Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_33322.293ON51351322120.0
ADL208W2.293ON50251417250.0
SAKL0E07524g2.293ON47951613360.0
KNAG0A053902.293ON49751811251e-149
KLTH0G10516g2.293ON47451611181e-148
Kwal_27.115002.293ON47551511021e-146
CAGL0D04202g2.293ON49952510981e-145
NCAS0B062202.293ON48652110941e-144
NDAI0B035202.293ON50151810831e-143
Suva_9.1092.293ON49151910801e-142
Skud_9.832.293ON49151810741e-141
Smik_9.892.293ON49151810711e-141
ZYRO0A02024g2.293ON48652010641e-140
TDEL0G022302.293ON48851710601e-139
YIL090W (ICE2)2.293ON49151810561e-139
KLLA0E08207g2.293ON48651510531e-138
KAFR0J013302.293ON49152010451e-137
Kpol_1003.422.293ON4905159251e-119
TPHA0C034402.293ON5795579311e-119
TBLA0B069902.293ON5365388361e-105
TBLA0B059802.293ON4935268161e-103
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3332
         (513 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   856   0.0  
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   669   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   519   0.0  
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   437   e-149
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   435   e-148
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   429   e-146
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   427   e-145
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   426   e-144
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   421   e-143
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   420   e-142
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   418   e-141
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   417   e-141
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   414   e-140
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   412   e-139
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   411   e-139
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   410   e-138
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   407   e-137
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   360   e-119
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   363   e-119
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            326   e-105
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   318   e-103

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  856 bits (2212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/513 (86%), Positives = 442/513 (86%)

Query: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXX 60
           MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLS                    
Sbjct: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTT 60

Query: 61  NGSGKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVN 120
           NGSGKFKLLASLIYYLQH              NSDQLQRLVDSDAVGASSKGFIFEGNVN
Sbjct: 61  NGSGKFKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNVN 120

Query: 121 ESLLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180
           ESLLQLLSLPPGNEGSVAS       IVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET
Sbjct: 121 ESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180

Query: 181 GRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240
           GRWLRYKKNSNTW               MFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG
Sbjct: 181 GRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240

Query: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLSKN 300
           LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLSKN
Sbjct: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLSKN 300

Query: 301 NLLTYYNTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIILQTQ 360
           NLLTYYNTFVSNAESFWDSLLKK               FGYSMPFTSTIAKDTLIILQTQ
Sbjct: 301 NLLTYYNTFVSNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIILQTQ 360

Query: 361 WWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATRII 420
           WWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATRII
Sbjct: 361 WWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATRII 420

Query: 421 PALQKATGATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNFSAK 480
           PALQKATGATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNFSAK
Sbjct: 421 PALQKATGATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNFSAK 480

Query: 481 TRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513
           TRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR
Sbjct: 481 TRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/514 (65%), Positives = 381/514 (74%), Gaps = 13/514 (2%)

Query: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXX 60
           M+ +GLLRS+RF+LA FYLFLVLIT+PISFQ+GGLYCGLS                    
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 61  NGSGKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQR-LVDSDAVGASSKGFIFEGNV 119
               ++K +AS +YYLQH              N+DQLQ+ LV SD  GA   GFIF+GN+
Sbjct: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARG-GFIFDGNM 119

Query: 120 NESLLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179
           NESLLQLL     +  ++A        +V+PWQYMLLHATP FTLTEGFFTVLAIQ IGE
Sbjct: 120 NESLLQLLGRSRDDRATMA-YLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178

Query: 180 TGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239
           TGRWLRYK+NS  W               M+YLYRIYVTPIWPLSV TATLLGFTLSLVF
Sbjct: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238

Query: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLSK 299
           GLGLYGIISGKGS IESSLFFAYMV CIYEISPQLALTAM+EIFQVVH+TWQ+QQGTL K
Sbjct: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPK 298

Query: 300 NNLLTYYNTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIILQT 359
           N+LL YY  F+ NAE+ WD LLKK                      +S + KD L+++Q 
Sbjct: 299 NSLLAYYKNFILNAENLWDVLLKKAFLLHSVEL---------DQAPSSVVVKDALVLVQQ 349

