPR 271

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  ++VG L     E  L+  F+  GPI NV++   KN       FV++ +  DA  + 
Sbjct: 354 TNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKN-----CGFVKFEKRIDAEASI 408

Query: 121 QTLDGKQIEGNVIKINWA 138
           Q L G  + G+ I+++W 
Sbjct: 409 QGLQGFIVGGSPIRLSWG 426

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L  F 
Sbjct: 356 TTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQGFI 415

Query: 374 FQGRNLRTGWGK 385
             G  +R  WG+
Sbjct: 416 VGGSPIRLSWGR 427

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 8/90 (8%)

Query: 139 FQSQHVSSDDTFN--LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFV 196
           F   H  + D  N  +FVG L     +  L   FK F   +   +         +  GFV
Sbjct: 343 FLPSHTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI------PNGKNCGFV 396

Query: 197 SFSEQDVAQQAMESKQGFILNGRAIRINWA 226
            F ++  A+ +++  QGFI+ G  IR++W 
Sbjct: 397 KFEKRIDAEASIQGLQGFIVGGSPIRLSWG 426

>Smik_2.355 Chr2 (633903..636113) [2211 bp, 736 aa] {ON} YBR212W
           (REAL)
          Length = 736

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 67/147 (45%), Gaps = 22/147 (14%)

Query: 103 ANYAFVEYHQPHDANVAFQTLDGKQIEG---------------NVIKINWA----FQSQH 143
           A Y FVE+    DA  A  +L+   +                    ++NWA     QS  
Sbjct: 127 AGYCFVEFETQTDAQFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSS- 184

Query: 144 VSSDDTFNLFVGDLNVDVDDETLTGTFK-EFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           + S   F+LFVGDL+    +  L   F+  F S     VM D L+G SR +GFV F  +D
Sbjct: 185 IPSTPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGNED 244

Query: 203 VAQQAMESKQGFILNGRAIRINWASKR 229
             ++A+    G    GRA+R+ +A+ R
Sbjct: 245 ERRRALIEMSGKWFQGRALRVAYATPR 271

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  ++VG L     E  L+  F+  GPI NV++   K     N  FV++ +  DA  + 
Sbjct: 357 TNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGK-----NCGFVKFEKRIDAEASI 411

Query: 121 QTLDGKQIEGNVIKINWA 138
           Q L G  + G+ I+++W 
Sbjct: 412 QGLQGFIVGGSPIRLSWG 429

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT ++G +     E  L  L + FG I++ +    K C F+K++    A   I  L  F 
Sbjct: 359 TTVFVGGLGPKTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKFEKRIDAEASIQGLQGFI 418

Query: 374 FQGRNLRTGWGK 385
             G  +R  WG+
Sbjct: 419 VGGSPIRLSWGR 430

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 7/95 (7%)

Query: 133 IKINWAFQSQHVSSDDT-FNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSR 191
           ++ N +  S   ++D T   +FVG L     +  L   FK F   +   +         +
Sbjct: 341 MRQNESLPSNTFNTDPTNTTVFVGGLGPKTTEFQLRSLFKPFGPILNVRI------PNGK 394

Query: 192 GYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
             GFV F ++  A+ +++  QGFI+ G  IR++W 
Sbjct: 395 NCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWG 429

>SAKL0H23562g Chr8 complement(2037551..2038816) [1266 bp, 421 aa]
           {ON} some similarities with uniprot|Q754G3 Ashbya
           gossypii AFR107W AFR107Wp and some similarites with
           YGR159C uniprot|P27476 Saccharomyces cerevisiae YGR159C
           NSR1 Nucleolar protein that binds nuclear localization
           sequences required for pre-rRNA processing and ribosome
           biogenesis
          Length = 421

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 102/236 (43%), Gaps = 20/236 (8%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L  +I+++ LK  F   G + + +V+ ++ ++ +  Y +V++   H A  A + 
Sbjct: 174 TIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVKE 233

Query: 123 LDGKQIEGNVIKINW-------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGT 169
           + GK+I+G  I  +              A +   V S  +  LF+G+L+ + D + L   
Sbjct: 234 MHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFNADRDNLFEI 293

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           F +    I   +     + + +G+G+V +   D A++A E+ QG  ++ R +R++++  R
Sbjct: 294 FSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRPVRLDYSIPR 353

Query: 230 EPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQG------HPMGSPNNAGPMGMAPQ 279
           +                        +              P GS +N  P+G A Q
Sbjct: 354 QNNNGGSRGGFGDRGGNRGGSRGGSRGGSRGGFGNRGGFKPSGSGSNTAPLGRARQ 409

>KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 87/171 (50%), Gaps = 8/171 (4%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKN-NEEANYAFVEYHQPHDANVAFQTL 123
           +YVGN+D  ++++ L + F   GP+A ++   DK       +AFVE++ P DA  A + L
Sbjct: 12  VYVGNVDPKVSKELLYELFLQIGPVAKIRYPKDKVLQTHQGFAFVEFNSPQDAEYASKCL 71

Query: 124 DGK-QIEGNVIKINWAF-QSQHVSSDDTFN----LFVGDLNVDVDDETLTGTFKEFPSFI 177
           +   ++    +K+  A   S   +S +  +    LF+ +++  VD E LT  F +F S +
Sbjct: 72  NNTVRLYDRTLKVRKANGASSSPTSQNALDVGAKLFIKNIDELVDSEMLTKIFGKFGSLV 131

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
           +   ++ +  G  R   ++ +S  + +  A+E     ++  + I I++A K
Sbjct: 132 RPPEIFTLKQGLLRC-AYICYSTFEHSDAALEKLNNQMVMNKCISIDYAYK 181

>TDEL0G03670 Chr7 complement(675820..677673) [1854 bp, 617 aa] {ON}
           Anc_6.104 YBR212W
          Length = 617

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 67/148 (45%), Gaps = 24/148 (16%)

Query: 103 ANYAFVEYHQPHDANVAFQTLDGKQIEGNVI----------------KINWA----FQSQ 142
           A Y FVE+    DA  A     G     N+I                ++NWA     QS 
Sbjct: 139 AGYCFVEFESQQDAQFALSLNSGPL--PNIISRSTNLPTNPSGQRNFRLNWASGATLQSS 196

Query: 143 HVSSDDTFNLFVGDLNVDVDDETLTGTFKE-FPSFIQAHVMWDMLSGRSRGYGFVSFSEQ 201
            + S   F+LFVGDL+    +  L   F++ F S     VM D ++G SR +GFV F  +
Sbjct: 197 -IPSRPEFSLFVGDLSPTATEADLLSLFQQKFRSVKTVRVMTDPITGASRCFGFVRFGNE 255

Query: 202 DVAQQAMESKQGFILNGRAIRINWASKR 229
           +  ++A+    G    GR +R+ +A+ R
Sbjct: 256 EERRRALVEMNGVWCQGRCLRVAYATPR 283

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 33/81 (40%)

Query: 309 APQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVA 368
            P   TT +IG +     E  L  L   FG I+  K    K C F+KY+    A   I  
Sbjct: 381 TPPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGKNCGFVKYENRIDAEAAIQG 440

Query: 369 LANFPFQGRNLRTGWGKEKPA 389
           +  F   G  +R  WG+   A
Sbjct: 441 MQGFIVGGNPVRLSWGRNTVA 461

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  +++G L   INE  L+  F   G I  VK+   KN       FV+Y    DA  A 
Sbjct: 384 NNTTVFIGGLTPKINEAQLQALFSPFGNILTVKIPQGKN-----CGFVKYENRIDAEAAI 438

Query: 121 QTLDGKQIEGNVIKINWA 138
           Q + G  + GN ++++W 
Sbjct: 439 QGMQGFIVGGNPVRLSWG 456

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/84 (21%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 143 HVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           + +  +   +F+G L   +++  L   F  F + +   +       + +  GFV +  + 
Sbjct: 379 YTTPPNNTTVFIGGLTPKINEAQLQALFSPFGNILTVKI------PQGKNCGFVKYENRI 432

Query: 203 VAQQAMESKQGFILNGRAIRINWA 226
            A+ A++  QGFI+ G  +R++W 
Sbjct: 433 DAEAAIQGMQGFIVGGNPVRLSWG 456

>TBLA0A09920 Chr1 (2434186..2435970) [1785 bp, 594 aa] {ON}
           Anc_6.104 YBR212W
          Length = 594

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 66/147 (44%), Gaps = 18/147 (12%)

Query: 101 EEANYAFVEYHQPHDANVAFQ--------------TLDGKQIEGNVIKINWAFQSQHVSS 146
             A Y FVE+    DA  A                +L          ++NWA  +   SS
Sbjct: 127 HHAGYCFVEFANQVDAKFALSLNSSPIPNFYSSSISLHTNPNNNRNFRLNWASGATLNSS 186

Query: 147 ---DDTFNLFVGDLNVDVDDETLTGTF-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
                 F+LFVGDL+  V +  L   F K+F S     VM D ++G SR +GF+ F+++ 
Sbjct: 187 IPLTPEFSLFVGDLSPLVTEADLLSLFQKKFKSVKTVRVMTDPITGTSRCFGFIRFTDEL 246

Query: 203 VAQQAMESKQGFILNGRAIRINWASKR 229
             + A+    G   NGR +R+ +A+ R
Sbjct: 247 ERKNALIEMNGIWCNGRPLRVAYATPR 273

>Kpol_530.46 s530 complement(104488..106251) [1764 bp, 587 aa] {ON}
           complement(104488..106251) [1764 nt, 588 aa]
          Length = 587

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (48%), Gaps = 13/141 (9%)

Query: 98  KNNEEANYAFVEYHQP-----HDANVAFQTLDGKQIEGNVIKINWAFQSQHVSS---DDT 149
           +N E+A YA      P      D+N  +    GK+      ++NWA  +   SS      
Sbjct: 172 QNQEDAQYALSLNSNPIPNILSDSNNLYTNPTGKR----NFRLNWASGATLQSSIPVTPE 227

Query: 150 FNLFVGDLNVDVDDETLTGTFKE-FPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAM 208
           F+LFVGDL+    +  L   F++ + S     VM D ++G SR +GF+ F +QD  ++A+
Sbjct: 228 FSLFVGDLSPTATEADLLSLFQQQYRSVKTVRVMTDPITGASRCFGFIRFGDQDERKRAL 287

Query: 209 ESKQGFILNGRAIRINWASKR 229
               G    GR +R+ +A+ R
Sbjct: 288 SEMNGVWCQGRPLRVAYATPR 308

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%)

Query: 313 VTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANF 372
           V+T +IG +     E  +  L + FG I++ K  P K C F+K++    A   I  L  F
Sbjct: 379 VSTVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGKNCGFVKFENRIDAEAAIQGLQGF 438

Query: 373 PFQGRNLRTGWGK 385
              G  +R  WGK
Sbjct: 439 IVAGNPIRLSWGK 451

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 5/102 (4%)

Query: 50  PVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVE 109
           P L+    +      +++G L   INE  ++  F+  G I NVK+   KN       FV+
Sbjct: 367 PQLSKSNSQNELVSTVFIGGLSPKINESQVRSLFKPFGNIVNVKLPPGKN-----CGFVK 421

Query: 110 YHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFN 151
           +    DA  A Q L G  + GN I+++W   S   S + + N
Sbjct: 422 FENRIDAEAAIQGLQGFIVAGNPIRLSWGKASSMTSGNASNN 463

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +F+G L+  +++  +   FK F + +   +         +  GFV F  +  A+ A++  
Sbjct: 382 VFIGGLSPKINESQVRSLFKPFGNIVNVKL------PPGKNCGFVKFENRIDAEAAIQGL 435

Query: 212 QGFILNGRAIRINWA 226
           QGFI+ G  IR++W 
Sbjct: 436 QGFIVAGNPIRLSWG 450

>ADL160W Chr4 (408685..410265) [1581 bp, 526 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL123W (HRP1)
          Length = 526

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 28/183 (15%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT- 122
           +++G L+    ED L++YF   G +  VK++ D     +  + F+ +      +   +T 
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 123 --LDGKQIE-------GNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEF 173
             LDGK I+       G   K                 +FV  +  DV  +     F ++
Sbjct: 225 HILDGKVIDPKESDPTGRARKAG--------------KIFVAGIGPDVRPKEFEEFFSQW 270

Query: 174 PSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI-LNGRAIRINWASKREPQ 232
            S I A +M D  +GRSRG+GF+++   D   +  ++K  FI   G+ I I  A  R+ Q
Sbjct: 271 GSIIDAQLMLDKDTGRSRGFGFITYDSPDAVDRVCQNK--FIEFKGKRIEIKRAEPRQVQ 328

Query: 233 QHQ 235
           + +
Sbjct: 329 KQR 331

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 45/76 (59%), Gaps = 2/76 (2%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           S D   +F+G LN +  ++ L   F ++ +  +  +M D  +GRSRG+GF+SF++     
Sbjct: 159 SRDINKMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVD 218

Query: 206 QAMESKQGFILNGRAI 221
           + ++++   IL+G+ I
Sbjct: 219 EVVKTQH--ILDGKVI 232

>ZYRO0G07326g Chr7 complement(577044..578450) [1407 bp, 468 aa] {ON}
           some similarities with uniprot|P27476 Saccharomyces
           cerevisiae YGR159C NSR1 Nucleolar protein that binds
           nuclear localization sequences required for pre-rRNA
           processing and ribosome biogenesis
          Length = 468

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 89/178 (50%), Gaps = 14/178 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
            ++VG L   I++  LK  F+  G + + +V+ ++ +  +  Y +V++     A  A + 
Sbjct: 237 TIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFTDKSYAEKAVKE 296

Query: 123 LDGKQIEGNVIKINWAFQSQHVS-------------SDDTFNLFVGDLNVDVDDETLTGT 169
           + GK+++G  I  + +     V+             S+ +  LF+G+L+ + D + +   
Sbjct: 297 MHGKELDGRPINCDMSTSKPTVNPREDRAKRFGDMPSEPSDTLFLGNLSFNADRDQIYEL 356

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
           F      I   +     + + +G+G+V ++  D AQ+A+E+ QG  ++ R +R+++++
Sbjct: 357 FSPHGEVISVRIPTHPETEQPKGFGYVQYASVDSAQKALETLQGEYIDNRPVRLDFST 414

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 48/78 (61%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +FVG L+ ++DD+ L   F+       A V+++  S RSRGYG+V F+++  A++A++  
Sbjct: 238 IFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRSRGYGYVDFTDKSYAEKAVKEM 297

Query: 212 QGFILNGRAIRINWASKR 229
            G  L+GR I  + ++ +
Sbjct: 298 HGKELDGRPINCDMSTSK 315

>AEL016C Chr5 complement(605004..607040) [2037 bp, 678 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR023W
           (PES4) and YHR015W (MIP6)
          Length = 678

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 55/93 (59%)

Query: 131 NVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRS 190
           +++K+  +  S  ++S     LF+GDL+  V ++ L  TF +F SF+ A +  D  + +S
Sbjct: 97  DIVKLGRSKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKS 156

Query: 191 RGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
            GYG+++FS ++ A++ +E      + GR +RI
Sbjct: 157 LGYGYLNFSNEEDAERVIEEFNYIPIFGREVRI 189

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 66/153 (43%), Gaps = 10/153 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           L++G+LD+ + E  L+  F       + K+ +D N +++  Y ++ +    DA    +  
Sbjct: 118 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 177

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDL---NVDVDDETLTGTFKEFPSFIQAH 180
           +   I G  ++I  + ++     +   N+F  +L   N+ +        FK+F   +   
Sbjct: 178 NYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRVFYDAFKKFGKILSCK 237

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQG 213
           +       R +  GFV F +   A+QA+    G
Sbjct: 238 L------DRRKNIGFVYFEKDSAAKQAIAEYNG 264

>NCAS0B07240 Chr2 (1369481..1371313) [1833 bp, 610 aa] {ON}
           Anc_1.357
          Length = 610

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 45/72 (62%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+GDLN DV  ETL   F  +PSF+ A V +D  +  S G+G+++F +++ A++A++  
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 212 QGFILNGRAIRI 223
               L  + IRI
Sbjct: 163 NCMKLGDKVIRI 174

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 74/161 (45%), Gaps = 9/161 (5%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQTL 123
           L++G+L++ + ++TL+  F V     + KV  D + N    + ++ +    DA  A    
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +  ++   VI+I  + + ++       N+F    N+  +D  L  + K F  F Q     
Sbjct: 163 NCMKLGDKVIRIMPSLRGKNTKKSIGTNVFFT--NLPDEDNRLFHSRKFFEIFRQ---FG 217

Query: 184 DMLSGR---SRGYGFVSFSEQDVAQQAMESKQGFILNGRAI 221
            +LS R   ++  GF+SF  ++VA+  ++     +  G  I
Sbjct: 218 KILSCRLDPNKNIGFISFEHEEVAKTVVKKYNNSMFFGNRI 258

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 57  GRETSDRILYVGNLDKAINEDTLKQYFQVG----GPIANVKVLVDKNNEEANYAFVEYHQ 112
            R+ + RILY+  L +  ++D + Q+          I+  KV ++K+   A    ++   
Sbjct: 396 SRKPTKRILYLKELSRICDKDFVSQFCHQRRIKFDEISLTKVNLEKSTHTAR---IKCRT 452

Query: 113 PHDANVAFQTLDGKQIEGNVIKINW 137
             DA   + +++ + I G++IK +W
Sbjct: 453 DEDARKLYNSINNRLIAGSIIKASW 477

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           ++V NL  +I  + ++ +F   G I N+  + DK +  A +AFV+Y     A  A + L+
Sbjct: 313 VFVSNLPTSITVEEIRNHFNKIGNIMNL-FISDKISSNALWAFVKYSTAACAIRAIKELN 371

Query: 125 GKQIEGNVIKINWAFQ 140
              I    I ++ AF+
Sbjct: 372 NTFIRKKQIVVSQAFR 387

>Ecym_2746 Chr2 (1447502..1449547) [2046 bp, 681 aa] {ON} similar to
           Ashbya gossypii AEL016C
          Length = 681

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 55/93 (59%)

Query: 131 NVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRS 190
           +++K+  +  S  ++S     LF+GDL+  V ++ L  TF +F SF+ A +  D  + +S
Sbjct: 101 DIVKLGRSKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKS 160

Query: 191 RGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
            GYG+++FS ++ A++ +E      + GR +RI
Sbjct: 161 LGYGYLNFSNEEDAERVIEEFNYIPIFGREVRI 193

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 66/153 (43%), Gaps = 10/153 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           L++G+LD+ + E  L+  F       + K+ +D N +++  Y ++ +    DA    +  
Sbjct: 122 LFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIEEF 181

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDL---NVDVDDETLTGTFKEFPSFIQAH 180
           +   I G  ++I  + ++     +   N+F  +L   N+ +        FK++   +   
Sbjct: 182 NYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRVFYDAFKKYGKILSCK 241

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQG 213
           +       R +  GFV F +   A+QA+    G
Sbjct: 242 L------DRRKNIGFVYFEKDSSAKQAIAEYNG 268

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN--YAFVEYHQPHDANVAFQT 122
           +++ NL    + D L  YF   GP   VK +   N  + N  +AF+ + +  DA  A  +
Sbjct: 331 VFIKNLPLNSDSDLLLDYFSQIGP---VKSIFTSNVSKLNSAWAFITFKKGSDAQDAIDS 387

Query: 123 LDGKQIEGNVIKINWA---FQS 141
           L+  Q+ G  I+++ A   FQS
Sbjct: 388 LNHSQLLGRTIELSRAQKNFQS 409

>ZYRO0C05060g Chr3 complement(397083..399233) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q75EC3 Ashbya gossypii AAR151W
           AAR151Wp and weakly similar to YBR212W uniprot|P32831
           Saccharomyces cerevisiae YBR212W NGR1 negative growth
           regulatory protein
          Length = 716

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 67/147 (45%), Gaps = 22/147 (14%)

Query: 103 ANYAFVEYHQPHDANVAFQTLDGKQIEGNV---------------IKINWA----FQSQH 143
           A Y FVE+    DA     +L+   +   +                ++NWA     QS  
Sbjct: 158 AGYCFVEFETQQDAQFGL-SLNSTPLPNFISQSSGLATNPTGQRNFRLNWASGATLQS-S 215

Query: 144 VSSDDTFNLFVGDLNVDVDDETLTGTFKE-FPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           + S   F+LFVGDL+    +  L   F++ F S     VM D ++G SR +GFV F  ++
Sbjct: 216 IPSRPEFSLFVGDLSPTATEADLLSLFQQKFKSVKTVRVMTDPITGASRCFGFVRFGNEE 275

Query: 203 VAQQAMESKQGFILNGRAIRINWASKR 229
             ++A+    G    GR +R+ +A+ R
Sbjct: 276 ERRRALVEMNGVWCQGRCLRVAYATPR 302

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           +  +++G L   INE+ L+  F   G I  VK+   KN       FV++ +  DA  A Q
Sbjct: 420 NTTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQGKN-----CGFVKFEKRIDAEAAIQ 474

Query: 122 TLDGKQIEGNVIKINWA 138
            + G  + G  I+++W 
Sbjct: 475 GMQGFVVGGCPIRLSWG 491

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 143 HVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           + +  +   +F+G L   +++  L   F  F + +   +       + +  GFV F ++ 
Sbjct: 414 YTTDPNNTTVFIGGLTPKINENQLQTLFSPFGNILTVKI------PQGKNCGFVKFEKRI 467

Query: 203 VAQQAMESKQGFILNGRAIRINWA 226
            A+ A++  QGF++ G  IR++W 
Sbjct: 468 DAEAAIQGMQGFVVGGCPIRLSWG 491

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 31/72 (43%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E  L  L   FG I+  K    K C F+K++    A   I  +  F 
Sbjct: 421 TTVFIGGLTPKINENQLQTLFSPFGNILTVKIPQGKNCGFVKFEKRIDAEAAIQGMQGFV 480

Query: 374 FQGRNLRTGWGK 385
             G  +R  WG+
Sbjct: 481 VGGCPIRLSWGR 492

>CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} similar
           to uniprot|P32831 Saccharomyces cerevisiae YBR212w
           Negative growth regulatory protein
          Length = 802

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 66/146 (45%), Gaps = 18/146 (12%)

Query: 103 ANYAFVEYHQPHDANVAF-----------QTLDGKQIEGN---VIKINWAFQSQHVSSDD 148
           A Y FVE+    DA                T  G+ I        ++NWA  +   SS  
Sbjct: 170 AGYCFVEFESQKDAQEGLALNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIP 229

Query: 149 T---FNLFVGDLNVDVDDETLTGTFK-EFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVA 204
           T   ++LFVGDL+    +  L   F+ +F S     VM D ++G SR +GFV F  ++  
Sbjct: 230 TTPEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEER 289

Query: 205 QQAMESKQGFILNGRAIRINWASKRE 230
           ++A+    G    GR +R+ +A+ R 
Sbjct: 290 RRALIEMNGVHFQGRTLRVAYATPRS 315

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT ++G +    QE  L  + Q FG I+  K  P K C F+K++    A   I  L  F 
Sbjct: 467 TTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKNCGFVKFEHKIDAEAAIQGLQGFV 526

Query: 374 FQGRNLRTGWGKEKPA 389
                +R  WG+   A
Sbjct: 527 LVENPIRLSWGRNHVA 542

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  ++VG L   + E  L++ FQ  G I ++K+   K     N  FV++    DA  A 
Sbjct: 465 TNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGK-----NCGFVKFEHKIDAEAAI 519

Query: 121 QTLDGKQIEGNVIKINWA 138
           Q L G  +  N I+++W 
Sbjct: 520 QGLQGFVLVENPIRLSWG 537

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +FVG L   V ++ L   F+ F + +   +         +  GFV F  +  A+ A++  
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKI------PPGKNCGFVKFEHKIDAEAAIQGL 522

Query: 212 QGFILNGRAIRINWA 226
           QGF+L    IR++W 
Sbjct: 523 QGFVLVENPIRLSWG 537

>Ecym_7420 Chr7 complement(859857..860471) [615 bp, 204 aa] {ON}
           similar to Ashbya gossypii ABL059W
          Length = 204

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 83/168 (49%), Gaps = 5/168 (2%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           +YVGNLD  + ++ L + F   GP+  ++   DK  +E   +AFVE++   D   A ++L
Sbjct: 9   IYVGNLDGQVTKEHLYELFVQMGPVYRIRYRKDKITQEYQGFAFVEFYTNSDCEFAIKSL 68