Query: 360 QWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATRI 419
           QWW K QQ+WSFTKNFS GIPRSIHEI +VTL +A+ESIN AV++NLVFRV+VFYSATRI
Sbjct: 350 QWWNKSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRI 409

Query: 420 IPALQKATGATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNFSA 479
           IPALQ+ATG TQSRKLMRIIYWYSPCIVIAMYTH+ILRYSGELNN+LCIWGCFPWL  S 
Sbjct: 410 IPALQRATGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQ-SE 468

Query: 480 KTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513
             R +WVVDAW FWNWCNLFFTLLIYAVELIGSR
Sbjct: 469 ANRDRWVVDAWGFWNWCNLFFTLLIYAVELIGSR 502

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  519 bits (1336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/516 (53%), Positives = 330/516 (63%), Gaps = 42/516 (8%)

Query: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXX 60
           ML R L++SIR  L  FYL LVLITIPISFQVGGLYCGLS                    
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 61  NGSGKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVN 120
             +  +  + S +YYLQH              N+D+L+R +D D                
Sbjct: 61  KYNRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDV-----------NLPR 109

Query: 121 ESLLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180
           ESL+  L    G    +          VKPWQ++LLH+TPYFTL EGFFTVL IQAIGET
Sbjct: 110 ESLVNFLRNKSGKHSWIF-YYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGET 168

Query: 181 GRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240
            +WLRY KNSNTW               ++YLYRIYVTP+W LS+QTA+LLGFTLS+V G
Sbjct: 169 NKWLRYHKNSNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCG 228

Query: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLSKN 300
           LGLYGI+SGKGS IESSLFFAY+VRCIYEISPQLA +AM EIF++V DTWQ  QG L  +
Sbjct: 229 LGLYGIVSGKGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPTD 288

Query: 301 NLLTYY-NTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIILQT 359
           NLL+YY N  + N E  WD++++K                G + P T+ +          
Sbjct: 289 NLLSYYRNVVLKNGEMIWDAIVQKT---------------GTTSPSTTQMV--------- 324

Query: 360 QWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATRI 419
             WL+ Q +W FTKNF++ +P SI EI  VTLKMA ES+ P V+ NLVFR+LVFYSATRI
Sbjct: 325 --WLRLQPLWKFTKNFTISVPSSIREIFRVTLKMATESVTPTVVINLVFRILVFYSATRI 382

Query: 420 IPALQK--ATGATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNF 477
           IPALQK  + G   SR+LMR+IYWYSPCIVIAMYTHLIL+YSGELNNDLC+WGCFPW + 
Sbjct: 383 IPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMYTHLILQYSGELNNDLCLWGCFPW-SH 441

Query: 478 SAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513
           +    SK VVDAW FWNWCN+F TL IY +ELIG +
Sbjct: 442 TNDPSSKVVVDAWGFWNWCNVFCTLAIYGLELIGGK 477

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  437 bits (1125), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 234/518 (45%), Positives = 316/518 (61%), Gaps = 39/518 (7%)

Query: 2   LSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXX-XXXXXXXXXXX 60
           L+ G +R  R      YL L LI+IPISF+VGGLYCGL+                     
Sbjct: 5   LTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK 64

Query: 61  NGSGKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVN 120
           NG+  + +L+S++YY QH              ++ +L +++++DA+              
Sbjct: 65  NGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPI------------ 112

Query: 121 ESLLQLLSLP-PGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179
           ESL  +L++    +E +          +V PW+++L H+TP+FTL+EGFFT+LAIQAIGE
Sbjct: 113 ESLTSILNVSMSSSEANWIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGE 172

Query: 180 TGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239
           T +WL Y+KNSN W               ++YLYRIYVTPIW L+VQTA+LLGF LSLV 
Sbjct: 173 TNKWLCYEKNSNAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVS 232

Query: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLS- 298
           GLG+YGI+S  GS IESSLFFAY+VRCIYEISP+LA TA  E+ ++  D WQ +QG L  
Sbjct: 233 GLGIYGIVSDSGSVIESSLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPI 292

Query: 299 KNNLLTYYNTFV-SNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIIL 357
           +NNL+ YYN  +  N E  WD+ + +                G S  F    +     +L
Sbjct: 293 RNNLIFYYNNVILKNIEMAWDNFILRT---------------GTSGTFNYNPS-----LL 332

Query: 358 QTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSAT 417
               W  C+ IW F KNF++ +P SI EIL++T KM+ ES++PAV+ NL FR+L+FYSAT
Sbjct: 333 LNNTWKFCKPIWKFFKNFTLSVPFSIREILLMTWKMSLESVSPAVVINLCFRILIFYSAT 392

Query: 418 RIIPALQKATGATQ--SRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFP-W 474
           RI+P+LQ+     Q  SRK+M ++YWYSPCI+IAMY HLIL+YS EL N+LC+WGC    
Sbjct: 393 RIVPSLQRKDAREQRRSRKVMELVYWYSPCILIAMYAHLILQYSSELKNELCLWGCNNIL 452

Query: 475 LNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512
           L ++       VVDAW FWNWCN+F T+L+YA ELIG 
Sbjct: 453 LGYNTDQNETVVVDAWRFWNWCNVFCTILVYANELIGD 490

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  435 bits (1118), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 249/516 (48%), Positives = 315/516 (61%), Gaps = 46/516 (8%)

Query: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXX-XXXXXXXXXXXXXX 59
           M  R +++S R  L  FYL L+LITIPISFQVGGLYCGLS                    
Sbjct: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 60  XNGSGKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNV 119
             G  K   LAS  YY QH              ++D+L+R +D++               
Sbjct: 61  ARGLAK---LASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNT------------RP 105

Query: 120 NESLLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179
           +ESL+ LL     ++  V         +V+PWQ+MLL +TPYFTL EGFFTVL IQA+GE
Sbjct: 106 DESLIDLLRSTTQSQTWVFYYYYYQY-VVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGE 164

Query: 180 TGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239
           T RWL     SN W               ++YLYRIYVTPIW LSVQTA+LLGFT S+V 
Sbjct: 165 TNRWLSRGNGSNMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVS 224

Query: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-S 298
           GLG+YGI+SG+GSTIESSLFFAY+VRC+YEISPQLA +AM EIF +V +TW  Q  +L S
Sbjct: 225 GLGIYGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRS 284

Query: 299 KNNLLTYYNTFV-SNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIIL 357
            + LLTYY   +  N E  WD++L +                       +  A  T +  
Sbjct: 285 SDTLLTYYRDIILKNGEMVWDAILARTN--------------------VNVGASGTPVWA 324

Query: 358 QTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSAT 417
               W + Q +W F K+F+  +P SI EI  +TL+MA+E+I PAV+ NL FR+L+FYSAT
Sbjct: 325 S---WNRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMAREAIAPAVVINLCFRILIFYSAT 381

Query: 418 RIIPALQKATGATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNF 477
           RIIPALQK     +SR+ MR++YWYSPCIVIAMYTHLIL+YSG+++NDLC+WGCFPW   
Sbjct: 382 RIIPALQKK-HKRRSRRFMRMLYWYSPCIVIAMYTHLILQYSGQISNDLCLWGCFPW--- 437

Query: 478 SAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513
           S     K VVD+W FWNWCN+F T+ IYA EL+GS+
Sbjct: 438 SVPDTPKVVVDSWGFWNWCNIFCTMAIYASELLGSK 473

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  429 bits (1102), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 241/515 (46%), Positives = 314/515 (60%), Gaps = 44/515 (8%)

Query: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXX 60
           M+ R +L+SIR  L  FYL L+LITIPI+FQVGGLYCGLS                    
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  NGSGKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVN 120
             +  F  LAS  YY QH              ++D+L+  +D++               +
Sbjct: 61  --ARGFAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNT------------RPD 106

Query: 121 ESLLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180
           ESL+ LL     ++  +         +V+PWQ++LL +TPYFTL EGFFTVL IQA+GET
Sbjct: 107 ESLIDLLRSSTHSQPWIFYYYYYHY-VVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGET 165