Query: 124 DGK-QIEGNVIKINWAFQSQHVSS--DDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
           +    + G ++K+    ++ H          LFV +L+  VD + L   F +F   ++  
Sbjct: 69  NNSVSLFGKILKVRRTLENTHYGGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQP 128

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            ++ + +G  +   ++ +S    + +A++     IL  R I I++A K
Sbjct: 129 EIFTLKNGTLKC-AYIYYSTFKHSDEALQKLNKQILANRVISIDYAFK 175

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 41/85 (48%)

Query: 56  GGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHD 115
           GG   S   L+V NLD +++   L++ F   GP+     +    N     A++ Y     
Sbjct: 91  GGPLISGAKLFVKNLDDSVDFQQLQKLFGKFGPLVKQPEIFTLKNGTLKCAYIYYSTFKH 150

Query: 116 ANVAFQTLDGKQIEGNVIKINWAFQ 140
           ++ A Q L+ + +   VI I++AF+
Sbjct: 151 SDEALQKLNKQILANRVISIDYAFK 175

>Kpol_1026.21 s1026 complement(46606..47919) [1314 bp, 437 aa] {ON}
           complement(46606..47919) [1314 nt, 438 aa]
          Length = 437

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (59%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           +T  +FVG L+  VDDE L   F+     I A V+++  + RSRGYG+V FS +  A++A
Sbjct: 176 ETATIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAAERA 235

Query: 208 MESKQGFILNGRAIRINWASKR 229
           ++   G  ++GR I  + ++ +
Sbjct: 236 VKEMHGKQIDGREINCDMSTSK 257

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 88/178 (49%), Gaps = 14/178 (7%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQT 122
            ++VG L  +++++ LK  F+  G +   +V+ ++  + +  Y +V++     A  A + 
Sbjct: 179 TIFVGRLSWSVDDEWLKNEFEHIGDVIGARVIYERGTDRSRGYGYVDFSSKSAAERAVKE 238

Query: 123 LDGKQIEGNVIKINW-------------AFQSQHVSSDDTFNLFVGDLNVDVDDETLTGT 169
           + GKQI+G  I  +              A +   V S  +  LF+G+L+ + D + +   
Sbjct: 239 MHGKQIDGREINCDMSTSKPAGGNGGDRAKKFGDVPSQPSDTLFLGNLSFNADRDQIYEL 298

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
           F +    I   +     + + +G+G+V +   + AQ A+++ QG  ++ R +R+++++
Sbjct: 299 FSKHGEIISVRLPTHPETEQPKGFGYVQYGNVNDAQSALDALQGEYIDNRPVRLDFST 356

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 90/227 (39%), Gaps = 55/227 (24%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNN---------------------- 100
           R L++G+LD   +E  +   +Q  G    VK++  K N                      
Sbjct: 20  RTLWMGDLDPGFDELIIASIWQSLGKSVKVKLIKSKTNALVPINSTSIPNNASSNALEIN 79

Query: 101 ------------EEANYAFVEYHQPHDA------------NVAFQTLDGKQIEGN---VI 133
                         A Y FVE+    DA            N++  T   K+   +     
Sbjct: 80  GVSFIDPNKTNLHHAGYCFVEFESFEDAQQALTLNATPIPNISCNTTASKRTNDDGKRKF 139

Query: 134 KINWAFQSQHVSS---DDTFNLFVGDLNVDVDDETLTGTFK-EFPSFIQAHVMWDMLSGR 189
           ++NWA  +   S+      F+LFVGDL+    +  L   F+ ++ S     VM D ++G 
Sbjct: 140 RLNWANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGA 199

Query: 190 SRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKRE--PQQH 234
           SR +GFV F+ +   + A+    G    GR +R+ +A+ R    QQH
Sbjct: 200 SRCFGFVRFANETERRNALIEMNGVQFQGRQLRVAYATPRNNVAQQH 246

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 34/72 (47%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT ++G +     E  L  L + FG I D K  P K C F+KY+   +A   I  L  F 
Sbjct: 445 TTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAAINGLQGFI 504

Query: 374 FQGRNLRTGWGK 385
             G  +R  WG+
Sbjct: 505 IMGSPIRLSWGR 516

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +FVG LN ++++  L   FK F +        D+     +  GFV ++E+  A+ A+   
Sbjct: 447 VFVGGLNPNINELQLFELFKPFGTIT------DVKIPPGKQCGFVKYNERLEAEAAINGL 500

Query: 212 QGFILNGRAIRINWA 226
           QGFI+ G  IR++W 
Sbjct: 501 QGFIIMGSPIRLSWG 515

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           S   ++VG L+  INE  L + F+  G I +VK+   K        FV+Y++  +A  A 
Sbjct: 443 SSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQ-----CGFVKYNERLEAEAAI 497

Query: 121 QTLDGKQIEGNVIKINWA 138
             L G  I G+ I+++W 
Sbjct: 498 NGLQGFIIMGSPIRLSWG 515

>TBLA0D04940 Chr4 (1214344..1216341) [1998 bp, 665 aa] {ON}
           Anc_1.357 YHR015W
          Length = 665

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%)

Query: 140 QSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFS 199
           ++  ++  ++F LF+G LN  V  E L   FK+FPSFI A V  DM + +S GYG+++FS
Sbjct: 84  RNNSLNDKNSFALFIGGLNQRVTKEMLKEEFKDFPSFISAKVCVDMKTKKSLGYGYLNFS 143

Query: 200 EQDVAQQAME 209
            Q+   + +E
Sbjct: 144 NQNDILRLVE 153

>KLTH0H06842g Chr8 complement(600623..602266) [1644 bp, 547 aa] {ON}
           some similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 547

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 54/101 (53%), Gaps = 4/101 (3%)

Query: 133 IKINWAFQSQHVS---SDDTFNLFVGDLNVDVDDETLTGTF-KEFPSFIQAHVMWDMLSG 188
            ++NWA  +  +S   S   F+LFVGDL+    +  L   F K+F S     VM D ++G
Sbjct: 155 FRLNWASGATLLSAIPSTPEFSLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITG 214

Query: 189 RSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
            SR +GFV F ++   ++A+    G    GR +R+ +A+ R
Sbjct: 215 ASRCFGFVRFGDEQERRRALVEMNGVWCQGRNLRVAYATPR 255

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 33/72 (45%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E  L  L   FG II+ K  P KGC F+KY     A   I  +  F 
Sbjct: 406 TTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKGCGFVKYAYRIDAEAAIQGMQGFI 465

Query: 374 FQGRNLRTGWGK 385
             G  +R  WG+
Sbjct: 466 VGGNPIRLSWGR 477

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
            +F+G L     +  L   F  F + I   +         +G GFV ++ +  A+ A++ 
Sbjct: 407 TVFIGGLTSHTSERQLHSLFAPFGTIINVKI------PPGKGCGFVKYAYRIDAEAAIQG 460

Query: 211 KQGFILNGRAIRINW 225
            QGFI+ G  IR++W
Sbjct: 461 MQGFIVGGNPIRLSW 475

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 5/84 (5%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           +  +++G L    +E  L   F   G I NVK+   K        FV+Y    DA  A Q
Sbjct: 405 NTTVFIGGLTSHTSERQLHSLFAPFGTIINVKIPPGKG-----CGFVKYAYRIDAEAAIQ 459

Query: 122 TLDGKQIEGNVIKINWAFQSQHVS 145
            + G  + GN I+++W   S   S
Sbjct: 460 GMQGFIVGGNPIRLSWGRTSTDTS 483

>YFR023W Chr6 (199874..201709) [1836 bp, 611 aa] {ON}  PES4Poly(A)
           binding protein, suppressor of DNA polymerase epsilon
           mutation, similar to Mip6p
          Length = 611

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 51/72 (70%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+GDL+  V +ETL G FK++PSF+ A V  D ++ +S G+G+++F +++ A++AME  
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 212 QGFILNGRAIRI 223
               +NG+ IRI
Sbjct: 153 NYTKVNGKEIRI 164

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/158 (19%), Positives = 72/158 (45%), Gaps = 4/158 (2%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           L++G+L + + E+TLK  F+      + KV +D   +++  + ++ +    +A  A + L
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +  ++ G  I+I  + ++     +   N+F  +L ++    T    +  F  +    ++ 
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRY--GKILS 210

Query: 184 DMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAI 221
             L  R +  GFV F ++  A+  ++        G+ I
Sbjct: 211 CKLDSR-KDIGFVYFEDEKTARNVIKMYNNTSFFGKKI 247

>Kwal_0.370 s0 (177067..178749) [1683 bp, 560 aa] {ON} YFR023W
           (PES4) - poly(A) binding protein; related to PES4
           protein homolog YHR015w [contig 89] FULL
          Length = 560

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 49/88 (55%), Gaps = 5/88 (5%)

Query: 136 NWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGF 195
           N    SQ VSS     LF+GDL+ +V ++ L  TF+ FPS I   +  D  +G S GYG+
Sbjct: 6   NPCVTSQKVSS-----LFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGY 60

Query: 196 VSFSEQDVAQQAMESKQGFILNGRAIRI 223
           ++F     A+ A+E+     L GR +RI
Sbjct: 61  LNFYSSKDAETAIETFSYVNLFGREVRI 88

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 67/150 (44%), Gaps = 10/150 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNE-EANYAFVEYHQPHDANVAFQTL 123
           L++G+LD  + E  L   F+V   + +VK+ VD        Y ++ ++   DA  A +T 
Sbjct: 17  LFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIETF 76

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVD---VDDETLTGTFKEFPSFIQAH 180
               + G  ++I  + ++ +   +   N+F  +L ++   +       TF+E+   +   
Sbjct: 77  SYVNLFGREVRIMPSMRNSYFRKNIGTNVFFSNLPLEQPALTTRVFYETFREYGKVLSCK 136

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           +       R +  GFV F     A++A+ S
Sbjct: 137 L------DRRKNIGFVYFESDAAARKAIAS 160

>NDAI0B04570 Chr2 (1137147..1138541) [1395 bp, 464 aa] {ON}
           Anc_1.357
          Length = 464

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 53/95 (55%), Gaps = 8/95 (8%)

Query: 129 EGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSG 188
           EG  IKI        + S +TF+LF+GDL+  V  E L   F ++PSF+ A V +D  + 
Sbjct: 38  EGKKIKI--------LESGETFSLFIGDLHPKVTQEILENIFGKYPSFLSAKVCYDFKTK 89

Query: 189 RSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
            S G+G+++FS +  ++QA++      L    IR+
Sbjct: 90  VSLGHGYLNFSSERDSKQAIDDFNCTRLFDSVIRL 124

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 81/174 (46%), Gaps = 8/174 (4%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQTL 123
           L++G+L   + ++ L+  F       + KV  D K      + ++ +    D+  A    
Sbjct: 53  LFIGDLHPKVTQEILENIFGKYPSFLSAKVCYDFKTKVSLGHGYLNFSSERDSKQAIDDF 112

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +  ++  +VI++  +F+ +++   + +NLF  +L  +VDD   + T + F    +     
Sbjct: 113 NCTRLFDSVIRLMPSFRGKNIKKSN-YNLFFSNL-PEVDDTGQSFTPRRFYELFRE--CG 168

Query: 184 DMLSGR---SRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQH 234
           +++S +   ++  GF+SF  ++VA++ + +     L G+ I     S    + H
Sbjct: 169 EIISCKFEENKNIGFISFQSENVAREVIINYNNKFLFGKQITCKLLSAENDESH 222

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/315 (19%), Positives = 111/315 (35%), Gaps = 52/315 (16%)

Query: 96  VDKNNEEANYAFVEYHQPHDANVAFQTLDGKQI---------------EGNVIKINWAFQ 140
           +   +++ANY  VE+    +A  A  TL+G  +               + +V ++NWA  
Sbjct: 92  IKSEHKQANYCLVEFESQQEAAEAL-TLNGLPLPNFFSRSRNSVINASQLSVFRLNWAVW 150

Query: 141 SQHVSSDDTFNLFVGDLNVDVDDETLTGTFK-EFPSFIQAHVMWDMLSGRSRGYGFVSFS 199
                    + LFVG+L+    +  L   F+  + S     +M + + G+S  +GF+ F+
Sbjct: 151 PTVNGLSPEYPLFVGNLSSITREADLLLLFRSRYKSVKTVRMMTEPIPGKSDSFGFICFA 210

Query: 200 EQDVAQQAMESKQGFILNGRAIRINWASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGI 259
             +  + A E   G     + I++  A+ R+                            I
Sbjct: 211 NCEERRLAAEEMNGICFQDKYIKVAIANPRDNM--------------------------I 244

Query: 260 PQGHPMGSPNNAGPMGMAPQGMAXXXXXXXXXXXXXXXXXXAVEAMIRR---------AP 310
           P    +    N  P+      +                    V   +R          + 
Sbjct: 245 PSSTDVPPVKNIPPLIKTANDLLTNNLNAVQEQTAQLALSTVVTGNLRSNGNIRQGLGSN 304

Query: 311 QRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 370
            + +T ++G +     E +L  L + FG I+D K    K C F+ +     A   I  L 
Sbjct: 305 SKNSTIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGKKCGFVTFKRRIDAKAAIKGLH 364

Query: 371 NFPFQGRNLRTGWGK 385
            F  +G  +R  WGK
Sbjct: 365 GFLVRGCPIRLSWGK 379

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 62/138 (44%), Gaps = 12/138 (8%)

Query: 88  PIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSD 147
           P+ N+  L+   N+      +   Q   A +A  T+    + GN ++ N   +    S+ 
Sbjct: 252 PVKNIPPLIKTANDLLTNN-LNAVQEQTAQLALSTV----VTGN-LRSNGNIRQGLGSNS 305

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
               +FVG L+ DV ++ L   F+ F   +   +         +  GFV+F  +  A+ A
Sbjct: 306 KNSTIFVGGLSTDVSEQELNELFRPFGEIMDVKI------PLGKKCGFVTFKRRIDAKAA 359

Query: 208 MESKQGFILNGRAIRINW 225
           ++   GF++ G  IR++W
Sbjct: 360 IKGLHGFLVRGCPIRLSW 377

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 5/81 (6%)

Query: 57  GRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDA 116
           G  + +  ++VG L   ++E  L + F+  G I +VK+ + K        FV + +  DA
Sbjct: 302 GSNSKNSTIFVGGLSTDVSEQELNELFRPFGEIMDVKIPLGK-----KCGFVTFKRRIDA 356

Query: 117 NVAFQTLDGKQIEGNVIKINW 137
             A + L G  + G  I+++W
Sbjct: 357 KAAIKGLHGFLVRGCPIRLSW 377

>TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.104
           YBR212W
          Length = 608

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 70/147 (47%), Gaps = 22/147 (14%)

Query: 103 ANYAFVEYHQPHDANVAFQTLDGKQIEG---------------NVIKINWA----FQSQH 143
           A Y FVE+    D  +A  +L+   I                    ++NWA     QS  
Sbjct: 119 AGYCFVEFESQQDV-IAALSLNKAVIPNIFSESINLYTNPNGRRTFRLNWASGATLQSL- 176

Query: 144 VSSDDTFNLFVGDLNVDVDDETLTGTF-KEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           + +   ++LF+GDL+    +  +   F K++ S     VM D ++G SRG+GF+ FS++D
Sbjct: 177 IPATPEYSLFIGDLSPLTTEADILSIFQKKYKSVKTVRVMTDPINGSSRGFGFIRFSDED 236

Query: 203 VAQQAMESKQGFILNGRAIRINWASKR 229
             + A+E+  G + + R  R+  A+ R
Sbjct: 237 ERKDALENMNGVMCHSRYFRLALATPR 263

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 48/88 (54%), Gaps = 5/88 (5%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANV 118
           + S+  +++G L  + NE  L+  F+  G I +VK+ + KN       FV++ +  +AN 
Sbjct: 338 DNSNTTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGKN-----CGFVKFKRKIEANA 392

Query: 119 AFQTLDGKQIEGNVIKINWAFQSQHVSS 146
           A + + G  I GN I+++W   + + S+
Sbjct: 393 AIKGMQGFIINGNPIRLSWGKSNNNAST 420

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 33/72 (45%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E +L  L + FG I+  K    K C F+K+    +A   I  +  F 
Sbjct: 342 TTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPIGKNCGFVKFKRKIEANAAIKGMQGFI 401

Query: 374 FQGRNLRTGWGK 385
             G  +R  WGK
Sbjct: 402 INGNPIRLSWGK 413

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 7/85 (8%)

Query: 143 HVSSDDT-FNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQ 201
           HV+ D++   +F+G L+   ++  L   F+ F + +   +         +  GFV F  +
Sbjct: 334 HVNLDNSNTTVFIGGLSTSTNEYELQVLFEPFGNILSVKIPI------GKNCGFVKFKRK 387

Query: 202 DVAQQAMESKQGFILNGRAIRINWA 226
             A  A++  QGFI+NG  IR++W 
Sbjct: 388 IEANAAIKGMQGFIINGNPIRLSWG 412

>TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON}
           Anc_8.797 YOR319W
          Length = 210

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 84/174 (48%), Gaps = 13/174 (7%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNE-EANYAFVEYHQPHDANVAFQTL 123
           +YVGN+D  + ++ L + F    PIAN++   DK  +    +AFVE++ P D     Q L
Sbjct: 12  VYVGNIDPKVTKENLYELFVQVSPIANIRYPKDKVLQLHQGFAFVEFYTPEDCQYVVQLL 71

Query: 124 DGK-QIEGNVIKINWAFQSQHVSSDDTFN--------LFVGDLNVDVDDETLTGTFKEFP 174
           +   Q+    +K+  A  +   S  DT +        +FV +L+  +D+  L+  F +F 
Sbjct: 72  NNTVQLYDRFLKVRKA--NVQSSGSDTIDVTIQPIAKVFVKNLDPSIDEPHLSRLFGKFG 129

Query: 175 SFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
              +   ++ +  G+ R   ++ F   D +  A+ +  G ++  + + +++A K
Sbjct: 130 PLAKGPEIFYLSDGQLRC-AYIYFKNYDHSDLALATLNGQLVVNKKVTVDYAFK 182

>Kpol_1008.23 s1008 (47628..49610) [1983 bp, 660 aa] {ON}
           (47628..49610) [1983 nt, 661 aa]
          Length = 660

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 45/72 (62%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+G+L++DV++E L   FK+FPS +   +  +  +  S GYG+++F +++ A++A E  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 212 QGFILNGRAIRI 223
               L G  ++I
Sbjct: 140 NYINLFGNEVKI 151

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 70/149 (46%), Gaps = 10/149 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           L++GNL   +NE+ LKQ F+    + +VK+  +   +E+  Y ++ +    DA  A +  
Sbjct: 80  LFIGNLSLDVNEEKLKQVFKKFPSLVSVKICTNSTTKESLGYGYLNFGDKEDAEKATEEF 139

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDET---LTGTFKEFPSFIQAH 180
           +   + GN +KI  + ++     +   NLF  +L +D  + T      TFK++   +   
Sbjct: 140 NYINLFGNEVKIMPSLRNSFYRKNIGTNLFFCNLPLDNKELTTRRFYDTFKKYGKILSCK 199

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAME 209
           +       + +  GFV F     A++ ++
Sbjct: 200 L------DKRKNIGFVYFDNDKSAKEVIK 222

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 3/90 (3%)

Query: 57  GRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANV-KVLVDKNNEEANYAFVEYHQPHD 115
            ++T    ++V NL     ++ +  YF V GPI +V    V K N  + ++ + Y +  D
Sbjct: 326 NKKTYPNSVFVKNLPINTTDEEILDYFSVAGPIKSVFSSKVPKFN--SLWSIITYKKSSD 383

Query: 116 ANVAFQTLDGKQIEGNVIKINWAFQSQHVS 145
           +  A QT D K  +  VI +  A    H S
Sbjct: 384 SIKAIQTYDNKTFKEKVISVTKAHSKLHES 413

>Smik_7.334 Chr7 (561338..563173) [1836 bp, 611 aa] {ON} YFR023W
           (REAL)
          Length = 611

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 50/72 (69%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+GDL+  V +ETL   FK++PSF+ + V  D ++ +S G+G+++F +++ A++AME  
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 212 QGFILNGRAIRI 223
               +NG+ IRI
Sbjct: 153 NYTKVNGKEIRI 164

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 30/149 (20%), Positives = 71/149 (47%), Gaps = 10/149 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           L++G+LD+ + E+TLK+ F+      + KV +D   +++  + ++ +    +A  A + L
Sbjct: 93  LFIGDLDETVTEETLKEIFKKYPSFVSSKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVD---VDDETLTGTFKEFPSFIQAH 180
           +  ++ G  I+I  + ++     +   N+F  +L ++   +       TF  +       
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRY-----GK 207

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAME 209
           ++   L  R +  GFV F ++  A+  ++
Sbjct: 208 ILSCKLDSR-KDIGFVYFEDEKTARSVIK 235

>Kpol_1075.1a s1075 (1..795) [795 bp, 264 aa] {ON} (1..795) [795 nt,
           265 aa]
          Length = 264

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           NLFV +L+  VDDE L   F  F + I A VM     G+S+ +GFV FS  + A +A+  
Sbjct: 22  NLFVKNLDDSVDDEKLQEEFSPFGTIISAKVMRTE-DGKSKNFGFVCFSTPEEATRAITE 80

Query: 211 KQGFILNGRAIRINWASKREPQQHQ 235
           K   I+ G+ + +  A ++E ++ Q
Sbjct: 81  KNQQIVAGKPLYVAIAQRKEVRRAQ 105

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 40/74 (54%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           L+V NLD +++++ L++ F   G I + KV+  ++ +  N+ FV +  P +A  A    +
Sbjct: 23  LFVKNLDDSVDDEKLQEEFSPFGTIISAKVMRTEDGKSKNFGFVCFSTPEEATRAITEKN 82

Query: 125 GKQIEGNVIKINWA 138
            + + G  + +  A
Sbjct: 83  QQIVAGKPLYVAIA 96

>NDAI0E03070 Chr5 (651544..653649) [2106 bp, 701 aa] {ON} Anc_8.491
           YPL043W
          Length = 701

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  + +DV DE LT  F  F     A V+ D ++ +SRG+GFVSF+ +D  ++A
Sbjct: 24  DMKTLFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKD-VNKKSRGFGFVSFAVEDDTKEA 82

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           ++  +   L G  +R++ A +R+
Sbjct: 83  LKKARQTKLKGHLLRVDIAKRRD 105

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 39/203 (19%), Positives = 79/203 (38%), Gaps = 42/203 (20%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + L+V ++   + ++ L  YF    P  +  V+ D N +   + FV +    D   A + 
Sbjct: 26  KTLFVRSIPMDVTDEELTDYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKK 85

Query: 123 LDGKQIEGNVIKINWAFQSQHVSSDDTFNL-----------FVGDLNVD----VDDETLT 167
               +++G++++++ A +    S  D  N              GD N D    VD+E+L 
Sbjct: 86  ARQTKLKGHLLRVDIAKRRDRSSKSDDKNEGKVKTDTIAVGTRGDDNGDEPEEVDEESL- 144

Query: 168 GTFKEFPSFIQAHVMWDM------------------------LSGRSRGYGFVSFSEQDV 203
              K  P  I  ++ W                            G+  G+ FV+  +   
Sbjct: 145 --LKGKPKLIIRNMPWSCRDPEKLKKVFGRFGNVVEATIPRKRDGKLCGFAFVTMKKLSN 202

Query: 204 AQQAMESKQGFILNGRAIRINWA 226
              A+E+ +   ++GR + +++A
Sbjct: 203 CHLALENTKDLKIDGRPVAVDFA 225

>ZYRO0G00814g Chr7 complement(63018..64982) [1965 bp, 654 aa] {ON}
           similar to uniprot|P39684 Saccharomyces cerevisiae or to
           YHR015W uniprot|P38760 Saccharomyces cerevisiae
          Length = 654

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (53%)

Query: 144 VSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDV 203
           + S  T  LF+GDL+  +D+E L   FK+F S     V  D  +G+S GYG+++FS +  
Sbjct: 97  IESQPTIALFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYLNFSRRQD 156

Query: 204 AQQAMESKQGFILNGRAIRI 223
              A E      + G+ +RI
Sbjct: 157 TLAATEEFNYRPIFGKEVRI 176

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 69/153 (45%), Gaps = 10/153 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQTL 123
           L++G+LD+ I+E+ L Q F+    + +VKV  D +  +   Y ++ + +  D   A +  
Sbjct: 105 LFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYLNFSRRQDTLAATEEF 164

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDL---NVDVDDETLTGTFKEFPSFIQAH 180
           + + I G  ++I  + ++     +   N+F  +L   N ++       TFK + + +   
Sbjct: 165 NYRPIFGKEVRIMPSLRNTFYRKNIGTNIFFSNLPLENSNLTTRVFYDTFKVYGNILSCK 224

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQG 213
           +       + +  GF+ F     A+  ++   G
Sbjct: 225 L------DKRKNIGFIYFDNDHAARVVIKEFNG 251

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           ++V NL  +  +D +  YF   GP+ +V      +  E+++AFV Y +  D N A +   
Sbjct: 316 IFVKNLPPSCPDDEILDYFSNLGPVKSV-FSSTSHKYESSWAFVTYKKGSDTNKAVKIYH 374

Query: 125 GKQIEGNVIKI 135
           G Q +G  + +
Sbjct: 375 GAQFKGRKLSV 385

>KAFR0B04420 Chr2 complement(918168..920045) [1878 bp, 625 aa] {ON}
           Anc_5.76 YGR250C
          Length = 625

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 92/194 (47%), Gaps = 32/194 (16%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK----NNEEANYAFVEYHQPHDANVAF 120
           L++G +DKAI    L   F V GPI ++K++ D      N E NY FV Y     A    
Sbjct: 170 LFIGGIDKAITLSQLTTIFSVYGPIISIKLISDTNNNSKNNETNYGFVSYQFGSQAANCI 229

Query: 121 QTLDGKQIEGNVIKINWAF------QSQHVSSDDTFN------LFVGDL-NVDVDDETLT 167
             L+GK+I  + + IN+        + Q + +D+  N      +F+G+L  V V+ E +T
Sbjct: 230 NDLNGKKIHDSNLFINYHVDVKERERIQWLDADENNNAKNFKCVFIGNLPKVAVNGEPIT 289

Query: 168 G-----TFKE-----FPSF-IQAHVM-WDMLSGRS---RGYGFVSFSEQDVAQQAMESKQ 212
                 T K+     F +F I +H    D +  RS   +GYGFV  +  + A + + S  
Sbjct: 290 CGMILETIKDRLKEQFANFEILSHYFPEDTVDDRSELLKGYGFVKVATHEEAIEIINSFN 349

Query: 213 GFILNGRAIRINWA 226
           G+  +G  + +N A
Sbjct: 350 GYEFHGSKLIVNRA 363

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 46/104 (44%), Gaps = 19/104 (18%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW------------------DMLSGRSRG 192
           NL+V  + ++  D  L   +++F   I A V+                    ++ G+SRG
Sbjct: 440 NLYVKHIPLEWRDTELFDFYRKFGEIISAKVITVGGSRNNSHVDIGESESGTLVHGQSRG 499

Query: 193 YGFVSFSEQDVAQQAMESKQGF-ILNGRAIRINWASKREPQQHQ 235
           YGFV F     A +A+    GF I     +  ++A K+  ++++
Sbjct: 500 YGFVCFENPVDASRAILGTDGFEIDENNTLSASFAQKKNLKKNK 543

>Suva_16.271 Chr16 (472819..474879) [2061 bp, 686 aa] {ON} YPL043W
           (REAL)
          Length = 686

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +  DV DE L   F  F     A V+ D ++ RSRG+GFVSF+ +D  ++A
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKD-VNKRSRGFGFVSFAVEDDTKEA 82

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           +   +    NG ++R++ A +R+
Sbjct: 83  LAKARKTKFNGHSLRVDVAKRRD 105

>Kwal_26.7493 s26 (387735..388400) [666 bp, 222 aa] {OFF} YGR159C
           (NSR1) - nuclear localization sequence binding protein
           [contig 667] PARTIAL
          Length = 222

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 69/138 (50%), Gaps = 13/138 (9%)

Query: 105 YAFVEYHQPHDANVAFQTLDGKQIEGNVIKINW-------------AFQSQHVSSDDTFN 151
           Y +V++     A  A + + GK+I+G  I ++              A Q     S  +  
Sbjct: 11  YGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPAGNPRNDRAKQYGDTPSQPSDT 70

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+G+L+ + + + +   F E+   +   +     + + +G+G+V +S  + AQ+A+++ 
Sbjct: 71  LFLGNLSFNTERDNVFEIFSEYGDVVSVRLPTHPETNQPKGFGYVQYSSVENAQKALDAL 130

Query: 212 QGFILNGRAIRINWASKR 229
           QG  ++ R +R+++++ +
Sbjct: 131 QGHYIDNRPVRLDFSTPK 148

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 28/41 (68%)

Query: 189 RSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
           RSRGYG+V F ++  A++A++   G  ++GR I ++ ++ +
Sbjct: 7   RSRGYGYVDFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSK 47

>ABL059W Chr2 (287618..288232) [615 bp, 204 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR319W (HSH49)
          Length = 204

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 84/175 (48%), Gaps = 7/175 (4%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDAN 117
           + ++  +YVGNLD  ++++ L + F    P++ ++   DK   E   +AFVE     D +
Sbjct: 3   QNTECTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCD 62

Query: 118 VAFQTLDGK-QIEGNVIKINWAFQSQHVSSDDTF---NLFVGDLNVDVDDETLTGTFKEF 173
            A ++L+    + G V+K+    ++   +S   F    LFV +L+  +D   L   F +F
Sbjct: 63  FAIKSLNNTVSLFGKVLKVRRTLENAK-NSAPVFARAKLFVKNLDSTIDAVQLQKLFGKF 121

Query: 174 PSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
               +   ++ +  G  R   +V F+    + +A+E     I+  + I I++A K
Sbjct: 122 GPLAKPPQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISIDYAFK 175

>Kpol_1018.122 s1018 (325215..327119) [1905 bp, 634 aa] {ON}
           (325215..327119) [1905 nt, 635 aa]
          Length = 634

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 93/181 (51%), Gaps = 21/181 (11%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNN-EEANYAFVEYHQPHDANVAFQTL 123
           LY+G+L+K + ED LK +F +   + +VK+ VD ++ E   Y ++      +A+   +  
Sbjct: 101 LYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEEADDLMERF 160

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +   I G V++I  + ++     +   N+F  DL   + ++++T   ++F +F +A+   
Sbjct: 161 NYTPIFGKVVRIMPSLRNSQTRKNMGTNVFFSDL--PLSEKSITT--RDFYNFFKAY--G 214

Query: 184 DMLSGR---SRGYGFVSFSEQDVAQQ------AMESKQGFILNG-----RAIRINWASKR 229
           ++LS +   S+  GF+ F  +  A++      A E   G+ +N      ++IR N  +++
Sbjct: 215 NILSCKLNTSKNIGFIFFENESSAKEVISKFNANELLYGYKINCGVHIDKSIRKNLGTEK 274

Query: 230 E 230
           +
Sbjct: 275 Q 275

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 40/80 (50%)

Query: 144 VSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDV 203
           + S  +  L++GDL   V ++ L   F  + S +   +  D  SG S GYG+++ + ++ 
Sbjct: 93  IESKQSIALYIGDLEKFVTEDMLKNFFAMYKSLLSVKICVDSHSGESLGYGYLNLTTKEE 152

Query: 204 AQQAMESKQGFILNGRAIRI 223
           A   ME      + G+ +RI
Sbjct: 153 ADDLMERFNYTPIFGKVVRI 172

>ZYRO0G04862g Chr7 complement(387238..388368) [1131 bp, 376 aa] {ON}
           highly similar to gnl|GLV|CAGL0J11154g Candida glabrata
           CAGL0J11154g and similar to YNL175C uniprot|P53883
           Saccharomyces cerevisiae
          Length = 376

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 43/82 (52%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  D+ L   F+     I+  +     SG+ +G+ FV F E+  A  A++ K
Sbjct: 216 LFVGNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALKDK 275

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               + GR+IR+ +   R  +Q
Sbjct: 276 SCRKIAGRSIRMEYGEDRSKRQ 297

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL    ++D L+++FQ  G I  V++   +++ +   +AFV++ +   A  A +
Sbjct: 214 RILFVGNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALK 273

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  I++ +
Sbjct: 274 DKSCRKIAGRSIRMEY 289

>NCAS0C02380 Chr3 (444347..446455) [2109 bp, 702 aa] {ON} Anc_8.491
           YPL043W
          Length = 702

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 129 EGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSG 188
           +GN    N A++ Q+ +  D   LFV  + +DV DE L   F  F     A V+ D ++ 
Sbjct: 6   KGNGNHRNAAYK-QNDNGLDMKTLFVRSIPMDVTDEELADYFSNFAPTKHAVVVKD-VNK 63

Query: 189 RSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKRE 230
           +SRG+GFVSF+ +D  ++A++  +   L G  +R++ A +R+
Sbjct: 64  KSRGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRD 105

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/195 (16%), Positives = 79/195 (40%), Gaps = 32/195 (16%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + L+V ++   + ++ L  YF    P  +  V+ D N +   + FV +    D   A + 
Sbjct: 26  KTLFVRSIPMDVTDEELADYFSNFAPTKHAVVVKDVNKKSRGFGFVSFAVEDDTKEALKQ 85

Query: 123 LDGKQIEGNVIKINWAFQSQHVS---------SDDTFNLFVGDLNVDVDDET-------- 165
               +++G++++++ A +    +              +    D N +VD+E+        
Sbjct: 86  ARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTIARDENEEVDEESLLKGKPKL 145

Query: 166 --------------LTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
                         L   F  F + ++A +      G+  G+ FV+  +      A+E+ 
Sbjct: 146 IIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKR-DGKLCGFAFVTMKKLSNCTIALENT 204

Query: 212 QGFILNGRAIRINWA 226
           +   ++GR++ +++A
Sbjct: 205 KDLKIDGRSVAVDFA 219

>Smik_16.192 Chr16 (345251..347323) [2073 bp, 690 aa] {ON} YPL043W
           (REAL)
          Length = 690

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +  DV DE L   F  F     A V+ D  + RSRG+GFVSF+ +D  ++A
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRSRGFGFVSFAVEDDTKEA 82

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           +   +    NG  +R++ A +R+
Sbjct: 83  LAKARKTKFNGHTLRVDVAKRRD 105

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/199 (16%), Positives = 76/199 (38%), Gaps = 36/199 (18%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + L+V ++ + + ++ L  +F    PI +  V+ D N     + FV +    D   A   
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 123 LDGKQIEGNVIKINWAFQSQHVSSD---------DTF----------------------- 150
               +  G+ ++++ A +    S           ++F                       
Sbjct: 86  ARKTKFNGHTLRVDVAKRRDRTSKSPEGAEKSTPESFEKISGQKNENDNDADDEDSLLKG 145

Query: 151 --NLFVGDLNVDVDDET-LTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
              L + ++     D T L   F  + + ++A +      G+  G+ FV+  +    + A
Sbjct: 146 KPKLIIRNMPWSCRDPTKLKKIFTRYGTVVEATIPRKR-DGKLCGFAFVTMKKISNCRIA 204

Query: 208 MESKQGFILNGRAIRINWA 226
           +E+ +   ++GR + +++A
Sbjct: 205 LENTKDLKIDGRKVAVDFA 223

>KLLA0C14388g Chr3 complement(1251548..1252159) [612 bp, 203 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 203

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 84/177 (47%), Gaps = 12/177 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEE----ANYAFVEYHQPHDANVAF 120
           +YVGNLD  +N+  L + F   GPI+ +K   +K +E+    + YAF+++    D +   
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVN-DDVDYVC 63

Query: 121 QTLDGK-QIEGNVIKINWAFQSQHVSSDDT-FNLFVGDLNVDVDDETLTGTFKEFPSFIQ 178
           +  D +  + G  +K+  + +    +  D    LFV +L+  +D   L+  FK F   ++
Sbjct: 64  KLFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKLLR 123

Query: 179 AHVMWDMLSG--RSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQ 233
              ++ + +G  R     F +F   D A Q +       L  + I I++A K + Q+
Sbjct: 124 KPEVFYLQNGTLRCAYVWFTTFKHSDEALQQLNETN---LANKLIYIDYAYKDDMQK 177

>NDAI0G00180 Chr7 complement(23120..24514) [1395 bp, 464 aa] {ON}
           Anc_1.408 YCL011C
          Length = 464

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 96/235 (40%), Gaps = 46/235 (19%)

Query: 44  DQSQVTPVLAT--------KGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVL 95
           D+    PVLA         K  R  S+ I +VGNL      + L++YF   G +    ++
Sbjct: 84  DKGDYGPVLARELDSTYEEKVNRNYSNSI-FVGNLTYDCTPEDLREYFSGIGEVVRADII 142

Query: 96  VDKNNEEANYAFVEYHQPHDANVAFQTLDG-----KQI-----------------EGNVI 133
             K +       VE+    D   A +  DG     +QI                     I
Sbjct: 143 TSKGHHRG-MGTVEFTNSKDVEDAIRQYDGSYFLDRQIFVRQDNPPPDGGRSSRRSDESI 201

Query: 134 KINWAFQSQHVSSDDT-----------FNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVM 182
             +  +Q +  SS D            + +F+ +L   ++ + L   FKEF   ++A + 
Sbjct: 202 SSSRGYQDKSSSSYDRAPSTRQPNRQGYKVFIANLPFSINWQALKDMFKEFGDVLRADIE 261

Query: 183 WDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRIN--WASKREPQQHQ 235
            D   GRSRG+G V   E+   ++A+ +  G  + GR I +   ++++++P  ++
Sbjct: 262 LDS-RGRSRGFGTVILREKSAMEKAIATLNGTEMEGRRIDVKEGYSNRQDPSDYK 315

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTL 123
           ++Y  NL  +     L   F+  G I+N ++  +   E  + A VEY    DA+V  + L
Sbjct: 387 LIYCNNLPASTARSDLYDLFESIGRISNAELKYNDKGEPTSEAVVEYINLEDADVCIERL 446

Query: 124 DGKQIEGNVIKINWAFQS 141
           +G    G  ++I++  +S
Sbjct: 447 NGYNYGGCELQISYGKRS 464

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 42/96 (43%), Gaps = 1/96 (1%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +++ NL  +IN   LK  F+  G +    + +D       +  V   +      A  TL+
Sbjct: 231 VFIANLPFSINWQALKDMFKEFGDVLRADIELDSRGRSRGFGTVILREKSAMEKAIATLN 290

Query: 125 GKQIEGNVIKINWAFQSQHVSSDDTF-NLFVGDLNV 159
           G ++EG  I +   + ++   SD  + N +  D+N 
Sbjct: 291 GTEMEGRRIDVKEGYSNRQDPSDYKYGNDYRNDINT 326

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 311 QRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFK-HYPEKGC----CFIKYDTHEQAAVC 365
           +R    Y  N+P      DL  L ++ G I + +  Y +KG       ++Y   E A VC
Sbjct: 383 ERNHLIYCNNLPASTARSDLYDLFESIGRISNAELKYNDKGEPTSEAVVEYINLEDADVC 442

Query: 366 IVALANFPFQGRNLRTGWGK 385
           I  L  + + G  L+  +GK
Sbjct: 443 IERLNGYNYGGCELQISYGK 462

>KAFR0H01450 Chr8 (267293..269365) [2073 bp, 690 aa] {ON} Anc_8.491
           YPL043W
          Length = 690

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +  DV DE L G F  F     A V+ D ++ +SRG+GFVSF+ ++  + A
Sbjct: 20  DMKTLFVRSIPFDVTDEELGGFFSNFAPTKHAVVVKD-VNKKSRGFGFVSFATEEDTKDA 78

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           +   +   LNG  +R++ A +R+
Sbjct: 79  LGKARRSKLNGNVLRVDIAKRRD 101

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/195 (18%), Positives = 79/195 (40%), Gaps = 31/195 (15%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + L+V ++   + ++ L  +F    P  +  V+ D N +   + FV +    D   A   
Sbjct: 22  KTLFVRSIPFDVTDEELGGFFSNFAPTKHAVVVKDVNKKSRGFGFVSFATEEDTKDALGK 81

Query: 123 LDGKQIEGNVIKINWAFQ---SQHVSSDDTFNL---FVGDLNVD-VDDETLTGTFKEFPS 175
               ++ GNV++++ A +   ++    +   +L    +GD  V+  DDE     FK  P 
Sbjct: 82  ARRSKLNGNVLRVDIAKRRDRNKKNGEEKAISLPLDTIGDKEVEQSDDEEEDSQFKGKPK 141

Query: 176 FIQAHVMWDMLS------------------------GRSRGYGFVSFSEQDVAQQAMESK 211
            I  ++ W                            G+  G+ FV+  +    + A+E+ 
Sbjct: 142 LIIRNMPWSCRDPNKLKKIFGRFGNVVEASIPRKRDGKLCGFAFVTMKKISNCRLALENT 201

Query: 212 QGFILNGRAIRINWA 226
           +   ++GR + +++A
Sbjct: 202 KDLKIDGRNVAVDFA 216

>YPL043W Chr16 (469939..471996) [2058 bp, 685 aa] {ON}
           NOP4Nucleolar protein, essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis; constituent of 66S pre-ribosomal particles;
           contains four RNA recognition motifs (RRMs)
          Length = 685

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +  DV DE L   F  F     A V+ D  + RSRG+GFVSF+ +D  ++A
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRSRGFGFVSFAVEDDTKEA 82

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           +   +    NG  +R++ A +R+
Sbjct: 83  LAKARKTKFNGHILRVDIAKRRD 105

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/76 (19%), Positives = 35/76 (46%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + L+V ++ + + ++ L  +F    PI +  V+ D N     + FV +    D   A   
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAK 85

Query: 123 LDGKQIEGNVIKINWA 138
               +  G++++++ A
Sbjct: 86  ARKTKFNGHILRVDIA 101

>NCAS0C04830 Chr3 (984086..985219) [1134 bp, 377 aa] {ON} Anc_1.408
          Length = 377

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 78/167 (46%), Gaps = 10/167 (5%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +++GNL     E+ L+ +F   G + N +V+  +   +     VE+  P DA  A +  +
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVMSYRGRSKG-MGTVEFTNPADAEEAIRQYN 138

Query: 125 GKQIEGNVIKINW-----AFQSQHVSSDDT---FNLFVGDLNVDVDDETLTGTFKEFPSF 176
           G    G  I +         + +  SS+ T   +  FV +L   +  + L   F+E    
Sbjct: 139 GVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDIFRECGDV 198

Query: 177 IQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
           I+A V  D  +G SRG+G V ++ ++   +A++S  G  L GR + +
Sbjct: 199 IRADVELD-YNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEV 244

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 74/204 (36%), Gaps = 43/204 (21%)

Query: 66  YVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLDG 125
           +V NL  +I    LK  F+  G +    V +D N     +  V Y    D   A  + +G
Sbjct: 175 FVVNLPYSITWQNLKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNG 234

Query: 126 KQIEGNVIKI---------------------------------------NWAFQSQHVSS 146
            ++EG ++++                                       N +F ++ VS 
Sbjct: 235 AELEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSF-TEGVSG 293

Query: 147 DDTFN--LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVA 204
           D   N  ++  +L +      L   F        A +++D  +G S G   V ++ QD A
Sbjct: 294 DGERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDE-TGTSTGAAVVEYASQDAA 352

Query: 205 QQAMESKQGFILNGRAIRINWASK 228
              +    G+   GR + I +AS+
Sbjct: 353 DVCINKLNGYNYGGRDLHITYASR 376

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 311 QRVTTAYIGNIPHFAQEPDLIPLLQNFGFI-----IDFKHYPEKGCCFIKYDTHEQAAVC 365
           +R  T Y  N+P     PDL  L  + G I     +  +     G   ++Y + + A VC
Sbjct: 296 ERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVC 355

Query: 366 IVALANFPFQGRNLRTGW 383
           I  L  + + GR+L   +
Sbjct: 356 INKLNGYNYGGRDLHITY 373

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 30/74 (40%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +Y  NL  +     L   F   G IA  +++ D+       A VEY     A+V    L+
Sbjct: 301 VYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLN 360

Query: 125 GKQIEGNVIKINWA 138
           G    G  + I +A
Sbjct: 361 GYNYGGRDLHITYA 374

>YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putative
           RNA-binding protein, interacts with Mex67p, which is a
           component of the nuclear pore involved in nuclear mRNA
           export
          Length = 659

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (57%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           +  T +LF+G+L   V +E L   FK + SF  A V  D L+ +S GYG+++F +++ A+
Sbjct: 107 TSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAE 166

Query: 206 QAMESKQGFILNGRAIRI 223
            A +     +  G+ ++I
Sbjct: 167 SARKEFNYTVFFGQEVKI 184

>Skud_16.238 Chr16 (433890..435932) [2043 bp, 680 aa] {ON} YPL043W
           (REAL)
          Length = 680

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +  DV DE L   F  F     A V+ D  + RSRG+GFVSF+ +D  ++A
Sbjct: 24  DMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRSRGFGFVSFAVEDDTKEA 82

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           +   +    NG  +R++ A +R+
Sbjct: 83  LIKARKTKFNGHTLRVDVAKRRD 105

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/202 (17%), Positives = 80/202 (39%), Gaps = 42/202 (20%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + L+V ++ + + ++ L  +F    PI +  V+ D N     + FV +    D   A   
Sbjct: 26  KTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALIK 85

Query: 123 LDGKQIEGNVIKINWAFQSQH---------VSSDDTFNLFVG-----DLNVDVDDETLTG 168
               +  G+ ++++ A +            + + ++F   +G     + + D +D  L G
Sbjct: 86  ARKTKFNGHTLRVDVAKRRDRSKKSSEGAPMKASESFEKTIGQKTENEHDADGEDSMLKG 145

Query: 169 TFKEFPSFIQAHVMW---------DMLS---------------GRSRGYGFVSFSEQDVA 204
                P  I  ++ W         D+ S               G+  G+ FV+  +    
Sbjct: 146 K----PKLIIRNMPWSCRDSTKLKDIFSRYGTVVEATIPRKRDGKLCGFAFVTMKKISNC 201

Query: 205 QQAMESKQGFILNGRAIRINWA 226
           + A+E+ +   ++GR + +++A
Sbjct: 202 RIALENSKDLKIDGRKVAVDFA 223

>KLTH0E11418g Chr5 complement(1020231..1022312) [2082 bp, 693 aa]
           {ON} some similarities with uniprot|P37838 Saccharomyces
           cerevisiae YPL043W NOP4 Nucleolar protein essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis contains four RNA
           recognition motifs (RRMs)
          Length = 693

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 1/90 (1%)

Query: 141 SQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSE 200
           S   +S D   LFV  +  +  DE LT  F E      A ++ D     SRG+GFVSF+ 
Sbjct: 12  SSAKNSLDMKTLFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEKN-SRGFGFVSFAV 70

Query: 201 QDVAQQAMESKQGFILNGRAIRINWASKRE 230
           +D  + A+E  +     GR +R++ A +RE
Sbjct: 71  EDDTKDALEKARKTKFKGRLLRVDIAKRRE 100

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/187 (16%), Positives = 74/187 (39%), Gaps = 24/187 (12%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + L+V ++     ++ L  YF    PI +  ++ D       + FV +    D   A + 
Sbjct: 21  KTLFVRSIPFEATDEELTNYFSELAPIKHAVIVKDNEKNSRGFGFVSFAVEDDTKDALEK 80

Query: 123 LDGKQIEGNVIKINWAFQSQHVSSDDTFN----------------------LFVGDLNVD 160
               + +G +++++ A + +    D   +                      L + ++   
Sbjct: 81  ARKTKFKGRLLRVDIAKRRERSKGDQRSSSSSEQAGNVENKENELMGGKPKLIIRNMPWS 140

Query: 161 VDD-ETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGR 219
           V   E L   F  F + ++A +      G+  G+ FV+  +    ++A+E  +   ++GR
Sbjct: 141 VRKPEQLKQIFMRFGTVVEAKIP-KKPDGKLCGFAFVTMKKLAACKKAIEDSKDLKIDGR 199

Query: 220 AIRINWA 226
            + +++A
Sbjct: 200 QVAVDFA 206

>KNAG0C02030 Chr3 (396024..397121) [1098 bp, 365 aa] {ON} Anc_1.357
           YHR015W
          Length = 365

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 44/67 (65%)

Query: 141 SQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSE 200
           +  ++SD   +LF+G+L+ +V +E L G F  +P FI A + ++ ++ +S G+G+++FS 
Sbjct: 83  TNKLASDSMESLFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNFSN 142