Query: 181 GRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240
            RWL     SN W               ++YLYRIYVTPIW LSVQTA+LLGFT S+V G
Sbjct: 166 NRWLSRGHGSNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSG 225

Query: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-SK 299
           LG++GI+SG+GSTIESSLFFAY+VRC+YEISPQLA +AM EI  +V DTW  Q  +L S 
Sbjct: 226 LGIFGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSS 285

Query: 300 NNLLTYYNTFV-SNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIILQ 358
           +  L YY   +  N E  WD++L +                  ++     +A  +     
Sbjct: 286 DTFLAYYRDIILKNGEMIWDAVLART---------------NVNVSGAGPVAWIS----- 325

Query: 359 TQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATR 418
              W + Q +W F K+F+  +P SI EI ++TL MA+E+I PAV+ NL FR+L+FYSATR
Sbjct: 326 ---WHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSMAREAIAPAVVINLCFRILIFYSATR 382

Query: 419 IIPALQKATGATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNFS 478
           IIPALQ+     +SR+ MR++YWYSPCIVIAMYTHLI++YSG+++NDLC+WGCFPW   S
Sbjct: 383 IIPALQRKH-KRRSRRFMRMLYWYSPCIVIAMYTHLIMQYSGQISNDLCLWGCFPW---S 438

Query: 479 AKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513
               SK VVD+W FWNWCN+F T+ IYA EL GS+
Sbjct: 439 PPEGSKVVVDSWGFWNWCNIFCTMAIYASELFGSK 473

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  427 bits (1098), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 235/525 (44%), Positives = 323/525 (61%), Gaps = 46/525 (8%)

Query: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXX 60
           +++ G+ RSIR S A  YL L L++IPISF++GGL CGLS                    
Sbjct: 3   LITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR 62

Query: 61  NGSGKFKLLA-SLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNV 119
               +  + A S++YY QH              ++++  R +       S  G   E + 
Sbjct: 63  RSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFL-------SPVGSYQELDP 115

Query: 120 NESLLQLL------SLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLA 173
           + S L LL      +    N  +          IV+PWQ++L ++TP+FTL EGFFT+LA
Sbjct: 116 DGSFLDLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILA 175

Query: 174 IQAIGETGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGF 233
           IQAIGET +WL Y+ NSNTW               ++YLYRIYVTPIW L++Q+A+LLGF
Sbjct: 176 IQAIGETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGF 235

Query: 234 TLSLVFGLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQL- 292
            LS+VF LGLYGIIS KGS IESSLFFAY+VRCIYEISP+LA  A  EI  +V D WQ  
Sbjct: 236 VLSIVFCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTH 295

Query: 293 QQGTLSKNNLLTYY-NTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAK 351
           Q+  L+++NLL YY N  + NAE  W+S +                     +P + ++  
Sbjct: 296 QRNLLNRDNLLAYYHNVVLKNAEMVWESFI---------------------LPRSRSLNA 334

Query: 352 DTLIILQTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVL 411
               + + ++WL    +W F KNF+V +P SI E++ VT KMA ES++PAVI NL FR+L
Sbjct: 335 ----MEKIRFWLDVTPVWKFFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRIL 390

Query: 412 VFYSATRIIPALQKAT--GATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIW 469
           +FYSATRIIPALQ+++     QSR++++++YWYSPC++IAMYTHLIL+YSGEL  +LC+W
Sbjct: 391 IFYSATRIIPALQRSSYKEQRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLW 450

Query: 470 GCFP-WLNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513
           GC   W  F +K + + V D+WSFWNWCN+F+T+L+YA ELIG++
Sbjct: 451 GCTSNW--FGSKDQPRIVTDSWSFWNWCNIFWTVLVYANELIGTQ 493

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  426 bits (1094), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 235/521 (45%), Positives = 310/521 (59%), Gaps = 50/521 (9%)

Query: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXX 60
           M+S   +R IR   A FYL   LI+IPISF++GGL+CGL+                    
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 61  N-GSGKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNV 119
             GS    LL +++YY QH              +++QL  ++        S   IF+ NV
Sbjct: 61  KYGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNV 120

Query: 120 NESLLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179
             S           + +           V+PWQ++L ++TP+FTL+EGFFT+LAIQAIGE
Sbjct: 121 ASS----------TQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGE 170

Query: 180 TGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239
           T +WL Y+ NSNTW               ++YLYRIYVTPIW LSVQTA+LLGFTLSLV 
Sbjct: 171 TNKWLVYEINSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVG 230

Query: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-S 298
           GLG+YGI++ KGS IESS+FFAY+VRCIYEISP+LA TA  EI +V  + WQ  Q  L S
Sbjct: 231 GLGIYGIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTS 290

Query: 299 KNNLLTYY-NTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIIL 357
            NNLL+YY N  + N E+ W+S                         F ++ + + +I +
Sbjct: 291 PNNLLSYYHNVVLKNIETIWESFKIN------------------DNSFITSFSTERVITI 332

Query: 358 QTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSAT 417
                     IW   K F++ +P SI+E+  VT KMA ESI+PAVI NL FRVL+FYSAT
Sbjct: 333 -------FMPIWKLLKTFTITVPSSINELCFVTYKMACESISPAVIVNLCFRVLIFYSAT 385

Query: 418 RIIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGC---- 471
           RIIPALQ+       +SR++M+++YWYSPCI+IAMY HLIL+YSGEL ++LC+WGC    
Sbjct: 386 RIIPALQRRDDNELRKSRRIMKVLYWYSPCILIAMYAHLILQYSGELKDELCLWGCNSKI 445

Query: 472 FPWLNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512
           FP        + K +VD+W FWNWCN+FFT+L+YA ELIG+
Sbjct: 446 FP------SDQPKIIVDSWGFWNWCNIFFTILVYASELIGT 480

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  421 bits (1083), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 227/518 (43%), Positives = 309/518 (59%), Gaps = 30/518 (5%)

Query: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXX 60
           M+S   +R +R   A FYL   LI+IPISF++GGL CGL+                    
Sbjct: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60

Query: 61  NGSGKFKL-LASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNV 119
                F + L   +YY QH              + + L   +  D         +   N+
Sbjct: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120

Query: 120 NESLLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179
           + +             +           V+PW+Y+L ++TP+FTL+EGFFT+LAIQA+GE
Sbjct: 121 SST-----------NSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGE 169

Query: 180 TGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239
           T +WL  + NSNTW               ++YLYRIYVTPIW LS+QTA+LLGFTLSLV 
Sbjct: 170 TNKWLVNEINSNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVG 229

Query: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-S 298
           GLGLYGI++ KGS IESSLFFAY+VRCIYEISP+LA TA  EI ++  + WQ  QG L +
Sbjct: 230 GLGLYGIVTEKGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPT 289

Query: 299 KNNLLTYYNTFV-SNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIIL 357
            +NLL YYN FV  + +  W+ L+ K                 +    T+ ++KD L+ +
Sbjct: 290 TDNLLFYYNNFVLRHIDMLWELLVSKINQNDPNNTLPSSFNINF---LTTFLSKDLLLRI 346

Query: 358 QTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSAT 417
                  C+ IW   KNF+V +P SI E+++VT +MA+ES++PAV+ NL FRVL+FYSAT
Sbjct: 347 -------CKPIWKLFKNFTVSVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSAT 399

Query: 418 RIIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGC-FPW 474
           RIIPALQ+   +   +SR++M+I+YWYSPC++IAMYTHLIL+YSGEL  DLC+WGC   W
Sbjct: 400 RIIPALQRRNDSELKKSRRIMKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKW 459

Query: 475 LNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512
           L      + + +VD+W FWNWCN+FFT++IYA EL G+
Sbjct: 460 L---IPNQPELIVDSWGFWNWCNIFFTIIIYASELFGT 494

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  420 bits (1080), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 232/519 (44%), Positives = 306/519 (58%), Gaps = 41/519 (7%)