Query: 201 QDVAQQA 207
           +  A +A
Sbjct: 143 KIDAIRA 149

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 38/185 (20%), Positives = 80/185 (43%), Gaps = 10/185 (5%)

Query: 52  LATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEY 110
           +AT      S   L++GNL K + E+ L+  F V     + K+  +   +++  + ++ +
Sbjct: 81  MATNKLASDSMESLFIGNLHKNVTEELLRGVFGVYPGFISAKICYNAITKKSLGHGYLNF 140

Query: 111 HQPHDANVAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF 170
               DA  A + L+   I  + I++  + ++         N+F+ +L +D+   T    +
Sbjct: 141 SNKIDAIRATKDLNYCNILSSEIRLMPSMRNAAYRKQIGTNVFMSNLPLDIPFLTTRFFY 200

Query: 171 KEFPSFIQAHVMWDMLSGR---SRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWAS 227
             F  F       ++LS +    +G GF+ F    VA   +    G +L G+ +  +   
Sbjct: 201 VYFSGF------GEVLSCKLVEEKGIGFIYFESNTVANYVVNLFNGSLLYGKQVFCSIHK 254

Query: 228 KREPQ 232
            +E +
Sbjct: 255 SKEER 259

>CAGL0I08943g Chr9 (867666..869474) [1809 bp, 602 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae YFR023w PES4
           DNA-directed DNA polymerase epsilon suppressor
          Length = 602

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 42/72 (58%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L  ++  E LT  FK + SFI A V  +    RS G+G+++F  ++ A++A E  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 212 QGFILNGRAIRI 223
               + G+ IRI
Sbjct: 126 NYNKIMGKEIRI 137

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 66/151 (43%), Gaps = 14/151 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQTL 123
           L+VGNL + I  + L + F+V     + KV  +  +N    + ++ +    DA  A +  
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLT-----GTFKEFPSFIQ 178
           +  +I G  I+I  + +      +   N+F    N+ +  E LT       F+++ + + 
Sbjct: 126 NYNKIMGKEIRIMPSIRDSVYRKNFGTNIFFS--NLPLQKEKLTHRMFYDIFRKYGNVLS 183

Query: 179 AHVMWDMLSGRSRGYGFVSFSEQDVAQQAME 209
             +        S+  GFV F +  +A+  ++
Sbjct: 184 VKL------DSSKNIGFVYFEDDTIARDVIK 208

>TPHA0A02220 Chr1 complement(457287..459428) [2142 bp, 713 aa] {ON}
           Anc_1.357 YHR015W
          Length = 713

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           L++GDL  DV +  L   F  + SF+ A +  D  +G S GYG+++ S ++ A   +E  
Sbjct: 154 LYIGDLGKDVTEGMLNSIFNSYNSFVSAKICIDSKTGESLGYGYLNLSNREEAYSLLERY 213

Query: 212 QGFILNGRAIRI 223
               + GR +RI
Sbjct: 214 NYTNIFGREVRI 225

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/149 (17%), Positives = 60/149 (40%), Gaps = 10/149 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQTL 123
           LY+G+L K + E  L   F       + K+ +D K  E   Y ++      +A    +  
Sbjct: 154 LYIGDLGKDVTEGMLNSIFNSYNSFVSAKICIDSKTGESLGYGYLNLSNREEAYSLLERY 213

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVD---VDDETLTGTFKEFPSFIQAH 180
           +   I G  ++I  + ++  +      N+++  L++    +        FK +   +   
Sbjct: 214 NYTNIFGREVRIMPSLRNSTMRKQIGTNIYLAGLSLKKKGITTRIFYDYFKIYGKILSCK 273

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAME 209
           + ++      +  GF+ F  + +A + +E
Sbjct: 274 LNFE------KDIGFIFFENKSIANKVIE 296

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 64  ILYVGNLDKAINEDTLKQY-FQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           I+Y+ NL      + LKQ+ F        +K+   +NN+ +  A V     +DA   F  
Sbjct: 470 IVYLSNLSSICTIEFLKQFCFLKNIRQETIKLNNSQNNDSSLNASVLCKTKNDAKKLFNC 529

Query: 123 LDGKQIEGNVIKINWAFQSQHV 144
           L+ + I G+ IK +W   S+ V
Sbjct: 530 LNDRLIGGSQIKTSWHDMSKSV 551

>SAKL0D08558g Chr4 (712000..713394) [1395 bp, 464 aa] {ON} similar
           to uniprot|P38922 Saccharomyces cerevisiae YNL004W
          Length = 464

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 74/173 (42%), Gaps = 15/173 (8%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           ++VGNL      + LK+YF   G +    ++  + +       VE+    D + A +  D
Sbjct: 164 IFVGNLTYDCQPEDLKEYFSQIGEVVRADIITSRGHHRG-MGTVEFTNADDVDEAIRRFD 222

Query: 125 GKQIEGNVIKIN-------------WAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFK 171
           G  +    I +                 + +  +S   + +F+ +L   V+ + L   FK
Sbjct: 223 GSTLLDREIFVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNWQALKDMFK 282

Query: 172 EFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRIN 224
           E    ++A V  D   G SRGYG V +  ++  Q A+E   G+ L GR + ++
Sbjct: 283 ECGDVLRADVKLDR-DGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVLDVH 334

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFI----IDFKHYPE-KGCCFIKYDTHEQAAVCIVA 368
           +T ++ N+P    + DL  L +  G +    + F +  +  G   ++YD    A VCI  
Sbjct: 386 STIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVCISR 445

Query: 369 LANFPFQGRNLRTGW 383
           L ++ + GR+L   +
Sbjct: 446 LNSYNYGGRDLDISY 460

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 52  LATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYH 111
           +AT GG ++S   ++V NL  +  +  L   F+  G +   ++    N + +  A VEY 
Sbjct: 377 MATGGGDQSS--TIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYD 434

Query: 112 QPHDANVAFQTLDGKQIEGNVIKINWA 138
            P DA V    L+     G  + I++ 
Sbjct: 435 NPADAEVCISRLNSYNYGGRDLDISYV 461

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           ++FVG+L  D   E L   F +    ++A ++     G  RG G V F+  D   +A+  
Sbjct: 163 SIFVGNLTYDCQPEDLKEYFSQIGEVVRADII--TSRGHHRGMGTVEFTNADDVDEAIRR 220

Query: 211 KQGFILNGRAI 221
             G  L  R I
Sbjct: 221 FDGSTLLDREI 231

>AEL217W Chr5 (225217..227721) [2505 bp, 834 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR250C
          Length = 834

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 84/214 (39%), Gaps = 52/214 (24%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           LY+  + K ++ D L   F   G + ++K+++D N  E+  Y F+ Y     A    + L
Sbjct: 219 LYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKEL 278

Query: 124 DGKQIEGNVIKINWAFQSQ--------HVSSDDT----FNLFVGDLNVDVDDETLTGTFK 171
           +G  + G+ + IN+  + +        H+  D+       +FVG+L  + +D TL    +
Sbjct: 279 NGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLITPEQ 338

Query: 172 EFPSFIQAHVMWDMLS---------------------------------------GRSRG 192
            F  F       D+LS                                          +G
Sbjct: 339 VFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNEDSPLKG 398

Query: 193 YGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
           YGF+ FS  D+A +A++    F   G ++ +N A
Sbjct: 399 YGFIKFSTHDMALKAIDKLNSFTWLGHSLVVNKA 432

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 58/121 (47%), Gaps = 6/121 (4%)

Query: 119 AFQTLDG--KQIEGNVIKIN----WAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKE 172
           AFQ L     QI+ N+ K +    W+      +     NL++  +  D+  + L   F +
Sbjct: 180 AFQDLCAARNQIKENLEKSDHVEAWSISQNPHALTHPGNLYIRGIPKDLSVDDLIPIFSK 239

Query: 173 FPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQ 232
           F + +   ++ D  +  S GYGF+S+     A + ++   G ++NG  + IN+  +R+ +
Sbjct: 240 FGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKELNGNLMNGSPLFINYHVERKER 299

Query: 233 Q 233
           +
Sbjct: 300 E 300

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 41/95 (43%), Gaps = 16/95 (16%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHV---------------MWDMLSGRSRGYGF 195
           NL+V  + +   DE L   + ++   I A +               + D+  G SRGYGF
Sbjct: 600 NLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRGYGF 659

Query: 196 VSFSEQDVAQQAMESKQGF-ILNGRAIRINWASKR 229
           V F     A +AM +   F +     + +++A KR
Sbjct: 660 VCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 29/77 (37%), Gaps = 6/77 (7%)

Query: 317 YIGNIPHFAQEPDLIPLLQNFG------FIIDFKHYPEKGCCFIKYDTHEQAAVCIVALA 370
           YI  IP      DLIP+   FG       IID       G  FI Y    QAA CI  L 
Sbjct: 220 YIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIKELN 279

Query: 371 NFPFQGRNLRTGWGKEK 387
                G  L   +  E+
Sbjct: 280 GNLMNGSPLFINYHVER 296

>Suva_8.370 Chr8 (653473..654114) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 82/180 (45%), Gaps = 13/180 (7%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVA 119
           S   +YVGN+D  I ++ L + F    PI  +K   DK  +    YAF+E+H   DA   
Sbjct: 7   SGSTVYVGNIDPRITKEQLYELFIQINPILRIKYPKDKVLQTYQGYAFIEFHSKEDAQYV 66

Query: 120 FQTLDGK-QIEGNVIKINWAFQSQHVSSDDTFN----------LFVGDLNVDVDDETLTG 168
            Q ++   ++   +IK+     S   ++  + N          LFV +L   VD E L  
Sbjct: 67  IQIMNNTVKLYDRLIKVRQVTNSVGAANASSNNSKGISLPIAKLFVKNLADSVDIEQLEK 126

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F +F   +    ++ + +G+ +   +V F + + A  A++S    ++    I +++A K
Sbjct: 127 IFNKFGKTVNKPEIFHLSTGKLKC-AYVYFEDFEKADMAIKSLNNQLVANNRITVDYAFK 185

>AGL250W Chr7 (232080..234269) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL043W (NOP4)
          Length = 729

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV ++  D  D  LT  F +F     A ++ D  +G SRG+GFVSF+ +   Q A
Sbjct: 14  DLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDN-AGSSRGFGFVSFAVESDTQAA 72

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           ++  +     GR +R++ A +RE
Sbjct: 73  LDKGRKTQFKGRLLRVDVAKRRE 95

>Skud_8.67 Chr8 (116061..118019) [1959 bp, 652 aa] {ON} YHR015W
           (REAL)
          Length = 652

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 41/72 (56%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+G L   V +E L  TFK++ SF  A +  D L+ +S GYG+++F  +  A+ A +  
Sbjct: 113 LFIGKLKSTVTEEMLRKTFKKYQSFESAKICRDFLTKKSLGYGYLNFGNKKDAEAAKKEF 172

Query: 212 QGFILNGRAIRI 223
              I  G+ ++I
Sbjct: 173 NYRIFFGQEVKI 184

>Kwal_27.12337 s27 complement(1185308..1185937) [630 bp, 209 aa]
           {ON} YOR319W (HSH49) - homolog of mammalian splicing
           factor/U2 snRNP protein [contig 20] FULL
          Length = 209

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 81/174 (46%), Gaps = 8/174 (4%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAF 120
           D  +YVGN+D  +  + L + F    P+A ++   DK       +AFVE++   D   A 
Sbjct: 9   DNTVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYAT 68

Query: 121 QTLDGK-QIEGNVIKINWAFQSQHV-----SSDDTFNLFVGDLNVDVDDETLTGTFKEFP 174
           + L+   ++    +K+  A  + H      + D    LFV +++  VD   LT  F +F 
Sbjct: 69  KCLNNSLRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTRIFSKFG 128

Query: 175 SFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
              +A  ++ +  G  +   +VS++  + + +A+      ++  + I +++A K
Sbjct: 129 PLAKAPEIFYLKQGVLKC-AYVSYTTFEHSDKALAKLNNQMVMNKCISLDYALK 181

>KNAG0A02210 Chr1 (195984..198032) [2049 bp, 682 aa] {ON} Anc_8.491
           YPL043W
          Length = 682

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +   V DE LT  F  F     A V+ D ++ +SRG+GFVSF+ ++  ++A
Sbjct: 15  DLQTLFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKD-VNKKSRGFGFVSFASEEDTKEA 73

Query: 208 MESKQGFILNGRAIRINWASKREPQQHQ 235
           +   +   LNG+ +R++ A +RE  + +
Sbjct: 74  LLKARKEKLNGQLLRVDIAKRRERNKRK 101

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/191 (18%), Positives = 79/191 (41%), Gaps = 30/191 (15%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           L+V  +  A+ ++ L ++F    P  +  V+ D N +   + FV +    D   A     
Sbjct: 19  LFVRAIPFAVTDEQLTEFFANFAPTKHAVVVKDVNKKSRGFGFVSFASEEDTKEALLKAR 78

Query: 125 GKQIEGNVIKINWAFQSQ------------------------HVSSDDTF----NLFVGD 156
            +++ G +++++ A + +                        +   DD F     L + +
Sbjct: 79  KEKLNGQLLRVDIAKRRERNKRKEDASNGIAAPKPEHKEKRTYGDEDDQFKGKPKLIIRN 138

Query: 157 LNVDVDD-ETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFI 215
           +     D  TL   F  F + + AH+      G+  G+ FV+ ++    + A+E+ +   
Sbjct: 139 MPWSCRDPNTLKNIFGRFGTVVDAHIPRKR-DGKLCGFAFVTMNKISNCKNALENTKDLK 197

Query: 216 LNGRAIRINWA 226
           ++GR + +++A
Sbjct: 198 IDGRQVAVDFA 208

>KAFR0C04410 Chr3 complement(870329..872098) [1770 bp, 589 aa] {ON}
           Anc_1.357 YHR015W
          Length = 589

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 1/80 (1%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+G+L+ DV ++ L   F  +PSFI A V ++  +  S G+G+++F  ++ A++A E  
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 212 QGFILNGRAIRINWASKREP 231
               +    IRI   S R+P
Sbjct: 151 NYSKVLNNEIRI-MPSMRDP 169

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKN-NEEANYAFVEYHQPHDANVAFQTL 123
           L++GNLDK + E  L+  F V     + KV  + + N    + ++ +    DA  A + +
Sbjct: 91  LFIGNLDKDVTEKQLETIFSVYPSFISAKVCYNSSTNLSLGHGYLNFGSKEDAEKACEEM 150

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +  ++  N I+I  + +          N++    N+  ++  LT  +  + SF +   + 
Sbjct: 151 NYSKVLNNEIRIMPSMRDPDYRKKVGTNVYFR--NLPTENNMLTTRY-FYDSFRKYGKIL 207

Query: 184 DMLSGRSRGYGFVSFSEQDVAQQAME 209
                RS+  GF+ F+ +  A + ++
Sbjct: 208 SCKIERSKKIGFIYFACEVTANEVIK 233

>SAKL0B06270g Chr2 complement(532445..533074) [630 bp, 209 aa] {ON}
           similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 81/175 (46%), Gaps = 12/175 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQTL 123
           LY+GN+D  + +D L + F    PI+ ++   DK  +    YAF+E+    DA+   + +
Sbjct: 12  LYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVKVM 71

Query: 124 DGK-QIEGNVIKINWAFQ-------SQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPS 175
           +   Q+    +K+  A         S+HV       LFV +L+  VD   L   F +F  
Sbjct: 72  NNTVQLYNRTLKVRRANSNTAASQPSKHVEI--GAKLFVKNLDDLVDVAALAKIFGKFGP 129

Query: 176 FIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKRE 230
           F +   ++ +     +   ++ ++  D + QA+      I+  R+I +++A K E
Sbjct: 130 FSKQPEIFHVKQADYKC-AYIYYTTFDDSDQALAKLNNQIVFNRSISVDYAFKDE 183

>Skud_15.487 Chr15 (852519..853160) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 86/180 (47%), Gaps = 13/180 (7%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVA 119
           SD  +YVGN+D  I +D L + F    P+  +K   DK  +    YAF+E++   DA   
Sbjct: 7   SDSTVYVGNIDPRITKDQLYELFIQINPVLRIKYPKDKVLQTYQGYAFIEFYNKEDAEYV 66

Query: 120 FQTLDGK-QIEGNVIKINWAFQS---QHVSSDDTFN-------LFVGDLNVDVDDETLTG 168
            Q ++   ++   +IK+     S    ++SS+++ +       LFV +L   +D + L  
Sbjct: 67  IQIMNNTVKLYDRLIKVRQVTNSVGTANLSSNNSKDIALPIAKLFVKNLADSIDIDQLAK 126

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F +F   I    ++ + +G+ +    V F + + A  A++S    ++    I I++A K
Sbjct: 127 IFGKFGKTISKPEIFHLSNGKLKC-ACVYFEDFEKADLAIKSLNNQLVANSRITIDYAFK 185

>CAGL0I09900g Chr9 (946987..947622) [636 bp, 211 aa] {ON} similar to
           uniprot|Q99181 Saccharomyces cerevisiae YOR319w
           essential yeast splicing factor
          Length = 211

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 80/172 (46%), Gaps = 19/172 (11%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQTL 123
           +YVGN+D  + ++ L + F   G +  VK   DK ++E   +AF+E+    DA+     +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 124 DGK-QIEGNVIKINWAFQSQHVSSDD-------------TFNLFVGDLNVDVDDETLTGT 169
           +   ++   V+KI  +  +Q V  DD                +FV D+   V+   LT  
Sbjct: 68  NNNVKLYQKVLKIRRS--NQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQL 125

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQG-FILNGRA 220
           F +F    +   ++ + +G  R   F+ F   D A  A+++  G FI+N +A
Sbjct: 126 FSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKA 176

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           ++V ++   +    L Q F   GP+A    +   +N E   AF+ +    +A++A QTL+
Sbjct: 108 VFVKDIADTVEVRHLTQLFSKFGPLAKTPEVFTVSNGEVRCAFIYFKFYDNADLAIQTLN 167

Query: 125 GKQIEGNVIKINWAFQ 140
           G+ I      + +AF+
Sbjct: 168 GQFIMNKKASLEYAFK 183

>KLLA0D13772g Chr4 (1185663..1186700) [1038 bp, 345 aa] {ON} some
           similarities with uniprot|P40561 Saccharomyces
           cerevisiae YIR001C SGN1 Cytoplasmic RNA-binding protein
           contains an RNA recognition motif (RRM) may have a role
           in mRNA translation as suggested by genetic interactions
           with genes encoding proteins involved in translational
           initiation
          Length = 345

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 14/116 (12%)

Query: 124 DGKQIEGNVIKINWAFQSQHVSSD----------DTFNLFVGDLNVDVDDETLTGTFKEF 173
           +G+Q E NV K N   +  H  S           D+ ++FVG++  +   ETL   FK+ 
Sbjct: 68  NGEQDESNV-KTNSGKKDHHHQSRAERLEKQIELDSRSIFVGNITTEATAETLEEHFKDC 126

Query: 174 PSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
              ++  ++++ L+G  +GY ++ F   D   +A+E K    L+G  I +  A KR
Sbjct: 127 GEVVRVTILYNKLTGAPKGYAYIEFESSDSIPKALELKDS-ELHGETINV--AKKR 179

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 2/78 (2%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDAN 117
           E   R ++VGN+      +TL+++F+  G +  V +L +K       YA++E+       
Sbjct: 99  ELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFESSDSIP 158

Query: 118 VAFQTLDGKQIEGNVIKI 135
            A +  D  ++ G  I +
Sbjct: 159 KALELKD-SELHGETINV 175

>TDEL0H03240 Chr8 complement(540934..541437) [504 bp, 167 aa] {ON}
           Anc_7.159 YIR005W
          Length = 167

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/114 (21%), Positives = 62/114 (54%), Gaps = 5/114 (4%)

Query: 119 AFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQ 178
           A Q ++  ++   ++  N ++ +++    D   +F+G LNV++ +  +   F ++   + 
Sbjct: 6   AIQRINDTELSSGILSPNLSWHNEY---KDRAYIFIGGLNVELTEADILTIFSQYGIPVD 62

Query: 179 AHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRIN--WASKRE 230
             ++ D  +G S+G+G++ + +Q  A  A+++  G  + GR I+++  W + R+
Sbjct: 63  VFLVRDRETGDSKGFGYLKYEDQRSAVLAIDNLNGSKIAGRIIKVDHAWYTPRD 116

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 59  ETSDR-ILYVGNLDKAINE-DTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDA 116
           E  DR  +++G L+  + E D L  + Q G P+    V   +  +   + +++Y     A
Sbjct: 29  EYKDRAYIFIGGLNVELTEADILTIFSQYGIPVDVFLVRDRETGDSKGFGYLKYEDQRSA 88

Query: 117 NVAFQTLDGKQIEGNVIKINWAFQS 141
            +A   L+G +I G +IK++ A+ +
Sbjct: 89  VLAIDNLNGSKIAGRIIKVDHAWYT 113

>KAFR0A07490 Chr1 (1512089..1513234) [1146 bp, 381 aa] {ON} Anc_2.80
           YNL175C
          Length = 381

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 41/82 (50%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  DE L   F+     I+  +     SG+ +G+ FV F  ++ A  A++ K
Sbjct: 225 LFVGNLSFDTTDEVLKKHFQHCGEIIKIRMATFQDSGKCKGFAFVDFKSEEGATNALKDK 284

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               +  R IR+ +   R  +Q
Sbjct: 285 TCRRIASRPIRMEYGEDRSKRQ 306

 Score = 36.6 bits (83), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL     ++ LK++FQ  G I  +++   +++ +   +AFV++     A  A +
Sbjct: 223 RILFVGNLSFDTTDEVLKKHFQHCGEIIKIRMATFQDSGKCKGFAFVDFKSEEGATNALK 282

Query: 122 TLDGKQIEGNVIKINW 137
               ++I    I++ +
Sbjct: 283 DKTCRRIASRPIRMEY 298

>KNAG0I01590 Chr9 complement(308547..310319) [1773 bp, 590 aa] {ON}
           Anc_1.357 YHR015W
          Length = 590

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQ 201
           L++G L   ++ +TL  TFK+F S   A V +D L+G S GYG+++F+ Q
Sbjct: 88  LYIGGLGKSINSKTLIETFKDFLSLQSAKVCYDSLTGDSLGYGYLNFTSQ 137

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 61/148 (41%), Gaps = 10/148 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQTL 123
           LY+G L K+IN  TL + F+    + + KV  D    +   Y ++ +    + +      
Sbjct: 88  LYIGGLGKSINSKTLIETFKDFLSLQSAKVCYDSLTGDSLGYGYLNFTSQKELDKFVDKY 147

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDL---NVDVDDETLTGTFKEFPSFIQAH 180
           + K++ G  IK+  + ++     +   N+F  +L   N  +        FK++   +   
Sbjct: 148 NYKRMLGGEIKLMPSLRNSVYRKNIGTNVFFSNLPLHNSGLSTRRFYDIFKKYGKILSCK 207

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAM 208
                L  R +  GFV F +   A + +
Sbjct: 208 -----LDAR-KNIGFVYFEDDKAATKVI 229

>TDEL0D02250 Chr4 complement(432801..434669) [1869 bp, 622 aa] {ON}
           Anc_1.357 YHR015W
          Length = 622

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%)

Query: 141 SQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSE 200
           S  + S     LF+GDL   V +  L   F +F S     +  D  SG+S GYG+++F+ 
Sbjct: 88  SSTLESKSVVALFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFAN 147

Query: 201 QDVAQQAMESKQGFILNGRAIRI 223
            + A++A E      + G+ +RI
Sbjct: 148 SEDAEKATEEFNYRPIEGQEVRI 170

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 74/155 (47%), Gaps = 14/155 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNN-EEANYAFVEYHQPHDANVAFQTL 123
           L++G+L+ ++ E+ L+  F     + +VK+ +D N+ +   Y ++ +    DA  A +  
Sbjct: 99  LFIGDLEPSVTENMLRDIFGKFRSLTSVKICLDSNSGKSLGYGYLNFANSEDAEKATEEF 158

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLT-----GTFKEFPSFIQ 178
           + + IEG  ++I  + ++     +   N+F    N+ ++D  LT      TFK++   + 
Sbjct: 159 NYRPIEGQEVRIMPSLRNSFYRKNVGTNVFFS--NLPLEDSRLTTRVFYDTFKKYGKILS 216

Query: 179 AHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQG 213
             +       + +  GF+ F+    A++ ++   G
Sbjct: 217 CKL------DKRKDIGFIYFNNDQSARKVIKDYNG 245

>Suva_15.198 Chr15 (343049..345037) [1989 bp, 662 aa] {ON} YHR015W
           (REAL)
          Length = 662

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+G L   V +E L  TFK++ SF  A V  D L+ +S GYG+++F  +  A  A +  
Sbjct: 118 LFIGKLKPTVTEEMLKQTFKKYQSFESAKVCRDFLTKKSLGYGYLNFKSEGDADAAKKDF 177

Query: 212 QGFILNGRAIRI 223
              +  G+ ++I
Sbjct: 178 NYTLFFGQEVKI 189

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 62/146 (42%), Gaps = 4/146 (2%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQTL 123
           L++G L   + E+ LKQ F+      + KV  D    +   Y ++ +    DA+ A +  
Sbjct: 118 LFIGKLKPTVTEEMLKQTFKKYQSFESAKVCRDFLTKKSLGYGYLNFKSEGDADAAKKDF 177

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +     G  +KI  + ++     +   N+F  +L +D +    T +F  +   I+   + 
Sbjct: 178 NYTLFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPLD-NPHLTTRSF--YLIMIEYGNVL 234

Query: 184 DMLSGRSRGYGFVSFSEQDVAQQAME 209
             L  + +  GFV F     A+  ++
Sbjct: 235 SCLLEKRKDIGFVYFDNDISARNVIK 260

>CAGL0J11154g Chr10 (1085737..1086879) [1143 bp, 380 aa] {ON}
           similar to uniprot|P53883 Saccharomyces cerevisiae
           YNL175c NOP13
          Length = 380

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  DE L   F+     ++  +     SG+ +G+ FV F  ++ A  A++ K
Sbjct: 225 LFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDK 284

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               + GR +R+ +   R  +Q
Sbjct: 285 SCRKIAGRPLRMEFGEDRSKRQ 306

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL     ++ L+++FQ  G I  +++   +++ +   +AFV++     A  A +
Sbjct: 223 RILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALK 282

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  +++ +
Sbjct: 283 DKSCRKIAGRPLRMEF 298

>NDAI0F03320 Chr6 (798225..799424) [1200 bp, 399 aa] {ON} Anc_2.80
          Length = 399

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  DE L   F+     I+  +     SG+ +G+ FV F  ++ A  A++ K
Sbjct: 240 LFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALKDK 299

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               + GR +R+ +   R  +Q
Sbjct: 300 TCRKIAGRPLRMEFGEDRSKRQ 321

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLV-DKNNEEANYAFVEYHQPHDANVAFQ 121
           RIL+VGNL     ++ L+++FQ  G I  +++   + + +   +AFV++     A  A +
Sbjct: 238 RILFVGNLSFDTTDELLRKHFQHCGEIIKIRMATFEDSGKCKGFAFVDFKNEEGATNALK 297

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  +++ +
Sbjct: 298 DKTCRKIAGRPLRMEF 313

>TPHA0B04300 Chr2 (1005558..1006562) [1005 bp, 334 aa] {ON}
           Anc_1.102
          Length = 334

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFV  LN   + + L   F  F   I   ++ D  +GRS GYGF+ F  +   + A  + 
Sbjct: 244 LFVCKLNAMTNAKDLAQIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSNM 303

Query: 212 QGFILNGRAIRINWA 226
           +G I++ + I ++++
Sbjct: 304 EGVIIDDKKIHVDFS 318

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNN-EEANYAFVEYHQPHDANVAFQT 122
           +L+V  L+   N   L Q F   G I +V+++ DK+      Y F+E+       +A+  
Sbjct: 243 VLFVCKLNAMTNAKDLAQIFSRFGQIISVEIVRDKDTGRSLGYGFIEFDSEGAVELAYSN 302

Query: 123 LDGKQIEGNVIKINWAFQSQHVS 145
           ++G  I+   I +++   SQ VS
Sbjct: 303 MEGVIIDDKKIHVDF---SQSVS 322

>YGR250C Chr7 complement(991176..993521) [2346 bp, 781 aa] {ON}
           Putative RNA binding protein; localizes to stress
           granules induced by glucose deprivation; interacts with
           Rbg1p in a two-hybrid
          Length = 781

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 97/223 (43%), Gaps = 64/223 (28%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQTL 123
           ++VG + K+++   L   F   GPI ++K++ DK   E N Y F+ Y     A++  + L
Sbjct: 197 IFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKEL 256

Query: 124 DGKQIEGNVIKINWAFQSQ--------HV---SSDDTFN-LFVGDLN------------- 158
           +G+ + G+ + IN+  + +        HV   ++DD F  LF+G+L              
Sbjct: 257 NGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVETLITP 316

Query: 159 ---VDVDDETLTGTFKEFPSF--------------------------IQAHVMWDMLSGR 189
              ++V  + L+   K+FP F                          ++++   +  +G 
Sbjct: 317 KEVIEVIKKELS---KKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTNGN 373

Query: 190 S------RGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
           +      +GYGF+     + A  A+E+  GF+ +G  + +N A
Sbjct: 374 AQDEDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKA 416

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 41/83 (49%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           N+FVG +   +    L+  F ++   +   +++D   G   GYGF+S+     A   ++ 
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255

Query: 211 KQGFILNGRAIRINWASKREPQQ 233
             G  +NG  + IN+  +R+ ++
Sbjct: 256 LNGRTVNGSTLFINYHVERKERE 278

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 20/99 (20%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW-------------------DMLSGRSR 191
           NL+V  + +   DE L   +K F   I   V+                    D+  G SR
Sbjct: 541 NLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPVGSSR 600

Query: 192 GYGFVSFSEQDVAQQAMESKQGF-ILNGRAIRINWASKR 229
           GYGFVSF     A +A+ +  G+ +   + + +++A KR
Sbjct: 601 GYGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQKR 639

>NDAI0D04810 Chr4 complement(1135992..1137872) [1881 bp, 626 aa]
           {ON} Anc_4.33 YHL024W
          Length = 626

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 48  VTPVLATKGGRETSDRILYVGNLDKAINEDTL----KQYFQVGGPIANVKVLVDKNNEEA 103
           + P + TK  R      ++V +L   + +D L      YF+  G I  VKVL D+ N   
Sbjct: 43  IPPAMNTKPFRGRPSSCVFVASLTSTLTDDELCVSVTDYFKKFGEIVRVKVLRDQANRP- 101

Query: 104 NYAFVEYHQPHDANVAFQTLDGKQIEGNVIK 134
            YAFV+Y    DAN A +T  G  + G  ++
Sbjct: 102 -YAFVQYTNDKDANNALKTAHGSLLNGRRLR 131

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 152 LFVGDLNVDVDDETL----TGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           +FV  L   + D+ L    T  FK+F   ++  V+ D  +   R Y FV ++    A  A
Sbjct: 60  VFVASLTSTLTDDELCVSVTDYFKKFGEIVRVKVLRDQAN---RPYAFVQYTNDKDANNA 116

Query: 208 MESKQGFILNGRAIR 222
           +++  G +LNGR +R
Sbjct: 117 LKTAHGSLLNGRRLR 131

>NCAS0G04280 Chr7 (796093..797400) [1308 bp, 435 aa] {ON} Anc_1.408
          Length = 435

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/356 (18%), Positives = 125/356 (35%), Gaps = 64/356 (17%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           ++VGNL      + L+ YF   G +    ++  K +       VE+    D   A +  D
Sbjct: 107 IFVGNLTYDCTPEDLRDYFSGIGEVVRADIITSKGHHRG-MGTVEFTNSRDVEEAIRQYD 165

Query: 125 GKQIEGNVIKINW---------------------AFQSQHVSS---------DDTFNLFV 154
                   I +                       + + Q +SS            + +FV
Sbjct: 166 SSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQSNMKQGYEIFV 225

Query: 155 GDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGF 214
            +L   ++ + L   FKE    ++A V  D  +GRSRG+G V F  +D  ++A++    F
Sbjct: 226 ANLPYSINWQALKDMFKECGDVMRADVELDR-AGRSRGFGTVIFRTRDDMERAIDRYNRF 284

Query: 215 ILNGRAIRINWASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGPM 274
            ++GR + +     RE   +                  HQ    +       + +N   +
Sbjct: 285 EVDGRTLDV-----REGHSNN---------RNDDMNIQHQTQNAMTNDATSDATSNERSL 330

Query: 275 GMAPQGMAXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLL 334
              P   A                    E ++    +R T  Y  N+P      DL  L 
Sbjct: 331 PTQPSEPASNRTSTF------------TEGVV-EGGERNTLIYCSNLPPSTARSDLYDLF 377

Query: 335 QNFGFIIDFKHYPEK-----GCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 385
           ++ G + + +   ++     G   +++ + + A VCI  L  + + G +L   + K
Sbjct: 378 ESIGKVRNAELKYDRNGETTGVAIVEFISQDDADVCIERLNKYNYGGCDLEISYAK 433

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 56/138 (40%), Gaps = 10/138 (7%)

Query: 1   MSVEQQEQPSQAIEVVNSVESVVATTPDQPXXXXXXXXXXXXXDQSQVTPVLATKGGRET 60
           M+++ Q Q +   +  +   S   + P QP               S  T  +   G R T
Sbjct: 305 MNIQHQTQNAMTNDATSDATSNERSLPTQPSEPASNRT-------STFTEGVVEGGERNT 357

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
              ++Y  NL  +     L   F+  G + N ++  D+N E    A VE+    DA+V  
Sbjct: 358 ---LIYCSNLPPSTARSDLYDLFESIGKVRNAELKYDRNGETTGVAIVEFISQDDADVCI 414

Query: 121 QTLDGKQIEGNVIKINWA 138
           + L+     G  ++I++A
Sbjct: 415 ERLNKYNYGGCDLEISYA 432

>TBLA0D04850 Chr4 (1191350..1192639) [1290 bp, 429 aa] {ON}
           Anc_1.408 YNL004W
          Length = 429

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/366 (19%), Positives = 119/366 (32%), Gaps = 85/366 (23%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           ++VGNL        LK YF   G +    ++  K +       VE+  P   + A   LD
Sbjct: 99  VFVGNLTFDTQPGDLKDYFSQVGDVIRADIITSKGHHRG-MGTVEFSNPEAVDAAISKLD 157

Query: 125 G-----KQI---------EGNVIKINWAFQSQHVSSDDT--------------------- 149
           G     +QI         EG   +     +     S D                      
Sbjct: 158 GSYLLDRQIFVRQDNPPPEGTRERRQPPRERNSRDSRDRDASRGRDRDIGRGRERGDHIP 217

Query: 150 ------FNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDV 203
                 + +FV ++      +TL   FKE    ++A V  D   G SRG+G V  + ++ 
Sbjct: 218 KHEQEGYEIFVANVPFATTWQTLKDLFKETGDVLRADVELDR-DGYSRGFGIVIMATKED 276

Query: 204 AQQAMESKQGFILNGRAIRINWASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGH 263
            ++++E   G+ L GR + +                                      GH
Sbjct: 277 MERSIERFNGYELEGRKLDVR------------------------------------AGH 300

Query: 264 PMGSPNNAGPMGMAPQGMAXXXXXXXXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPH 323
              SP+++     +    +                    E ++    +R    Y  N+P 
Sbjct: 301 GRKSPSSSSHEYDSYYNDSAARSDSRKQERSDGVHRQFTEGVVG-GGERSNLIYCSNLPF 359

Query: 324 FAQEPDLIPLLQNFGFII--DFKHYPE---KGCCFIKYDTHEQAAVCIVALANFPFQGRN 378
                DL  L    G I   D K+  +    G   ++YD  E A +CI  L N+ + G +
Sbjct: 360 TTARSDLYDLFGTIGQITNTDLKYDSDGKPTGIAIVEYDNIEDADICIDRLNNYTYGGCD 419

Query: 379 LRTGWG 384
           L   +G
Sbjct: 420 LDISYG 425

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 35/85 (41%), Gaps = 1/85 (1%)

Query: 56  GGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHD 115
           GG E S+ ++Y  NL        L   F   G I N  +  D + +    A VEY    D
Sbjct: 344 GGGERSN-LIYCSNLPFTTARSDLYDLFGTIGQITNTDLKYDSDGKPTGIAIVEYDNIED 402

Query: 116 ANVAFQTLDGKQIEGNVIKINWAFQ 140
           A++    L+     G  + I++  +
Sbjct: 403 ADICIDRLNNYTYGGCDLDISYGIR 427

>TBLA0A03300 Chr1 (785613..786701) [1089 bp, 362 aa] {ON} Anc_5.382
           YHR086W
          Length = 362

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%)

Query: 314 TTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALANFP 373
           TT +IG +     E +L  L Q FG I+  K    KGC F++Y+T + A + I  +    
Sbjct: 255 TTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGKGCGFVQYETRKAAELAIHKMKGVS 314

Query: 374 FQGRNLRTGWGK 385
            +   +R  WGK
Sbjct: 315 IKNSKIRLSWGK 326

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAF 120
           ++  +++G L   + E+ L+  FQ  G I  VK+   K        FV+Y     A +A 
Sbjct: 253 TNTTVFIGGLSSLVTENELRSLFQPFGEIVYVKIPFGKGC-----GFVQYETRKAAELAI 307

Query: 121 QTLDGKQIEGNVIKINWA 138
             + G  I+ + I+++W 
Sbjct: 308 HKMKGVSIKNSKIRLSWG 325

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 34/76 (44%), Gaps = 6/76 (7%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
            +F+G L+  V +  L   F+ F   +   + +       +G GFV +  +  A+ A+  
Sbjct: 256 TVFIGGLSSLVTENELRSLFQPFGEIVYVKIPF------GKGCGFVQYETRKAAELAIHK 309

Query: 211 KQGFILNGRAIRINWA 226
            +G  +    IR++W 
Sbjct: 310 MKGVSIKNSKIRLSWG 325

>KNAG0G03260 Chr7 (701431..702036) [606 bp, 201 aa] {ON} Anc_8.797
           YOR319W
          Length = 201

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 54/118 (45%), Gaps = 4/118 (3%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           LYVGN+D  +  + L + F    P+ +++   DK  +    YAFV      DA+ A Q L
Sbjct: 8   LYVGNIDPRVTREQLYELFVQACPVVSLRYPRDKVLQTPQGYAFVGVPSVQDADYAVQLL 67

Query: 124 -DGKQIEGNVIKINWAFQSQHVSSDDT--FNLFVGDLNVDVDDETLTGTFKEFPSFIQ 178
            +   + G  +KI  A      ++D      L+VG L   VD + L   F +F +  +
Sbjct: 68  HNCVTLHGRPLKIRRARPDSAEAADTAPVARLYVGGLAATVDAQQLARVFGKFGALYR 125

>TDEL0B01460 Chr2 (255177..257255) [2079 bp, 692 aa] {ON} Anc_8.491
           YPL043W
          Length = 692

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 1/88 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +  DV DE +   F  F     A ++ D    +SRG+GFVSF+ +D    A
Sbjct: 24  DMKTLFVRSIPADVTDEEMGEFFSNFAPIKHAVIVKDA-QKKSRGFGFVSFAVEDDTLAA 82

Query: 208 MESKQGFILNGRAIRINWASKREPQQHQ 235
           ++  +   L  R +RI+ A +R+  + +
Sbjct: 83  LKEARKTKLKDRLLRIDIAKRRDRNKKK 110

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 37/208 (17%), Positives = 86/208 (41%), Gaps = 27/208 (12%)

Query: 45  QSQVTPVLATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN 104
           +S    V +TK       + L+V ++   + ++ + ++F    PI +  ++ D   +   
Sbjct: 8   ESAKQEVSSTKSNDGLDMKTLFVRSIPADVTDEEMGEFFSNFAPIKHAVIVKDAQKKSRG 67

Query: 105 YAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAF----------QSQHVSSD------- 147
           + FV +    D   A +     +++  +++I+ A           +S+  S D       
Sbjct: 68  FGFVSFAVEDDTLAALKEARKTKLKDRLLRIDIAKRRDRNKKKGEESKPTSEDTESADGP 127

Query: 148 -DTFNLFVGDLNVDV--------DDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSF 198
            D  +L  G   + +        D E L   F  F + ++A +      G+  G+ FV+ 
Sbjct: 128 IDEESLLKGKPKIIIRNMPWSCRDPEKLKNIFSRFGTVVEAKIPKKK-DGKLCGFAFVTM 186

Query: 199 SEQDVAQQAMESKQGFILNGRAIRINWA 226
            +    + A+E+ +   ++GR + +++A
Sbjct: 187 KKLVNCKTAIENSKDLKIDGRKVAVDFA 214

>TBLA0B08010 Chr2 (1910016..1912835) [2820 bp, 939 aa] {ON} Anc_5.76
           YGR250C
          Length = 939

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           NL++  +  D+  + L   F  F   +   ++ D+++G S GYGF+SF     A   +  
Sbjct: 230 NLYIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLITGESLGYGFISFKLGSEASNCINK 289

Query: 211 KQGFILNGRAIRINWASKREPQQ 233
             G  +NG  + IN+  +R+ ++
Sbjct: 290 LNGTAMNGSTLFINYHVERKERE 312

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQTL 123
           LY+  + K +  D LK  F   G + ++K++ D    E   Y F+ +    +A+     L
Sbjct: 231 LYIRGIPKDLTIDDLKPIFDTFGKVLSLKIICDLITGESLGYGFISFKLGSEASNCINKL 290

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF 170
           +G  + G+ + IN+     HV   +   +F  +   + DD    G F
Sbjct: 291 NGTAMNGSTLFINY-----HVERKEREKVFWNNFKENNDDNKFKGIF 332

>KLLA0A08338g Chr1 (736461..738761) [2301 bp, 766 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 766

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 68/150 (45%), Gaps = 4/150 (2%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           L++G+L   + ED L   F       +VK+ VD N +++  Y ++ +  P DA  A    
Sbjct: 140 LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEY 199

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
           +   I G  I++  + ++ +   +   N+F  +L +D    T    + EF  F    ++ 
Sbjct: 200 NYMPIFGREIRMMPSLRNTYFRKNIGTNVFFSNLPLDNTKLTTRVFYDEFKKF--GKILS 257

Query: 184 DMLSGRSRGYGFVSFSEQDVAQQAMESKQG 213
             L  R +  GF+ F     A++A++   G
Sbjct: 258 CKLD-RRKNIGFIYFENDAAAKEAIKQYNG 286

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 45/84 (53%)

Query: 140 QSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFS 199
           Q+  + S+    LF+GDL  +V ++ L   F +F SF    +  D  + +S GYG+++F 
Sbjct: 128 QTNTMKSEKQTALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFG 187

Query: 200 EQDVAQQAMESKQGFILNGRAIRI 223
           +   A+ A++      + GR IR+
Sbjct: 188 DPKDAENAVDEYNYMPIFGREIRM 211

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/171 (19%), Positives = 75/171 (43%), Gaps = 12/171 (7%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           ++V NL    + D L  +F   GP+ +V    D +  ++++AF+ Y +  D   A + L+
Sbjct: 388 IFVKNLPINPSHDNLLNFFSKIGPVKSV-YTSDVSKFDSSWAFITYKRIQDTKTAIEKLN 446

Query: 125 GKQIEGNVIKINWA---------FQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPS 175
           G +     I++            F++    ++    +F+ +L+V  ++E L     +   
Sbjct: 447 GCKYMKRTIEVKKTERHHLEESQFENNTRPNNYKKTVFLTNLSVICNEEFLNFLCGQ-ER 505

Query: 176 FIQAHVMWDMLSGRSRGY-GFVSFSEQDVAQQAMESKQGFILNGRAIRINW 225
                V+      ++  Y G+V  + ++ AQ+  E  +  +L    ++ +W
Sbjct: 506 IKTERVVVRYYEEKTDTYSGYVRCASRNDAQRLFELMENKLLGDSEVKASW 556

>ZYRO0F08294g Chr6 complement(670688..672832) [2145 bp, 714 aa] {ON}
           similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043W NOP4 Nucleolar protein essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis contains four RNA recognition motifs
           (RRMs)
          Length = 714

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +  +  DE L+  F  F     A ++ D  + +SRG+GFVSF+ +D   +A
Sbjct: 25  DMKTLFVRSIPPNTTDEDLSVFFSNFAPIKHAVLVKDK-NQKSRGFGFVSFAVEDDTMEA 83

Query: 208 MESKQGFILNGRAIRINWASKR-------EPQQHQ 235
           ++  +   LNG  +R++ A +R       E  QHQ
Sbjct: 84  LKQARRTKLNGHQVRVDLAKRRHRSGKNDEGAQHQ 118

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 33/198 (16%), Positives = 78/198 (39%), Gaps = 35/198 (17%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + L+V ++     ++ L  +F    PI +  ++ DKN +   + FV +    D   A + 
Sbjct: 27  KTLFVRSIPPNTTDEDLSVFFSNFAPIKHAVLVKDKNQKSRGFGFVSFAVEDDTMEALKQ 86

Query: 123 LDGKQIEGNVIKINWAFQSQHVSSDD--------------------------TFNLFVGD 156
               ++ G+ ++++ A +      +D                             L  G 
Sbjct: 87  ARRTKLNGHQVRVDLAKRRHRSGKNDEGAQHQQQAAEVHIARHNEGDHEDDDEDALLKGK 146

Query: 157 LNVDV--------DDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAM 208
             + +        D E L   F ++   ++A +     +G+ RG+ FV+  +    ++A+
Sbjct: 147 PKIIIRNMPWSCRDPEKLKSIFGKYGLVVEATIPRKP-NGQLRGFAFVTMKKISNCKKAI 205

Query: 209 ESKQGFILNGRAIRINWA 226
           E  +   ++GR + +++A
Sbjct: 206 EDSKNLKIDGRPVAVDFA 223

>NCAS0G01950 Chr7 complement(348633..349847) [1215 bp, 404 aa] {ON}
           Anc_2.80
          Length = 404

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 41/82 (50%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  DE L   F+     ++  +     SG+ +G+ F+ F  ++ A  A++ K
Sbjct: 240 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDK 299

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               +  R IR+ +   R  +Q
Sbjct: 300 TCRKIAARPIRMEYGEDRSKRQ 321

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL     ++ LK++FQ  G I  +++   +++ +   +AF+++     A  A +
Sbjct: 238 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALK 297

Query: 122 TLDGKQIEGNVIKINW 137
               ++I    I++ +
Sbjct: 298 DKTCRKIAARPIRMEY 313

>Smik_8.80 Chr8 (114815..116827) [2013 bp, 670 aa] {ON} YHR015W
           (REAL)
          Length = 670

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 41/72 (56%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+G+L   V +E L   F+++ SF  A +  D L+ +S GYG+++F  ++  + A +  
Sbjct: 123 LFIGNLKPTVTEEMLRKIFRKYQSFESAKICRDFLTKKSLGYGYLNFKNKNETEAARKEF 182

Query: 212 QGFILNGRAIRI 223
              +  G+ ++I
Sbjct: 183 NYTVFFGQEVKI 194

>YOR319W Chr15 (912822..913463) [642 bp, 213 aa] {ON}  HSH49U2-snRNP
           associated splicing factor with similarity to the
           mammalian splicing factor SAP49; proposed to function as
           a U2-snRNP assembly factor along with Hsh155p and
           binding partner Cus1p; contains two RNA recognition
           motifs (RRM)
          Length = 213

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 84/180 (46%), Gaps = 13/180 (7%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVA 119
           S   +YVGN+D  I ++ L + F    P+  +K   DK  +    YAF+E++   DA  A
Sbjct: 7   SGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYA 66

Query: 120 FQTLDGK-QIEGNVIKINWAFQS-------QHVSSDDTF---NLFVGDLNVDVDDETLTG 168
            + ++   ++   +IK+     S        ++S D       LF+ +L   +D + L  
Sbjct: 67  IKIMNNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQLVK 126

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F +F   I+   ++ + +G+ +   +V F + + A  A++S    ++    I +++A K
Sbjct: 127 IFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITVDYAFK 185

>Suva_7.546 Chr7 complement(946681..949020) [2340 bp, 779 aa] {ON}
           YGR250C (REAL)
          Length = 779

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 93/220 (42%), Gaps = 58/220 (26%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQTL 123
           ++VG + K+++   L   F   GP+ ++K++ DK   E N Y F  Y     A++  + L
Sbjct: 197 IFVGGIAKSLSIGELSFLFSKYGPVLSMKLIYDKTKGEPNGYGFFSYPLGSQASLCIREL 256