Query: 2   LSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXXN 61
           LS+  ++S R   A FYL   L++IPISF+VGGL CGLS                     
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  GSGK-FKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVN 120
             G+ +  L S +YY QH              ++D+L  ++ +              N +
Sbjct: 64  NGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKN------------RSNES 111

Query: 121 ESLLQLLSLP-PGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179
           ES L+ L      N+ +          +V+PWQ++L  +TP+FTL+EGFFT+LAIQA+GE
Sbjct: 112 ESFLEALKNSLNSNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGE 171

Query: 180 TGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239
           T RWL    NSNTW               ++YLYRIYVTPIWPLS+QTA+LLGF LS+V 
Sbjct: 172 TNRWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVC 231

Query: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-S 298
           GLGLYGI+S +GS IESSLFFAY+VRCIYEISP+LA TA  EI  +  D WQ  Q  L +
Sbjct: 232 GLGLYGIVSQRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPT 291

Query: 299 KNNLLTYY-NTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIIL 357
            +NLL Y+ N  + NAE  W S + +                      TS + +  + IL
Sbjct: 292 ADNLLCYFHNVILKNAEVLWGSFIPRRRKT------------------TSDLHEKIISIL 333

Query: 358 Q-TQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSA 416
              +  L  +  W F KNF+  +P SI+E   VT+KMA ES++PA++ NL FRVL+FYSA
Sbjct: 334 SFEKVSLISKPFWRFCKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSA 393

Query: 417 TRIIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFP- 473
           TRIIPALQ+       +SR++M+ +YWYSPCI+IAMYTHLIL+YSGEL  DLCIWGC   
Sbjct: 394 TRIIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEK 453

Query: 474 WLNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512
           W       + + +VD+W FWNWCN+F T+L+YA EL+GS
Sbjct: 454 WF---GPDQPEIIVDSWGFWNWCNIFCTILVYATELVGS 489

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  418 bits (1074), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 235/518 (45%), Positives = 304/518 (58%), Gaps = 39/518 (7%)

Query: 2   LSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXXN 61
           LS+  ++S R   A FYL   L++IPISF+VGGL CGLS                     
Sbjct: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAKR 63

Query: 62  GSGK-FKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVN 120
             GK +  L + +YY QH              ++D+L  ++ +              N +
Sbjct: 64  HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKN------------RSNES 111

Query: 121 ESLLQLLSLP-PGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179
           ES L  L      N+ +          +V+PWQ++L  +TP+FTL+EGFFT+LAIQA+GE
Sbjct: 112 ESFLDALKDSLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGE 171

Query: 180 TGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239
           T RWL    NSNTW               ++YLYRIYVTPIWPLS+QTA+LLGF LS+V 
Sbjct: 172 TNRWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVC 231

Query: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-S 298
           GLGLYGI+S KGS IESSLFFAY+VRCIYEISP+LA TA  EI  +  D WQ  Q  L +
Sbjct: 232 GLGLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPT 291

Query: 299 KNNLLTYY-NTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIIL 357
            +NLL Y+ N  + NAE  W S + +                 +         K +LI  
Sbjct: 292 ADNLLCYFHNVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFE--------KVSLI-- 341

Query: 358 QTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSAT 417
                   +  W F KNF+  +P SI+E   VT+KMA ES++PA++ NL FRVL+FYSAT
Sbjct: 342 -------SRPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSAT 394

Query: 418 RIIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFP-W 474
           RIIPALQ+       +SR++MR +YWYSPCI+IAMYTHLIL+YSGEL  DLCIWGC   W
Sbjct: 395 RIIPALQRKNDKQLRKSRRIMRGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKW 454

Query: 475 LNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512
             F A+ + + +VD+W FWNWCN+F T+L+YA ELIGS
Sbjct: 455 --FGAE-QPEIIVDSWGFWNWCNIFCTILVYATELIGS 489

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  417 bits (1071), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 234/518 (45%), Positives = 303/518 (58%), Gaps = 39/518 (7%)

Query: 2   LSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXXN 61
           LS+  ++S R   A FYL   L++IPISF+VGGL CGLS                     
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  GSGK-FKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVN 120
             GK +  L S +YY QH              ++D+L  ++                N +
Sbjct: 64  YGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKK------------RPNES 111