Query: 124 DGKQIEGNVIKINWAFQSQ--------HV---SSDDTFN-LFVGDLN------------- 158
           +GK + G+ + IN+  + +        HV   ++DD +  LF+G+L              
Sbjct: 257 NGKTVSGSTLFINYHVERKERERIHWDHVKENNNDDNYRCLFIGNLPYHNTEKEESLITP 316

Query: 159 ---VDVDDETLTGTFKEFPSF-----------------------IQAHVMWDMLSGRS-- 190
              +DV    L+  F +F                          + ++ + ++ +G +  
Sbjct: 317 KDVIDVIKRELSKRFSDFDIISYYFPKKSNARSSSSVSFQDDGSVDSNKISNITAGAAQE 376

Query: 191 ----RGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
               +GYGF+     + A  A+E   GF+ +G  + +N A
Sbjct: 377 EDMLKGYGFIKLINHEQALAAIEIFNGFMWHGNRLVVNKA 416

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 39/83 (46%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           N+FVG +   +    L+  F ++   +   +++D   G   GYGF S+     A   +  
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPVLSMKLIYDKTKGEPNGYGFFSYPLGSQASLCIRE 255

Query: 211 KQGFILNGRAIRINWASKREPQQ 233
             G  ++G  + IN+  +R+ ++
Sbjct: 256 LNGKTVSGSTLFINYHVERKERE 278

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 20/99 (20%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVM-------------------WDMLSGRSR 191
           NL+V  + +   DE L G +K F   I   V+                    D+  G SR
Sbjct: 541 NLYVKHIPLSWTDEDLYGFYKTFGEIISVKVITVGGSKNKYRQQSNDSSSDSDLPVGSSR 600

Query: 192 GYGFVSFSEQDVAQQAMESKQGF-ILNGRAIRINWASKR 229
           GYGFVSF     A +A+ +  G+ +   + + +++A KR
Sbjct: 601 GYGFVSFESPLDAAKAISNTDGYQVSKDQVLSVSFAQKR 639

>Ecym_2541 Chr2 complement(1049892..1051919) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL250W
          Length = 675

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV ++     D  LT  F +F     A ++ D   G SRG+GFVSF+  +  Q A
Sbjct: 14  DQKTLFVRNIPFTATDAELTDFFSQFAPLKHAIIVKDG-DGNSRGFGFVSFAVDEDTQTA 72

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           +   +     GR +R++ A +RE
Sbjct: 73  LNEGRKMKFQGRLLRVDIAKRRE 95

>Kwal_23.5864 s23 (1347244..1348080) [837 bp, 278 aa] {ON} YIL061C
           (SNP1) - U1snRNP 70K protein homolog [contig 11] FULL
          Length = 278

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 8/109 (7%)

Query: 124 DGKQIEGNVIKINWAF-----QSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQ 178
           + +QIE + +K   +       +  V SD    +FVG L   V +  L   F  F    +
Sbjct: 70  NARQIEADALKEKLSHWHPNEDANIVGSDPYRTVFVGRLPYTVTEVELQKEFVRFGEIEK 129

Query: 179 AHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES---KQGFILNGRAIRIN 224
             V+ D  S +SRGYGF+ F E+  A+ A       +G  + GR + ++
Sbjct: 130 VRVVRDKTSNKSRGYGFIMFKEELFARTACREIGVHRGVEIGGRPVIVD 178

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQ 121
           R ++VG L   + E  L++ F   G I  V+V+ DK +N+   Y F+ + +   A  A +
Sbjct: 101 RTVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACR 160

Query: 122 TL---DGKQIEGNVIKIN 136
            +    G +I G  + ++
Sbjct: 161 EIGVHRGVEIGGRPVIVD 178

>TDEL0F00680 Chr6 complement(114474..115640) [1167 bp, 388 aa] {ON}
           Anc_2.80 YNL175C
          Length = 388

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  DE L   F+     ++  +     SG+ +G+ FV F +++ A  A++ K
Sbjct: 223 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKDEEGATNALKDK 282

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               +  R IR+ +   R  +Q
Sbjct: 283 GCRKIAQRPIRMEYGEDRSKRQ 304

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL     ++ LK++FQ  G I  +++   +++ +   +AFV++     A  A +
Sbjct: 221 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKDEEGATNALK 280

Query: 122 TLDGKQIEGNVIKINW 137
               ++I    I++ +
Sbjct: 281 DKGCRKIAQRPIRMEY 296

>ZYRO0F16214g Chr6 (1331671..1332663) [993 bp, 330 aa] {ON}
           conserved hypothetical protein
          Length = 330

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 41/75 (54%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+  LN     + +   F+ F +     ++ D  +G S GYGF+ F+++   +QA +  
Sbjct: 244 LFICKLNPLTRAKDIATIFQRFGAIASVEIVRDKSTGHSLGYGFIQFTDRKSCEQAYKKM 303

Query: 212 QGFILNGRAIRINWA 226
           +G I++ R I ++++
Sbjct: 304 EGVIIDDRRIHVDFS 318

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 57  GRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNN-EEANYAFVEYHQPHD 115
           G + S R+L++  L+       +   FQ  G IA+V+++ DK+      Y F+++     
Sbjct: 236 GIKPSPRVLFICKLNPLTRAKDIATIFQRFGAIASVEIVRDKSTGHSLGYGFIQFTDRKS 295

Query: 116 ANVAFQTLDGKQIEGNVIKINWA 138
              A++ ++G  I+   I ++++
Sbjct: 296 CEQAYKKMEGVIIDDRRIHVDFS 318

>Suva_14.166 Chr14 complement(303573..304784) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ DV D+ L   F+     ++  +     SG+ +G+ F+ F  ++ +  A++ K
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               + GR +R+ +   R  +Q
Sbjct: 301 SCRKIAGRPLRMEYGEDRSKRQ 322

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL   + +D L+++FQ  G I  +++   +++ +   +AF+++     +  A +
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  +++ +
Sbjct: 299 DKSCRKIAGRPLRMEY 314

>YNL175C Chr14 complement(307401..308612) [1212 bp, 403 aa] {ON}
           NOP13Nucleolar protein found in preribosomal complexes;
           contains an RNA recognition motif (RRM)
          Length = 403

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ DV D+ L   F+     ++  +     SG+ +G+ F+ F  ++ +  A++ K
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               + GR +R+ +   R  +Q
Sbjct: 301 SCRKIAGRPLRMEYGEDRSKRQ 322

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLV-DKNNEEANYAFVEYHQPHDANVAFQ 121
           RIL+VGNL   + +D L+++FQ  G I  +++   + + +   +AF+++     +  A +
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  +++ +
Sbjct: 299 DKSCRKIAGRPLRMEY 314

>YIR005W Chr9 (364889..365335) [447 bp, 148 aa] {ON}  IST3Component
           of the U2 snRNP, required for the first catalytic step
           of splicing and for spliceosomal assembly; interacts
           with Rds3p and is required for Mer1p-activated splicing
          Length = 148

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 61/118 (51%), Gaps = 6/118 (5%)

Query: 120 FQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQA 179
            Q ++ K+++  ++      QS H    D   +++G+LN ++ +  +   F E+   +  
Sbjct: 4   IQQINDKELQSGILS---PHQSWHNEYKDNAYIYIGNLNRELTEGDILTVFSEYGVPVDV 60

Query: 180 HVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRIN---WASKREPQQH 234
            +  D  +G S+G+ ++ + +Q     A+++  GF + GRA++I+   +  KR  Q++
Sbjct: 61  ILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYRPKRSLQKY 118

 Score = 36.6 bits (83), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 65  LYVGNLDKAINE-DTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTL 123
           +Y+GNL++ + E D L  + + G P+  +    +   E   +A+++Y       +A   L
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 124 DGKQIEGNVIKINWAF 139
           +G +I G  +KI+  F
Sbjct: 93  NGFKIGGRALKIDHTF 108

>NDAI0G05970 Chr7 complement(1475760..1477595) [1836 bp, 611 aa]
           {ON} Anc_1.357 YFR023W
          Length = 611

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 69/161 (42%), Gaps = 10/161 (6%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQTL 123
           LY+G L K + E+TL + F+    +A++K+  D   NE   Y ++ +    +A       
Sbjct: 103 LYIGGLSKDVTEETLFEAFEDYKTLASIKICRDSVTNESLGYGYLNFSNSVEATKLIDDY 162

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDL---NVDVDDETLTGTFKEFPSFIQAH 180
           +   + GN IKI  + ++     +   N+F  +L   N  +       TFK++       
Sbjct: 163 NYTNLFGNEIKIMPSMRNTLYRKNIGTNVFFSNLPLENKQLTTRKFYDTFKKY-----GE 217

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAI 221
           ++   L  R +  GFV F     A QA++     +  G  I
Sbjct: 218 ILSCKLDSR-KNIGFVYFENDKAALQAIKDYNNKVFFGNKI 257

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 39/72 (54%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           L++G L+ DV +ETL   F+++ +     +  D ++  S GYG+++FS    A + ++  
Sbjct: 103 LYIGGLSKDVTEETLFEAFEDYKTLASIKICRDSVTNESLGYGYLNFSNSVEATKLIDDY 162

Query: 212 QGFILNGRAIRI 223
               L G  I+I
Sbjct: 163 NYTNLFGNEIKI 174

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 7/77 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANV---KVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           +++ NL    N+D +  +F   GP+ +V   +VL       + +AFV Y +  D  +A Q
Sbjct: 313 VFIKNLPMTTNDDEILDFFSKIGPVKSVFASQVL----KYNSLWAFVTYKKSSDTELAIQ 368

Query: 122 TLDGKQIEGNVIKINWA 138
            LD    +   I +  A
Sbjct: 369 KLDQTYFKDRAISVTKA 385

>Smik_14.155 Chr14 complement(286559..287770) [1212 bp, 403 aa] {ON}
           YNL175C (REAL)
          Length = 403

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 43/82 (52%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ DV D+ L   F+     I+  +     SG+ +G+ F+ F  ++ +  A++ K
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 300

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               + GR +R+ +   R  +Q
Sbjct: 301 GCRKIAGRPLRMEYGEDRSKRQ 322

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLV-DKNNEEANYAFVEYHQPHDANVAFQ 121
           RIL+VGNL   + +D L+++FQ  G I  +++   + + +   +AF+++     +  A +
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIIKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 298

Query: 122 TLDGKQIEGNVIKINWA 138
               ++I G  +++ + 
Sbjct: 299 DKGCRKIAGRPLRMEYG 315

>Skud_14.159 Chr14 complement(298222..299424) [1203 bp, 400 aa] {ON}
           YNL175C (REAL)
          Length = 400

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ DV D+ L   F+     ++  +     SG+ +G+ F+ F  ++ +  A++ K
Sbjct: 238 LFVGNLSFDVTDDLLRKHFQHCGDVVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDK 297

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               + GR +R+ +   R  +Q
Sbjct: 298 SCRKIAGRPLRMEYGEDRSKRQ 319

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL   + +D L+++FQ  G +  +++   +++ +   +AF+++     +  A +
Sbjct: 236 RILFVGNLSFDVTDDLLRKHFQHCGDVVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALK 295

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  +++ +
Sbjct: 296 DKSCRKIAGRPLRMEY 311

>Kpol_1062.7 s1062 (14539..16821) [2283 bp, 760 aa] {ON}
           (14539..16821) [2283 nt, 761 aa]
          Length = 760

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 2/116 (1%)

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI 177
           VA   LD  + +  V   NW+      +     NL++  +  D+  + L   F  F   I
Sbjct: 112 VASILLDKTKSQDGVT--NWSVSINEHALTHPGNLYIKGIPKDLSIDDLVPVFSTFGDII 169

Query: 178 QAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQ 233
              ++ D ++G S GYGF+S+     +   M    G I+NG  + IN+  +R+ ++
Sbjct: 170 SMKIIQDSITGISLGYGFLSYRLGSQSSSCMSKLNGQIMNGSTLFINYHVERKERE 225

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 45/107 (42%), Gaps = 6/107 (5%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQTL 123
           LY+  + K ++ D L   F   G I ++K++ D        Y F+ Y     ++     L
Sbjct: 144 LYIKGIPKDLSIDDLVPVFSTFGDIISMKIIQDSITGISLGYGFLSYRLGSQSSSCMSKL 203

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF 170
           +G+ + G+ + IN+     HV   +   ++      + D +   G F
Sbjct: 204 NGQIMNGSTLFINY-----HVERKERERIYWDHFKENTDSKKFRGVF 245

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 23/43 (53%)

Query: 191 RGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKREPQQ 233
           +GYGF+ FS  + A  A+E  + F   G  + +N A + +P  
Sbjct: 335 KGYGFIKFSNHEYAVLAIEKFKEFEWFGHKLTVNKAIQNKPHH 377

>TPHA0F02310 Chr6 (507306..508508) [1203 bp, 400 aa] {ON} Anc_2.80
           YNL175C
          Length = 400

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  DE L   F+     ++  +     SG+ +G+ FV F  ++ A +A+  K
Sbjct: 235 LFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALSDK 294

Query: 212 QGFILNGRAIRINWASKREPQ 232
               + GR +R+ +   R  +
Sbjct: 295 SCRKIAGRPLRMEFGEDRSKR 315

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL     ++ L+++FQ  G I  +++   +++ +   +AFV++     A  A  
Sbjct: 233 RILFVGNLSFDTTDELLRKHFQHCGDIVKIRMATFQDSGKCKGFAFVDFKNEEGATKALS 292

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  +++ +
Sbjct: 293 DKSCRKIAGRPLRMEF 308

>Kwal_56.24709 s56 complement(1113983..1116469) [2487 bp, 828 aa]
           {ON} YGR250C - Hypothetical ORF [contig 160] FULL
          Length = 828

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 45/83 (54%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           NL+V  +  D+  + L   F +F   +   ++ D  SG S GYGF+S+     A + ++ 
Sbjct: 242 NLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKE 301

Query: 211 KQGFILNGRAIRINWASKREPQQ 233
             G ++NG A+ IN+  +R+ ++
Sbjct: 302 LNGNLMNGSALFINYHVERKERE 324

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 6/107 (5%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           LYV  + K +  D L   F   GP+ ++K++ D ++ ++  Y F+ Y     A+   + L
Sbjct: 243 LYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKEL 302

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF 170
           +G  + G+ + IN+     HV   +   +       D DD+   G F
Sbjct: 303 NGNLMNGSALFINY-----HVERKERERIHWDHFKEDNDDDRFKGVF 344

>TBLA0B00810 Chr2 complement(175882..177051) [1170 bp, 389 aa] {ON}
           Anc_2.80 YNL175C
          Length = 389

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  DE L   F+     ++        +G+ +G+ F+ F  ++ A +A++ K
Sbjct: 224 LFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALKDK 283

Query: 212 QGFILNGRAIRINWASKR 229
               + GR IR+ +   R
Sbjct: 284 SCRKIAGRPIRMEYGEDR 301

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL     ++ L+ +FQ  G I  ++    ++  +   ++F+++     A  A +
Sbjct: 222 RILFVGNLSYDTTDELLRSHFQHCGEIVKIRTATFEDTGKCKGFSFIDFLTEESATKALK 281

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  I++ +
Sbjct: 282 DKSCRKIAGRPIRMEY 297

>KLLA0D05016g Chr4 complement(431592..432911,433342..433353) [1332
           bp, 443 aa] {ON} similar to uniprot|P38922 Saccharomyces
           cerevisiae YNL004W
          Length = 443

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 63/344 (18%), Positives = 114/344 (33%), Gaps = 67/344 (19%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           +++GNL      + LK+YF   G +    ++  + +       VE++   D + A +  D
Sbjct: 143 IFIGNLTYNTTPEDLKEYFGKIGEVRRADIITSRGHHRG-MGTVEFNNSTDVDTAIRDCD 201

Query: 125 GKQIEGNVIKIN----------------WAFQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
           G  + G  I +                         + D+ F +FV  L   V+ + L  
Sbjct: 202 GAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDEGFEVFVAQLPFSVNWQELKD 261

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            FK     + A V+ D   G+SRG+G V  + ++    A+    G    GR + +     
Sbjct: 262 MFKPCGDVLHADVVTDR-DGKSRGFGTVYMATKEQQNDAIRHWTGTEYKGRVLDVKEGKG 320

Query: 229 REPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQGHPMGSPNNAGPMGMAPQGMAXXXXXX 288
              +                          IP+      P N  P  + P+ +       
Sbjct: 321 TSTRTAATGADTY-----------------IPR-----QPRNEPPATLKPKPLDID---- 354

Query: 289 XXXXXXXXXXXXAVEAMIRRAPQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFK---- 344
                            I     R +  +  N+P    E DL  L  +   +I  K    
Sbjct: 355 --------------PLAITTGGDRNSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLN 400

Query: 345 ---HYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGK 385
              H+     C  +++T E A +CI  L  + +    L+  + +
Sbjct: 401 PEGHFTRNSYC--QFETPEDADICISKLDKYSYGDHELKVTYAR 442

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           ++F+G+L  +   E L   F +     +A ++     G  RG G V F+       A+  
Sbjct: 142 SIFIGNLTYNTTPEDLKEYFGKIGEVRRADII--TSRGHHRGMGTVEFNNSTDVDTAIRD 199

Query: 211 KQGFILNGRAI 221
             G  LNGRAI
Sbjct: 200 CDGAFLNGRAI 210

>SAKL0H11330g Chr8 (972836..974929) [2094 bp, 697 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs)
          Length = 697

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +  D +DE     F +F     + ++ D    +SRG+GFVSF+ +D  ++A
Sbjct: 24  DMKTLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDS-EKQSRGFGFVSFAVEDDTKEA 82

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           +   +      R +RI+ A +RE
Sbjct: 83  LAQARKAKFKNRLLRIDIAKRRE 105

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 84/210 (40%), Gaps = 30/210 (14%)

Query: 46  SQVTPVLATKGGRETSD-------RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK 98
           S+VT V   K G + S        + L+V ++    N++    +F    PI +  ++ D 
Sbjct: 2   SEVTSVKPGKDGLKQSPNDDGLDMKTLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDS 61

Query: 99  NNEEANYAFVEYHQPHDANVAFQTLDGKQIEGNVIKINWAF------------QSQHVSS 146
             +   + FV +    D   A       + +  +++I+ A             +S+H S 
Sbjct: 62  EKQSRGFGFVSFAVEDDTKEALAQARKAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSY 121

Query: 147 DDT--FNLFVGDLNVDV--------DDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFV 196
            ++    L  G   + +        D   L   F  F + ++A +      G+  G+ FV
Sbjct: 122 KESNEEELMKGKPKLIIRNMPWSCRDAAVLKKLFSRFGTVVEAKIP-KKAGGKLCGFAFV 180

Query: 197 SFSEQDVAQQAMESKQGFILNGRAIRINWA 226
           +  +    ++A+E  +   ++GR + I++A
Sbjct: 181 TMKKLSACKRAIEEGKDMKIDGRQVAIDFA 210

>Kpol_1041.4 s1041 (12746..13900) [1155 bp, 384 aa] {ON}
           (12746..13900) [1155 nt, 385 aa]
          Length = 384

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  D+ L   F+     I+  +     +G+ +G+ FV F  ++ A +A+  K
Sbjct: 224 LFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALTDK 283

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               + GR +R+ +   R  +Q
Sbjct: 284 SCRKIAGRPLRMEFGEDRSKRQ 305

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL     +D L+++FQ  G I  +++   ++  +   +AFV++     A  A  
Sbjct: 222 RILFVGNLSFDTTDDLLRKHFQHCGEIIKIRMATFQDTGKCKGFAFVDFKNEEGATKALT 281

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  +++ +
Sbjct: 282 DKSCRKIAGRPLRMEF 297

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 7/83 (8%)

Query: 309 APQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCI-- 366
           AP R  T Y+GNIP F     L+  +++ G I + K  P++ C FI +   E +A+    
Sbjct: 158 APSR--TVYLGNIPPFLPAKQLLDHVRS-GVIEELKILPDRMCAFISF-VDESSALLFHS 213

Query: 367 -VALANFPFQGRNLRTGWGKEKP 388
              L     +GR+++ GWGK  P
Sbjct: 214 DAILKRLNIEGRDIKVGWGKPTP 236

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 59/131 (45%), Gaps = 25/131 (19%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDAN--VA 119
           +R +Y+GNL K +  + +    + GG + +VK+L D++       FV +  P  A    A
Sbjct: 400 NRTVYLGNLPKDVKIEEICNAVR-GGLLQSVKLLSDRH-----VCFVTFIDPTAAAQFYA 453

Query: 120 FQTLDGKQIEGNVIKINWAFQSQH--------VSSDDTFNLFVGDLNVDVDDET------ 165
             +L G  I     KI W   S          VS   + N++VG+++ +  DET      
Sbjct: 454 MSSLHGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAIDETGETIFT 513

Query: 166 ---LTGTFKEF 173
              L  TF+EF
Sbjct: 514 EQNLRETFQEF 524

 Score = 37.4 bits (85), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 14/87 (16%)

Query: 317 YIGNIPHFA---------QEPDLIPLLQNFGFI--IDFKHYPEKGCCFIKYDTHEQAAVC 365
           Y+GNI   A          E +L    Q FG +  I+F H  EK CCFI +     A + 
Sbjct: 495 YVGNIDFNAIDETGETIFTEQNLRETFQEFGEVEQINFLH--EKNCCFINFTNISNAILA 552

Query: 366 IVALANFPFQGRNLRTGWGKEKPAFIP 392
           I  +   P+  +NL+  +GK++   +P
Sbjct: 553 IDKIKCNPY-FKNLKVNFGKDRCGNVP 578

>TBLA0J01830 Chr10 complement(418200..418622) [423 bp, 140 aa] {ON}
           Anc_7.159 YIR005W
          Length = 140

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 49/86 (56%), Gaps = 3/86 (3%)

Query: 65  LYVGNLDKAINE-DTLKQYFQVGGPIANVKVLVDKN-NEEANYAFVEYHQPHDANVAFQT 122
           +++GNL+K + E D L  + Q G PI ++K++ +K  N    +A+++Y       +A   
Sbjct: 36  IFIGNLNKNLTEGDILTVFSQFGNPI-DLKLIRNKQTNHSMGFAYLKYEDSRSCILAIDN 94

Query: 123 LDGKQIEGNVIKINWAFQSQHVSSDD 148
           L+G ++ GN +KI+  +   + + +D
Sbjct: 95  LNGSKVAGNTLKIDHFWHDPNKNKND 120

 Score = 35.8 bits (81), Expect = 0.064,   Method: Composition-based stats.
 Identities = 20/104 (19%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 121 QTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAH 180
           Q L+  +++ N++ I    +S H +  D   +F+G+LN ++ +  +   F +F + I   
Sbjct: 8   QQLNDTELQNNILSIE---KSWHYNYIDYGYIFIGNLNKNLTEGDILTVFSQFGNPIDLK 64

Query: 181 VMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRIN 224
           ++ +  +  S G+ ++ + +      A+++  G  + G  ++I+
Sbjct: 65  LIRNKQTNHSMGFAYLKYEDSRSCILAIDNLNGSKVAGNTLKID 108

>KLTH0C04268g Chr3 (367879..369231) [1353 bp, 450 aa] {ON} similar
           to uniprot|P49960 Saccharomyces cerevisiae YMR268C PRP24
           Splicing factor that reanneals U4 and U6 snRNPs during
           spliceosome recycling
          Length = 450

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/190 (20%), Positives = 83/190 (43%), Gaps = 20/190 (10%)

Query: 59  ETSDRILYVGNLDKAINEDTLKQYF-QVGGPIANVKVLVDKNNEEANYAFVEYHQPHDAN 117
           E S   L+  N     ++  L Q F Q GG + +V++   + +    +A+++     +A+
Sbjct: 113 ELSKSTLWATNFPPTYDQGKLMQLFGQFGGTVLSVRLPSLRFDSRRRFAYIDMASKQEAS 172

Query: 118 VAFQTLDGKQIEGNVIKINWAFQSQHVSSDDTF-----NLFVGDLNVDVDDETLTGTFKE 172
           +A + LDG +IE   + +  +  S   +  D        + V +LN + ++  L+  F +
Sbjct: 173 LALEKLDGVEIENYKMIVKLSQPSNAAARTDKAVIERRQVLVRNLNYNTNEAALSAIFAK 232

Query: 173 FPSFIQAHV-------------MWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGR 219
           F    Q ++               +     + G+ F++FS+   A+ ++ S  G  ++ R
Sbjct: 233 FGHVEQINLPRTRENKHGEIDTKGETKERLNEGFAFITFSDASCARSSL-SLNGTEIDNR 291

Query: 220 AIRINWASKR 229
            + +  A +R
Sbjct: 292 ILDVTLADRR 301

>Smik_15.500 Chr15 (862344..862985) [642 bp, 213 aa] {ON} YOR319W
           (REAL)
          Length = 213

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 79/180 (43%), Gaps = 13/180 (7%)

Query: 61  SDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKN-NEEANYAFVEYHQPHDANVA 119
           S   +YVGNLD  I ++ L + F    P+  +K   DK       YAF+E++   DA   
Sbjct: 7   SGNTVYVGNLDPRITKEQLYELFIQINPVLRIKYPKDKVLQTHQGYAFIEFYNREDAQYV 66

Query: 120 FQTLDG-----------KQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTG 168
            Q +             +Q+  ++   N A  S    +     LF+ +L   ++ + LT 
Sbjct: 67  IQIMHNTVKLYDRLIKVRQVTSSIGTSNLASNSSRDITLPVAKLFIKNLADSINCDQLTK 126

Query: 169 TFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
            F +F   I    ++ + +G+ +   +V F + + A  A++S    ++    I +++A K
Sbjct: 127 IFNKFGRTISEPKIFHLSNGKLKC-AYVYFEDFEKADLAIKSLDNQLVANSRINVDYAFK 185

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 49  TPVLATKGGRETSDRI--LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYA 106
           T  LA+   R+ +  +  L++ NL  +IN D L + F   G   +   +   +N +   A
Sbjct: 92  TSNLASNSSRDITLPVAKLFIKNLADSINCDQLTKIFNKFGRTISEPKIFHLSNGKLKCA 151

Query: 107 FVEYHQPHDANVAFQTLDGKQIEGNVIKINWAFQ 140
           +V +     A++A ++LD + +  + I +++AF+
Sbjct: 152 YVYFEDFEKADLAIKSLDNQLVANSRINVDYAFK 185

>TDEL0A03990 Chr1 complement(713693..714529) [837 bp, 278 aa] {ON}
           Anc_5.536 YDR429C
          Length = 278

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 147 DDTFNLFVGDLNVDVDDETLTGT----FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           DD   L +  LN + D+ TL       F   P  +   V+ +  +GRSRG  FV+F+ ++
Sbjct: 189 DDMATLKITQLNENADENTLREELLFPFAPIPKVV---VVRNRETGRSRGLSFVTFASEE 245

Query: 203 VAQQAMESKQGFILNGRAIRINWASKREPQ 232
           +A+QA+    G       +R+ W+  + P+
Sbjct: 246 IAEQALHFLDGRGFMNLILRVEWSKPKVPE 275

>Kwal_33.14463 s33 complement(685488..686669) [1182 bp, 393 aa] {ON}
           YNL175C (NOP13) - nucleolar protein [contig 103] FULL
          Length = 393

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 42/82 (51%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  DE L   F+     ++  +     +G+ +G+ FV F +++    A++ K
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               + GR +R+ +   R  +Q
Sbjct: 297 TCRKIAGRPLRMEFGEDRSKRQ 318

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL     ++ LK++FQ  G I  +++   ++  +   +AFV++        A +
Sbjct: 235 RILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALK 294

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  +++ +
Sbjct: 295 DKTCRKIAGRPLRMEF 310

>SAKL0C03234g Chr3 complement(306710..307732) [1023 bp, 340 aa] {ON}
           conserved hypothetical protein
          Length = 340

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFV  LN     + L   F  F   +   ++ D  +G S GYGF+ FSEQ   + A    
Sbjct: 246 LFVCKLNPMTRAQDLAVIFHRFGEIVSVEIVRDKDTGGSLGYGFIEFSEQKACELAYSKM 305

Query: 212 QGFILNGRAIRINWA 226
            G +++ R I ++++
Sbjct: 306 DGVLVDDRRIHVDFS 320

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNE-EANYAFVEYHQPHDANVAFQT 122
           +L+V  L+       L   F   G I +V+++ DK+      Y F+E+ +     +A+  
Sbjct: 245 VLFVCKLNPMTRAQDLAVIFHRFGEIVSVEIVRDKDTGGSLGYGFIEFSEQKACELAYSK 304

Query: 123 LDGKQIEGNVIKINWAFQSQHVS 145
           +DG  ++   I +++   SQ VS
Sbjct: 305 MDGVLVDDRRIHVDF---SQSVS 324

>SAKL0E12738g Chr5 (1052695..1053885) [1191 bp, 396 aa] {ON} similar
           to uniprot|P53883 Saccharomyces cerevisiae YNL175C
          Length = 396

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  DE L   F+     ++  +     SG+ +G+ F+ F ++    +A+  K
Sbjct: 231 LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDK 290

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               + GR +R+ +   R  +Q
Sbjct: 291 SCRKIAGRPLRMEFGEDRSKRQ 312

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL     ++ L+++FQ  G I  V++   +++ +   +AF+++        A  
Sbjct: 229 RILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALT 288

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  +++ +
Sbjct: 289 DKSCRKIAGRPLRMEF 304

>Kwal_27.11832 s27 complement(966449..968509) [2061 bp, 686 aa] {ON}
           YPL043W (NOP4) - RNA recognition motif-containing
           protein [contig 27] FULL
          Length = 686

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +  D  DE L   F        A ++ D     SRG+GFVSF+ +D  + A
Sbjct: 19  DMKTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKN-SRGFGFVSFAVEDDTKDA 77

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           ++  +     GR +R++ A +R+
Sbjct: 78  LDKARKTKFKGRLLRVDIAKRRD 100

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 34/192 (17%), Positives = 71/192 (36%), Gaps = 34/192 (17%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + L+V ++     ++ L  YF    PI +  ++ D       + FV +    D   A   
Sbjct: 21  KTLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDK 80

Query: 123 LDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNV----DVDDETLTGTFKEFPSFIQ 178
               + +G +++++ A +      D   N   G  +     D +DE L G     P  I 
Sbjct: 81  ARKTKFKGRLLRVDIAKRRDRTKKDQ--NAAAGSEDTSGPQDKEDELLGGK----PKLIV 134

Query: 179 AHVMWDMLS------------------------GRSRGYGFVSFSEQDVAQQAMESKQGF 214
            ++ W + +                        G+  G+ FV+  +    + A+E  +  
Sbjct: 135 RNMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSL 194

Query: 215 ILNGRAIRINWA 226
            + GR + +++A
Sbjct: 195 KIGGRQVAVDFA 206

>ZYRO0G07216g Chr7 (568877..569692) [816 bp, 271 aa] {ON} similar to
           uniprot|P25299 Saccharomyces cerevisiae YGL044C RNA15
           Cleavage and polyadenylation factor I (CF I) component
           involved in cleavage and polyadenylation of mRNA 3' ends
           interacts with the A-rich polyadenylation signal in
           complex with Rna14p and Hrp1p
          Length = 271

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 54  TKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQ 112
           T GG+    R++Y+G++     E+ +       GP+ N+K++ D +  +   YAFVEY  
Sbjct: 4   TSGGQHLPSRVVYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEYKD 63

Query: 113 PHDANVAFQTLDGKQIEGNVIKINWA 138
              +  A + L+G Q    ++K  +A
Sbjct: 64  LESSASAVRNLNGYQFGSRLLKCGYA 89

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 8/81 (9%)

Query: 310 PQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHY------PEKGCCFIKYDTHEQAA 363
           P RV   Y+G+IP+   E  ++ L  N G + + K          KG  F++Y   E +A
Sbjct: 11  PSRV--VYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEYKDLESSA 68

Query: 364 VCIVALANFPFQGRNLRTGWG 384
             +  L  + F  R L+ G+ 
Sbjct: 69  SAVRNLNGYQFGSRLLKCGYA 89

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 15/76 (19%), Positives = 37/76 (48%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +++G +  D  +E +              +M+D  +G+S+GY FV + + + +  A+ + 
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVNNLKMMFDPQTGKSKGYAFVEYKDLESSASAVRNL 74

Query: 212 QGFILNGRAIRINWAS 227
            G+    R ++  +A+
Sbjct: 75  NGYQFGSRLLKCGYAT 90

>ZYRO0F12716g Chr6 (1035111..1035743) [633 bp, 210 aa] {ON} similar
           to uniprot|Q99181 Saccharomyces cerevisiae YOR319W
          Length = 210

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 88/193 (45%), Gaps = 14/193 (7%)

Query: 52  LATKGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNE-EANYAFVEY 110
           +++   R+TS   +YVGN+D  + +  L + F    PI  ++   DK  +    YAFVE+
Sbjct: 1   MSSNSNRDTS---IYVGNIDPKVTKAQLYELFVQISPIRRIRYPKDKVLQIHQGYAFVEF 57

Query: 111 HQPHDANVAFQTLDG-KQIEGNVIKI--------NWAFQSQHVSSDDTFNLFVGDLNVDV 161
           +   D     + ++    +    ++I        N +  ++ +S      +FV +++  +
Sbjct: 58  YSVEDVQYVLRVMNNVVSLYDRTLRIRRVNGPGTNNSVNAKELSLLPLAKVFVKNVDESI 117

Query: 162 DDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAI 221
           D+  L+  F +F        ++ +  G+ R   FV F +   +  A++S    ++  R I
Sbjct: 118 DNVHLSKIFGKFGPLASLPEIFYLSHGQLRC-AFVYFRDYTHSDAAIKSLDNQLVVNRRI 176

Query: 222 RINWASKREPQQH 234
            +++A K   QQ+
Sbjct: 177 NLDYAIKENSQQN 189

>KLLA0C08019g Chr3 complement(704199..705104) [906 bp, 301 aa] {ON}
           weakly similar to uniprot|Q00916 Saccharomyces
           cerevisiae YIL061C SNP1 U1snRNP 70K protein homolog,
          Length = 301

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 4/80 (5%)

Query: 144 VSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDV 203
           +SSD    LFVG L+  VD+  L  +F ++       ++ D   G+SRGYGFV F+  + 
Sbjct: 109 ISSDPYRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQ-DGKSRGYGFVQFTSYED 167

Query: 204 AQQAMES---KQGFILNGRA 220
           ++Q       ++G  + GR 
Sbjct: 168 SKQCFRELGVRKGIEIMGRT 187

>ABL134C Chr2 complement(140623..141750) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL175C
           (NOP13)
          Length = 375

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  DE L   F+     ++  +     SG+ +G+ FV F ++  A  A+  +
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 212 QGFILNGRAIRINWASKR 229
               + GR +R+ +   R
Sbjct: 278 SCRAIAGRPLRMEYGEDR 295

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL     ++ LK++FQ  G I  +++   +++ +   +AFV++     A  A  
Sbjct: 216 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALT 275

Query: 122 TLDGKQIEGNVIKINWA--FQSQHVSS 146
               + I G  +++ +      +HV S
Sbjct: 276 DRSCRAIAGRPLRMEYGEDRSKRHVRS 302

>KAFR0H03110 Chr8 complement(593465..594760,595029..595058) [1326
           bp, 441 aa] {ON} Anc_1.408 YNL004W intron location
           uncertain
          Length = 441

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 44/76 (57%), Gaps = 1/76 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D F +FV +L   V+ + L   FK   + ++A V  D + GRSRG+G V FS Q+  ++A
Sbjct: 240 DGFEIFVANLPFSVNWQALKDMFKPCGNVLRADVELDHV-GRSRGFGTVLFSNQEDMRRA 298

Query: 208 MESKQGFILNGRAIRI 223
           ++   G+ + GR + +
Sbjct: 299 IDDYNGYEIEGRRLDV 314

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 7/83 (8%)

Query: 311 QRVTTAYIGNIPHFAQEPDLIPLLQNFGFII------DFKHYPEKGCCFIKYDTHEQAAV 364
           +R    Y  N+P      DL  L +  G +I      D  + P  G   I+Y+  E A V
Sbjct: 360 ERNNFIYCSNLPFSTDRSDLYDLFETIGKVINAELRYDSANQP-TGVAVIEYENIEDADV 418

Query: 365 CIVALANFPFQGRNLRTGWGKEK 387
           CI  L N+ + G +L   + K++
Sbjct: 419 CIERLNNYNYGGCDLVISYAKKE 441

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 34/75 (45%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTL 123
            +Y  NL  + +   L   F+  G + N ++  D  N+    A +EY    DA+V  + L
Sbjct: 364 FIYCSNLPFSTDRSDLYDLFETIGKVINAELRYDSANQPTGVAVIEYENIEDADVCIERL 423

Query: 124 DGKQIEGNVIKINWA 138
           +     G  + I++A
Sbjct: 424 NNYNYGGCDLVISYA 438

>CAGL0L12672g Chr12 complement(1361933..1363981) [2049 bp, 682 aa]
           {ON} similar to uniprot|P37838 Saccharomyces cerevisiae
           YPL043w nucleolar protein
          Length = 682

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +   V DE L   F  F     A V+ D ++ +SRG+GFVSF+ +D  + A
Sbjct: 20  DMKTLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKD-VNKKSRGFGFVSFAVEDDTKIA 78

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           ++  +   L+G  ++++ A +R+
Sbjct: 79  LKEARKTKLDGAQLKVDIARRRD 101

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/199 (16%), Positives = 80/199 (40%), Gaps = 35/199 (17%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + L+V ++ +++ ++ L  +F    PI +  V+ D N +   + FV +    D  +A + 
Sbjct: 22  KTLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKE 81

Query: 123 LDGKQIEGNVIKINWAFQSQHVSSDD-----------TFNLFVGDLNVDVDDETLTGTFK 171
               +++G  +K++ A +      ++           +     GD N +  +E  +   K
Sbjct: 82  ARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLK 141

Query: 172 EFPSFIQAHVMWDM------------------------LSGRSRGYGFVSFSEQDVAQQA 207
             P  I  ++ W                            G+  G+ FV+ ++    ++A
Sbjct: 142 GKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKA 201

Query: 208 MESKQGFILNGRAIRINWA 226
           +E  +   ++GR + +++A
Sbjct: 202 LEDTKNLTIDGRKVAVDFA 220

>Kpol_1023.95 s1023 (221318..222142) [825 bp, 274 aa] {ON}
           (221318..222142) [825 nt, 275 aa]
          Length = 274

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 17/95 (17%)

Query: 147 DDTFNLFVGDLNVDVDDETLTGT----FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQD 202
           DD   L +  LN + D+ TL       F   P  +   V+ +  +GRSRG  FV+FS ++
Sbjct: 188 DDMATLKITQLNENADETTLREELLFPFGNIPRVV---VVRNRETGRSRGLAFVTFSSEE 244

Query: 203 VAQQAMESKQGFILNGRA-----IRINWASKREPQ 232
           VA++A       +LNGR      ++++W+  +E +
Sbjct: 245 VAEKARR-----LLNGRGFMNLILQVDWSKPKEKE 274

>ADL063W Chr4 (569852..569854,569912..570871) [963 bp, 320 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL061C
           (SNP1); 1-intron
          Length = 320

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 48/90 (53%), Gaps = 5/90 (5%)

Query: 136 NWAFQSQ-HVSSDDTF-NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGY 193
            WA ++  ++   D F  +FVG L+ DVD+  L   F +F    +  ++ D ++ + RGY
Sbjct: 91  KWAPENDTNIQGTDPFRTIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGY 150

Query: 194 GFVSFSEQDVAQQAMES---KQGFILNGRA 220
            FV F + + +++A       +G ++ GR+
Sbjct: 151 AFVLFRDPECSKKAYREIGVHRGLMIRGRS 180

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 309 APQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAV--CI 366
           AP R  T Y+GNIP      +L+  +++ G + D K  PEK C FI +     A +    
Sbjct: 166 APSR--TVYLGNIPTTLTVKELLDHVRS-GVVEDVKILPEKMCAFISFVDDSSALLFHSD 222

Query: 367 VALANFPFQGRNLRTGWGK 385
             L     +GR+++ GWGK
Sbjct: 223 AILKRLNIEGRDIKIGWGK 241

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 39/89 (43%), Gaps = 10/89 (11%)

Query: 316 AYIGNI---------PHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCI 366
            YIGNI              E +L  L Q +G +      P K CCFI Y     A   I
Sbjct: 502 VYIGNIDFEEDSKRNERVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAI 561

Query: 367 VALANFPFQGRNLRTGWGKEKPAFIPNGM 395
             + + P+  ++L+  +GK++   IP+ +
Sbjct: 562 DKIKSNPY-FKDLKINFGKDRCGNIPHQL 589

>SAKL0H23298g Chr8 complement(2021024..2021797) [774 bp, 257 aa]
           {ON} similar to uniprot|P25299 Saccharomyces cerevisiae
           YGL044C RNA15 Cleavage and polyadenylation factor I (CF
           I) component involved in cleavage and polyadenylation of
           mRNA 3' ends interacts with the A-rich polyadenylation
           signal in complex with Rna14p and Hrp1p
          Length = 257

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 14/118 (11%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQ 121
           R++Y+G++     E+ +       GP+ N+K++ D +  +   YAFVEY     +N A +
Sbjct: 13  RVVYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVR 72

Query: 122 TLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQA 179
            L+G Q+    +K    +     +S+DT     GD N    +ETLT     FPS  Q 
Sbjct: 73  NLNGYQLGNRFLK--CGYYGGGSTSNDT-----GDSNT-TTNETLT-----FPSLPQG 117

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/74 (20%), Positives = 36/74 (48%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +++G +  D  +E +              +M+D  +G+S+GY FV + + + +  A+ + 
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 212 QGFILNGRAIRINW 225
            G+ L  R ++  +
Sbjct: 75  NGYQLGNRFLKCGY 88

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 310 PQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHY------PEKGCCFIKYDTHEQAA 363
           P RV   Y+G+IP+   E  ++ L  N G + + K          KG  F++Y   E + 
Sbjct: 11  PSRV--VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASN 68

Query: 364 VCIVALANFPFQGRNLRTGW 383
             +  L  +    R L+ G+
Sbjct: 69  SAVRNLNGYQLGNRFLKCGY 88

>KLTH0B06886g Chr2 (557856..559046) [1191 bp, 396 aa] {ON} similar
           to uniprot|P53883 Saccharomyces cerevisiae YNL175C
          Length = 396

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LFVG+L+ D  DE L   F+     ++  +     +G+ +G+ FV F  ++    A++ K
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCKGFAFVDFKNEEGPTNALKDK 296

Query: 212 QGFILNGRAIRINWASKREPQQ 233
               + GR +R+ +   R  +Q
Sbjct: 297 TCRRIAGRPLRMEFGEDRSKRQ 318

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQ 121
           RIL+VGNL     ++ LK++FQ  G I  +++   ++  +   +AFV++        A +
Sbjct: 235 RILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCKGFAFVDFKNEEGPTNALK 294

Query: 122 TLDGKQIEGNVIKINW 137
               ++I G  +++ +
Sbjct: 295 DKTCRRIAGRPLRMEF 310

>Kwal_55.20972 s55 (629521..629928) [408 bp, 135 aa] {ON} YIR005W
           (IST3) - U2 snRNP associated protein [contig 135] FULL
          Length = 135

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/106 (22%), Positives = 53/106 (50%), Gaps = 3/106 (2%)

Query: 119 AFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQ 178
           + Q L  +++E  ++       S H    D   +FVG L+ D+ +  +   F ++   + 
Sbjct: 6   SIQNLSFRELEQGILSPT---ASWHFEYKDQAYIFVGGLHKDLTEGDILTIFSQYGIPVD 62

Query: 179 AHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRIN 224
             ++ D  SG S+G+ ++ + +Q     A+++  G  + GR+IR++
Sbjct: 63  LKLVRDRESGESKGFAYLKYEDQRSTVLAVDNLNGVKIAGRSIRVD 108

 Score = 35.0 bits (79), Expect = 0.096,   Method: Composition-based stats.
 Identities = 23/89 (25%), Positives = 48/89 (53%), Gaps = 6/89 (6%)

Query: 65  LYVGNLDKAINE-DTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
           ++VG L K + E D L  + Q G P+ ++K++ D+ + E+  +A+++Y       +A   
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPV-DLKLVRDRESGESKGFAYLKYEDQRSTVLAVDN 94

Query: 123 LDGKQIEGNVIKINWAFQSQHVSSDDTFN 151
           L+G +I G  I+++    +     DD ++
Sbjct: 95  LNGVKIAGRSIRVD---HTMFTPRDDDYD 120

>KAFR0F02770 Chr6 complement(547451..549682) [2232 bp, 743 aa] {ON}
           Anc_4.33 YHL024W
          Length = 743

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 6/87 (6%)

Query: 56  GGRETSDRILYVGNLDKAINEDTL----KQYFQVGGPIANVKVLVDKNNEEANYAFVEYH 111
           G R      ++V +L   +++D L     + F+  G +  VKVL D+ N    YAFV+Y 
Sbjct: 102 GPRGLPSSCVFVASLAATLSDDKLCISVAEKFKQYGKLNGVKVLRDQENRP--YAFVQYA 159

Query: 112 QPHDANVAFQTLDGKQIEGNVIKINWA 138
             HDAN+A +   G  + G +I+   A
Sbjct: 160 NDHDANLALKEAHGSTLNGRIIRCERA 186

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           R ++VG L    N D LK +FQ+ G I+++ ++  + N    +AF+EY   + A  A +
Sbjct: 337 RSIFVGQLPDETNYDNLKNHFQLHGEISDINLIHKQTNV---FAFIEYETENAAASALE 392

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 7/79 (8%)

Query: 152 LFVGDLNVDVDDETLTGT----FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           +FV  L   + D+ L  +    FK++       V+ D     +R Y FV ++    A  A
Sbjct: 111 VFVASLAATLSDDKLCISVAEKFKQYGKLNGVKVLRDQ---ENRPYAFVQYANDHDANLA 167

Query: 208 MESKQGFILNGRAIRINWA 226
           ++   G  LNGR IR   A
Sbjct: 168 LKEAHGSTLNGRIIRCERA 186

>Kpol_487.6 s487 (35743..36873) [1131 bp, 376 aa] {ON}
           (35743..36873) [1131 nt, 377 aa]
          Length = 376

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 74/181 (40%), Gaps = 24/181 (13%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQTLD 124
           ++VGNL      + L+ +F   G +    ++  + +       VE+    D N A    D
Sbjct: 70  VFVGNLTYDCTPEDLRDHFSTIGEVVRADIITSRGHHRG-MGTVEFTNADDVNEAISQYD 128

Query: 125 GKQIEGNVIKI---NWAFQSQHVS-------------------SDDTFNLFVGDLNVDVD 162
           G  +    I +   N   ++ H S                   S   + +F+ +L   ++
Sbjct: 129 GSYLLDRQIFVRQDNPPPEASHESEPPRERRERRTLGNDGSLHSHIGYEVFIANLPYSIN 188

Query: 163 DETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIR 222
            + L   FKE  S I+A V  D  +G SRG+G V    Q+  ++A+    G+ L GR + 
Sbjct: 189 WQALKDMFKECGSVIRADVELDR-NGYSRGFGTVILGSQEDMERAISMYNGYELEGRVLE 247

Query: 223 I 223
           +
Sbjct: 248 V 248

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 7/77 (9%)

Query: 317 YIGNIPHFAQEPDLIPLLQNFGFI------IDFKHYPEKGCCFIKYDTHEQAAVCIVALA 370
           Y  N+P    + DL  L +  G +       D K  P  G   ++Y+  + A VC+  L 
Sbjct: 301 YCSNLPFSTAKSDLFDLFETIGKLKNAELKFDQKGNP-TGVAIVEYENVDDAQVCVDRLN 359

Query: 371 NFPFQGRNLRTGWGKEK 387
           N+ + G +L   +GK +
Sbjct: 360 NYNYGGCDLDISYGKRE 376

>Skud_7.583 Chr7 complement(965719..968058) [2340 bp, 779 aa] {ON}
           YGR250C (REAL)
          Length = 779

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 90/224 (40%), Gaps = 66/224 (29%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQTL 123
           ++VG + K ++   L   F   GP++++K++ DK   + N Y F  Y     A+V  + L
Sbjct: 196 IFVGGIAKGLSMGELSFLFSKYGPVSSMKLIYDKTKGDTNGYGFFSYPLGSQASVCIKEL 255

Query: 124 DGKQIEGNVIKINWAFQSQ--------HV---SSDDTFN-LFVGDL---NVDVDDETLT- 167
           +G  + G+ + IN+  + +        HV   ++DD F  LF+G+L   N D ++  +T 
Sbjct: 256 NGSTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPDKEEALITP 315

Query: 168 ---------GTFKEFPSFIQAHVMW----------------------------------- 183
                       + FP F      +                                   
Sbjct: 316 KEVIDVIKKELSRNFPDFDIISYYFPKRSNTRSSSSVSFNDEGSIDSSKFSLNANGPAQD 375

Query: 184 -DMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
            DML    +GYGF+     + A  A+E+  G++ +G  + +N A
Sbjct: 376 EDML----KGYGFIKLINHEQALAAIETFNGYMWHGNRLVVNKA 415

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 40/83 (48%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           N+FVG +   +    L+  F ++       +++D   G + GYGF S+     A   ++ 
Sbjct: 195 NIFVGGIAKGLSMGELSFLFSKYGPVSSMKLIYDKTKGDTNGYGFFSYPLGSQASVCIKE 254

Query: 211 KQGFILNGRAIRINWASKREPQQ 233
             G  +NG  + IN+  +R+ ++
Sbjct: 255 LNGSTVNGSTLFINYHVERKERE 277

 Score = 37.4 bits (85), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 20/99 (20%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW-------------------DMLSGRSR 191
           NL+V  + +   DE L G +K F   I   V+                    D+  G SR
Sbjct: 540 NLYVKHIPLSWTDEDLYGFYKTFGEIISVKVITVGGSKNKYRQQSNDTSSDSDLPVGSSR 599

Query: 192 GYGFVSFSEQDVAQQAMESKQGF-ILNGRAIRINWASKR 229
           GYGFVSF     A +A+ +  G+ +   + + +++A KR
Sbjct: 600 GYGFVSFESPLDAAKAILNTDGYQVGKDQVLSVSFAQKR 638

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 50/105 (47%), Gaps = 21/105 (20%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLV-----DKNNEEAN--------------- 104
           LYV ++  +  ++ L  +++  G I +VKV+      +K  +++N               
Sbjct: 541 LYVKHIPLSWTDEDLYGFYKTFGEIISVKVITVGGSKNKYRQQSNDTSSDSDLPVGSSRG 600

Query: 105 YAFVEYHQPHDANVAFQTLDGKQI-EGNVIKINWAFQSQHVSSDD 148
           Y FV +  P DA  A    DG Q+ +  V+ +++A +  ++SS D
Sbjct: 601 YGFVSFESPLDAAKAILNTDGYQVGKDQVLSVSFAQKRGNLSSSD 645

>CAGL0H04675g Chr8 complement(447256..448080) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q04067 Saccharomyces
           cerevisiae YDR429c TIF35
          Length = 274

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 147 DDTFNLFVGDLNVDVDDETLTGTFK-EFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           DD+  L +  LN + D+ TL       F    +  V+ +  +GRSRG  FV+F  +D+A+
Sbjct: 186 DDSCTLKILQLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAE 245

Query: 206 QAMESKQGFILNGRAIRINWASKREP 231
           +A+    G       +R++W+  + P
Sbjct: 246 KALHFLDGRGFMNLILRVDWSKPKVP 271

>KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {ON}
           Anc_5.536 YDR429C
          Length = 274

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 1/81 (1%)

Query: 147 DDTFNLFVGDLNVDVDDETLTGTFK-EFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           DD   L +  LN + D+ TL       F    +A V+ +  +GRSRG  FV+FS +++A+
Sbjct: 190 DDMCTLKIMQLNENADENTLREELLFPFAPIPKAVVVRNRETGRSRGLAFVTFSSEEMAE 249

Query: 206 QAMESKQGFILNGRAIRINWA 226
           +A+    G       +R+ W+
Sbjct: 250 KALHFLDGRGFMNLILRVEWS 270

>KLTH0B02992g Chr2 complement(234560..235174) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|P40561 Saccharomyces
           cerevisiae YIR001C SGN1 Cytoplasmic RNA-binding protein
          Length = 204

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVG-GPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAF 120
           R +YVGNLD +IN +TL+++F+     +  V++ ++K    A  +AFVE+ QP D   A 
Sbjct: 70  RSVYVGNLDPSINAETLQEFFKGSVSRVNRVEIQINKLTGFAKGFAFVEFAQPRDVMDAI 129

Query: 121 QTLDGKQIEGNVIKI 135
           + L   ++ G  +KI
Sbjct: 130 K-LSNTKLGGKPLKI 143

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 53/119 (44%), Gaps = 7/119 (5%)

Query: 146 SDDTFNLFVGDLNVDVDDETLTGTFKEFPSFI-QAHVMWDMLSGRSRGYGFVSFSE-QDV 203
           S D  +++VG+L+  ++ ETL   FK   S + +  +  + L+G ++G+ FV F++ +DV
Sbjct: 66  SADARSVYVGNLDPSINAETLQEFFKGSVSRVNRVEIQINKLTGFAKGFAFVEFAQPRDV 125

Query: 204 AQQAMESKQGFILNGRAIRINWASKREPQQHQXXXXXXXXXXXXXXXXXHQQFRGIPQG 262
                 S     L G+ ++I     + P  HQ                 H   RG P G
Sbjct: 126 MDAIKLSNTK--LGGKPLKI---VPKRPSFHQESPNRGSHRMRRATTRTHPPLRGRPHG 179

>KLTH0H12958g Chr8 (1107939..1109858) [1920 bp, 639 aa] {ON} similar
           to uniprot|P39684 Saccharomyces cerevisiae or to YHR015W
           uniprot|P38760 Saccharomyces cerevisiae
          Length = 639

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           +LF+GDL+  V ++ L   F  F +     +  D  + +S GYG+++F+    A +A+E 
Sbjct: 95  SLFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEK 154

Query: 211 KQGFILNGRAIRI 223
                L G+ +RI
Sbjct: 155 FSYVKLFGKEVRI 167

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 71/146 (48%), Gaps = 4/146 (2%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           L++G+LDK + E  L   F     +A+VK+ +D   +++  Y ++ +    +A+ A +  
Sbjct: 96  LFIGDLDKGVTEKMLLHAFSGFKTLASVKICIDSETKKSLGYGYLNFTSAQEADEAIEKF 155

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMW 183
              ++ G  ++I  + ++ +   +   N+F    N+ +++  LT T   + SF +   + 
Sbjct: 156 SYVKLFGKEVRIMPSMRNSYFRKNIGTNVFF--TNLPLENPALT-TRVFYESFRKYGRVL 212

Query: 184 DMLSGRSRGYGFVSFSEQDVAQQAME 209
                R +  GFV F     A++A++
Sbjct: 213 SCKLDRRKNIGFVYFESDISAKKAID 238

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 64  ILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYA-FVEYHQPHDANVAFQ 121
           +LY+ ++    NE  L    +    I   ++ +D+ +EE   +A  V      D+N  F+
Sbjct: 421 MLYLSDMSAVCNEKFLSHLCRTE-KIKFQRITIDRYDEEGLTFAGSVLCKSRSDSNRLFE 479

Query: 122 TLDGKQIEGNVIKINW 137
            L+GK I  +V+K++W
Sbjct: 480 VLNGKLIGDSVVKVSW 495

>KLTH0F13442g Chr6 (1103806..1104210) [405 bp, 134 aa] {ON} similar
           to uniprot|P40565 YIR005W Saccharomyces cerevisiae IST3
           Component of the U2 snRNP required for the first
           catalytic step of splicing and for spliceosomal assembly
          Length = 134

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 58/108 (53%), Gaps = 7/108 (6%)

Query: 119 AFQTLDGKQIEGNVI--KINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSF 176
           + Q L  +++E  V+  K +W     H    D   +++G LN ++ +  +   F ++   
Sbjct: 6   SIQNLSLRELENGVLSPKASW-----HHEYRDQAYVYIGGLNKELTEGDVLTVFSQYGVP 60

Query: 177 IQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRIN 224
           +  +++ D  +G S+G+ ++ F +Q  +  A+++  G ++ GRAI+++
Sbjct: 61  VDINLVRDRETGESKGFCYLKFEDQRSSILAVDNLNGAVVAGRAIKVD 108

 Score = 33.1 bits (74), Expect = 0.43,   Method: Composition-based stats.
 Identities = 18/74 (24%), Positives = 41/74 (55%), Gaps = 3/74 (4%)

Query: 65  LYVGNLDKAINE-DTLKQYFQVGGPIANVKVLVDKNNEEAN-YAFVEYHQPHDANVAFQT 122
           +Y+G L+K + E D L  + Q G P+ ++ ++ D+   E+  + ++++     + +A   
Sbjct: 36  VYIGGLNKELTEGDVLTVFSQYGVPV-DINLVRDRETGESKGFCYLKFEDQRSSILAVDN 94

Query: 123 LDGKQIEGNVIKIN 136
           L+G  + G  IK++
Sbjct: 95  LNGAVVAGRAIKVD 108

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 7/83 (8%)

Query: 309 APQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCI-- 366
           AP R  T Y+GNIP      DL+  +++ G I + K  PEK C FI +   E +++    
Sbjct: 165 APSR--TVYLGNIPPTLTASDLLDHVRS-GVIEEVKILPEKMCAFISF-LDENSSLLFHS 220

Query: 367 -VALANFPFQGRNLRTGWGKEKP 388
              L      G++++ GWGK  P
Sbjct: 221 DAILKRLNIDGKDIKIGWGKPSP 243

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 10/85 (11%)

Query: 316 AYIGNI---------PHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCI 366
            YIGNI           +  + +L  +   +G +        K CCF+ Y     A   I
Sbjct: 508 VYIGNIDFTADGTKRERYFTDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAI 567

Query: 367 VALANFPFQGRNLRTGWGKEKPAFI 391
             + N P   +NL+  +GK++   I
Sbjct: 568 DKIKNNP-TFKNLKINFGKDRCGNI 591

>KLLA0D13420g Chr4 complement(1157491..1157991) [501 bp, 166 aa]
           {ON} similar to uniprot|P40565 YIR005W Saccharomyces
           cerevisiae IST3 Component of the U2 snRNP required for
           the first catalytic step of splicing and for
           spliceosomal assembly
          Length = 166

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 56/111 (50%), Gaps = 3/111 (2%)

Query: 119 AFQTLDGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTFKEFPSFIQ 178
           + Q L  +++E  ++K      S H    D   +  G +++++ +  +   F ++   + 
Sbjct: 6   SIQKLSERELECGILKPE---SSWHHEYKDQAYINFGGMHLELTEADILTIFSQYGCPVD 62

Query: 179 AHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASKR 229
             ++ D  +G+S+G+GF+ + +Q     A+++  G  + GR IR++ A  R
Sbjct: 63  IKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRVDHAFYR 113

>Ecym_1121 Chr1 (248858..249832) [975 bp, 324 aa] {ON} similar to
           Ashbya gossypii AFR649W
          Length = 324

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           LF+  LN     E +   F+ F   +   ++ D  +G S GYGF+ F  ++  +QA    
Sbjct: 243 LFICKLNPLTKAEHIATIFERFGDVLSVEIVRDKKTGNSLGYGFIEFETKEACEQAYSKM 302

Query: 212 QGFILNGRAIRINWA 226
              +++ R I ++++
Sbjct: 303 DNTLIDDRRIHVDFS 317

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/85 (18%), Positives = 40/85 (47%), Gaps = 1/85 (1%)

Query: 55  KGGRETSDRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNN-EEANYAFVEYHQP 113
           K G + ++ +L++  L+     + +   F+  G + +V+++ DK       Y F+E+   
Sbjct: 233 KAGIKPAENVLFICKLNPLTKAEHIATIFERFGDVLSVEIVRDKKTGNSLGYGFIEFETK 292

Query: 114 HDANVAFQTLDGKQIEGNVIKINWA 138
                A+  +D   I+   I ++++
Sbjct: 293 EACEQAYSKMDNTLIDDRRIHVDFS 317

>KLLA0D11792g Chr4 (1005079..1007136) [2058 bp, 685 aa] {ON} similar
           to uniprot|P37838 Saccharomyces cerevisiae YPL043W NOP4
           Nucleolar protein essential for processing and
           maturation of 27S pre-rRNA and large ribosomal subunit
           biogenesis contains four RNA recognition motifs (RRMs),
          Length = 685

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  +  +  DE     F +F     A ++ D   G SRG+GFVSF+ +D  + A
Sbjct: 13  DLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDG-EGASRGFGFVSFAVEDDTKTA 71

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           +   +     GR +RI+ A +RE
Sbjct: 72  LNQARKTKFMGRLLRIDIAKRRE 94

>NDAI0E00470 Chr5 complement(91514..92290) [777 bp, 258 aa] {ON}
           Anc_8.797
          Length = 258

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 80/179 (44%), Gaps = 17/179 (9%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYHQPHDANVAFQTL 123
           +YVGN+D  + +  L + F    PI+ +    DK       YAF+E++ P D N   + +
Sbjct: 51  VYVGNIDPNVTKAQLYELFVQVSPISKIAYPKDKLLQTHQGYAFIEFYTPEDTNYVVKVM 110

Query: 124 DGK-QIEGNVIKINWAFQSQHVSSDDTFN------------LFVGDLNVDVDDETLTGTF 170
           +    +    +K+  + Q+   S++ T+             +FV +L+  VD + L+  F
Sbjct: 111 NNTVSLYDRFLKVRKSVQNLPSSNNKTYTTSKQVEVLPIAKVFVKNLDESVDIQQLSNIF 170

Query: 171 KEF-PSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRINWASK 228
           ++F P F +  + +  LS  +     + F     +  A+      ++  + I +++A K
Sbjct: 171 EKFGPLFKEPEIFY--LSNNTLRCAHIFFKFYPDSDAAIGKLDNELIANKRINLDYAYK 227

>CAGL0M12573g Chr13 (1247678..1248577) [900 bp, 299 aa] {ON} similar
           to uniprot|Q00916 Saccharomyces cerevisiae YIL061c SNP1
           U1 small nuclear ribonucleoprotein
          Length = 299

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 135 INW-AFQSQHVSSDDTFN-LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRG 192
           + W      H+   D +  +FVG L  D D+  L   F ++   ++  V+ D    +SRG
Sbjct: 98  LQWDPLSDNHMRDTDPYKTVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDK-QNKSRG 156

Query: 193 YGFVSFSEQDVAQQAMES---KQGFILNGR 219
           Y FV F E D A+         +G  +NGR
Sbjct: 157 YAFVLFKETDSARVCTRDIGVHRGIQINGR 186

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + ++VG L    +E  L++ F   G I  V+V+ DK N+   YAFV + +   A V  + 
Sbjct: 115 KTVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSARVCTRD 174

Query: 123 L---DGKQIEGN 131
           +    G QI G 
Sbjct: 175 IGVHRGIQINGR 186

>TPHA0C01740 Chr3 (398136..400229) [2094 bp, 697 aa] {ON} Anc_8.491
           YPL043W
          Length = 697

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 148 DTFNLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           D   LFV  + +   D+  T  F  F     A ++ D  + +SRG+GFVSF+ ++ +Q+A
Sbjct: 20  DLKTLFVRSIPLQTTDDEFTDFFSNFAPLKHAVIVKDT-NKKSRGFGFVSFASEEDSQEA 78

Query: 208 MESKQGFILNGRAIRINWASKRE 230
           +   +   +    +R+++A +R+
Sbjct: 79  LTKARTSKIQNHLLRVDFAKRRD 101

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 36/211 (17%), Positives = 78/211 (36%), Gaps = 55/211 (26%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQT 122
           + L+V ++     +D    +F    P+ +  ++ D N +   + FV +    D+  A   
Sbjct: 22  KTLFVRSIPLQTTDDEFTDFFSNFAPLKHAVIVKDTNKKSRGFGFVSFASEEDSQEALTK 81

Query: 123 LDGKQIEGNVIKINWA-----------------------FQSQHVSSDDTFNLFVGDLNV 159
               +I+ +++++++A                       F+      DD       D + 
Sbjct: 82  ARTSKIQNHLLRVDFAKRRDRSKTRTEGSEQTKEIVKKTFKKSATERDDG-----KDEDK 136

Query: 160 DVDDETLTGTFKEFPSFIQAHVMWDM------------------------LSGRSRGYGF 195
           D D+E+   + K  P  I  ++ W                            G+  G+ F
Sbjct: 137 DFDEES---SLKGKPKLIIRNMPWSCRDSAKLKNIFSRYGTVDEATIPRKRDGKLCGFAF 193

Query: 196 VSFSEQDVAQQAMESKQGFILNGRAIRINWA 226
           V+F      + A+E  +G  ++GRA+ +++A
Sbjct: 194 VTFKNLANCKVALEKSKGLKIDGRAVAVDFA 224

>KNAG0B03650 Chr2 (702368..703207) [840 bp, 279 aa] {ON} Anc_5.536
           YDR429C
          Length = 279

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

Query: 147 DDTFNLFVGDLNVDVDDETLTGTFK-EFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQ 205
           DD+  L +  LN + D+ TL       F    +  V+ +  +GRSRG  FV+FS + +A+
Sbjct: 191 DDSCTLKILQLNENADENTLREELLFPFAPIQRVVVVRNRETGRSRGLAFVTFSSEQLAE 250

Query: 206 QAMESKQGFILNGRAIRINWASKREPQQH 234
           +A++   G       +++ W+  + P++ 
Sbjct: 251 KALQFLDGRGFMNLILKVEWSKPKPPKEE 279

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 7/91 (7%)

Query: 53  ATKGGRETSDRI-LYVGNLDKAINEDTLKQYFQVGGPIANV-KVLVDKNNEEAN---YAF 107
           A +  RE  D   L +  L++  +E+TL++      P A + +V+V +N E       AF
Sbjct: 183 AYRDSRERDDSCTLKILQLNENADENTLREELLF--PFAPIQRVVVVRNRETGRSRGLAF 240

Query: 108 VEYHQPHDANVAFQTLDGKQIEGNVIKINWA 138
           V +     A  A Q LDG+     ++K+ W+
Sbjct: 241 VTFSSEQLAEKALQFLDGRGFMNLILKVEWS 271

>NDAI0G04190 Chr7 (1005539..1006618) [1080 bp, 359 aa] {ON}
           Anc_1.408 YCL011C
          Length = 359

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 72/174 (41%), Gaps = 14/174 (8%)

Query: 62  DRILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYHQPHDANVAFQ 121
           D  ++VGNL      + L  YF   G +    ++  K   +     VE+    DA  A +
Sbjct: 67  DNRVFVGNLSFDTTAEDLVDYFSQVGEVVTADIITFKGRHKG-LGTVEFTNADDATEAIE 125

Query: 122 TLDGKQIEGNVIKIN-------WAFQSQHVS-----SDDTFNLFVGDLNVDVDDETLTGT 169
             D     G  I +           ++  ++     +   +  FV +L   +  + L   
Sbjct: 126 RCDNTHFMGRDIYVKDDQPPPGARQKTMRIAPIRDINRQGYEAFVINLPYSITWQNLKDL 185

Query: 170 FKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESKQGFILNGRAIRI 223
           F+E    ++A +  D  +G SRG G V ++ +D   +A+++  G+ L GR + +
Sbjct: 186 FRECGDILRADIELDY-NGFSRGLGSVLYATEDAMHRAIDTFNGYELEGRVLEV 238

>NCAS0A02880 Chr1 complement(553819..555585) [1767 bp, 588 aa] {ON}
           Anc_4.33 YHL024W
          Length = 588

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 47/93 (50%), Gaps = 8/93 (8%)

Query: 50  PVLATKGGRETSDRILYVGNLDKAINEDTL----KQYFQVGGPIANVKVLVDKNNEEANY 105
           P   T  GR +S   ++V +L   +++D L      YF+  G I  VKVL D+ N    Y
Sbjct: 130 PYEPTFRGRPSS--CVFVASLASNLHDDELCLSVTDYFKKFGEIIRVKVLRDQANRP--Y 185

Query: 106 AFVEYHQPHDANVAFQTLDGKQIEGNVIKINWA 138
           AFV+Y   +DANVA +   G  + G  ++   A
Sbjct: 186 AFVQYTNDNDANVALKEAHGSILNGRRLRCERA 218

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 7/79 (8%)

Query: 152 LFVGDLNVDVDDETL----TGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQA 207
           +FV  L  ++ D+ L    T  FK+F   I+  V+ D  +   R Y FV ++  + A  A
Sbjct: 143 VFVASLASNLHDDELCLSVTDYFKKFGEIIRVKVLRDQAN---RPYAFVQYTNDNDANVA 199

Query: 208 MESKQGFILNGRAIRINWA 226
           ++   G ILNGR +R   A
Sbjct: 200 LKEAHGSILNGRRLRCERA 218

>Kpol_1026.16 s1026 (34514..35347) [834 bp, 277 aa] {ON}
           (34514..35347) [834 nt, 278 aa]
          Length = 277

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 310 PQRVTTAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHY------PEKGCCFIKYDTHEQAA 363
           P RV   Y+G+IP+   E  L+ L +N G +++ K          KG  F++Y   E +A
Sbjct: 12  PSRV--VYLGSIPYDQTEEQLLDLCRNVGPVVNLKLMFDPQTGKSKGYAFVEYKDLETSA 69

Query: 364 VCIVALANFPFQGRNLRTGW 383
             +  L  +P   R L+ G+
Sbjct: 70  SAVRNLNGYPIGSRFLKCGY 89

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/79 (20%), Positives = 41/79 (51%)

Query: 152 LFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMESK 211
           +++G +  D  +E L    +     +   +M+D  +G+S+GY FV + + + +  A+ + 
Sbjct: 16  VYLGSIPYDQTEEQLLDLCRNVGPVVNLKLMFDPQTGKSKGYAFVEYKDLETSASAVRNL 75

Query: 212 QGFILNGRAIRINWASKRE 230
            G+ +  R ++  ++S  +
Sbjct: 76  NGYPIGSRFLKCGYSSNSD 94

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 63  RILYVGNLDKAINEDTLKQYFQVGGPIANVKVLVD-KNNEEANYAFVEYHQPHDANVAFQ 121
           R++Y+G++     E+ L    +  GP+ N+K++ D +  +   YAFVEY     +  A +
Sbjct: 14  RVVYLGSIPYDQTEEQLLDLCRNVGPVVNLKLMFDPQTGKSKGYAFVEYKDLETSASAVR 73

Query: 122 TLDGKQIEGNVIKINWAFQS 141
            L+G  I    +K  ++  S
Sbjct: 74  NLNGYPIGSRFLKCGYSSNS 93

>KLTH0H00792g Chr8 (88079..90586) [2508 bp, 835 aa] {ON} some
           similarities with uniprot|P53316 Saccharomyces
           cerevisiae YGR250C Hypothetical ORF
          Length = 835

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 6/107 (5%)

Query: 65  LYVGNLDKAINEDTLKQYFQVGGPIANVKVLVDKNNEEA-NYAFVEYHQPHDANVAFQTL 123
           LYV  + K +  D L   F   GP+ ++K++ D N  ++  Y F+ Y     A+   + L
Sbjct: 251 LYVRGIPKDLTIDDLVPVFAKFGPVLSMKIICDSNTGDSLGYGFLSYPLGSQASRCIKEL 310

Query: 124 DGKQIEGNVIKINWAFQSQHVSSDDTFNLFVGDLNVDVDDETLTGTF 170
           +G  + G+ + IN+     HV   +   +    +  D DDE   G F
Sbjct: 311 NGNLMNGSPLFINY-----HVERKERERIHWDHIKEDNDDERFKGVF 352

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%)

Query: 151 NLFVGDLNVDVDDETLTGTFKEFPSFIQAHVMWDMLSGRSRGYGFVSFSEQDVAQQAMES 210
           NL+V  +  D+  + L   F +F   +   ++ D  +G S GYGF+S+     A + ++ 
Sbjct: 250 NLYVRGIPKDLTIDDLVPVFAKFGPVLSMKIICDSNTGDSLGYGFLSYPLGSQASRCIKE 309

Query: 211 KQGFILNGRAIRINWASKREPQQ 233
             G ++NG  + IN+  +R+ ++
Sbjct: 310 LNGNLMNGSPLFINYHVERKERE 332

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,743,406
Number of extensions: 1558478
Number of successful extensions: 5709
Number of sequences better than 10.0: 579
Number of HSP's gapped: 5220
Number of HSP's successfully gapped: 1229
Length of query: 421
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 309
Effective length of database: 40,638,807
Effective search space: 12557391363
Effective search space used: 12557391363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)