Query: 121 ESLLQLLSLP-PGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179
           ES L+ L      N+ +          +V+PWQ++L  +TP+FTL+EGFFT+LAIQA+GE
Sbjct: 112 ESFLEALKNSLNSNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGE 171

Query: 180 TGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239
           T RWL    NSNTW               ++YLYRIYVTPIWPLS+QTA+LLGF LS+V 
Sbjct: 172 TNRWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVC 231

Query: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-S 298
           GLGLYGI+S KGS IESSLFFAY+VRCIYEISP+LA TA  EI  +  D WQ  Q  L +
Sbjct: 232 GLGLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPT 291

Query: 299 KNNLLTYY-NTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIIL 357
            +NLL Y+ N  + NAE  W S + +               F   +    +  K +LI  
Sbjct: 292 ADNLLCYFHNVILKNAEMLWGSFIPR--------GRKKTGDFHDKLISVLSFEKVSLI-- 341

Query: 358 QTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSAT 417
                   +  W F KNF+  +P SI+E   VT+KMA ES++PA++ NL FRVL+FYSAT
Sbjct: 342 -------SKPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVVNLCFRVLMFYSAT 394

Query: 418 RIIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFP-W 474
           RIIPALQ+       +SR++M+ +YWYSPCI+IAMYTHLIL+YSGEL  DLCIWGC   W
Sbjct: 395 RIIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKW 454

Query: 475 LNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512
                  + + +VD+W FWNWCN+F T+L+YA ELIGS
Sbjct: 455 F---GSDQPEIIVDSWGFWNWCNIFCTILVYATELIGS 489

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  414 bits (1064), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 233/520 (44%), Positives = 317/520 (60%), Gaps = 50/520 (9%)

Query: 6   LLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXXNGSGK 65
           +++S+R  LA FYL  +LITIPISF+VGGLYCGLS                      + +
Sbjct: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63

Query: 66  FKLLASL-IYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVNESLL 124
           F + ++  IYY QH              ++++L ++++S +               +SLL
Sbjct: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGS------------QPEQSLL 111

Query: 125 QLL-SLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGETGRW 183
           ++L S P     +          IV+PWQ++L H+T +F+L+EGFFT+LAIQA+GE+ RW
Sbjct: 112 EVLKSNPFSAHSNWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRW 171

Query: 184 LRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFGLGL 243
           L Y+ NSN W               ++YLYRIYVTP+W LS+QTA+LLGFTLSLV GLGL
Sbjct: 172 LLYEINSNIWNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGL 231

Query: 244 YGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLSK-NNL 302
           YGI+S  GS IESSLFFAY+VRCIYEISP+LA TA  EI ++  + WQ  Q   S  NNL
Sbjct: 232 YGIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNL 291

Query: 303 LTYYNTFV-SNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTST-----IAKDTLII 356
           L+YY+  V  +AE  W+S++ K                  S PF  T     + K T I 
Sbjct: 292 LSYYHDVVLDSAEMMWESIVSKTVTT--------------SDPFYHTSMFPPLRKFTDIF 337

Query: 357 LQTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSA 416
                    + +  F KNF++ +P SI  +  VTLKMA +S++PA++ NL FRVL+FYSA
Sbjct: 338 ---------KPVGIFFKNFTISVPSSIEGLFQVTLKMASDSVSPAIVVNLFFRVLIFYSA 388

Query: 417 TRIIPALQKATGA--TQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFP- 473
           T+IIPALQ        +SR++M ++YWYSPCI+IAMYTHLIL+YSGELN DLC+WGC   
Sbjct: 389 TKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNRDLCLWGCNSM 448

Query: 474 WLNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513
           W + +   ++K VVD+W FWNWCN+F+T+L+Y  ELIG +
Sbjct: 449 WFSLN---QTKIVVDSWGFWNWCNIFWTILVYGSELIGGK 485

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  412 bits (1060), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 231/517 (44%), Positives = 302/517 (58%), Gaps = 38/517 (7%)

Query: 2   LSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXXN 61
           +S+  L+  R +LA FYL   L+TIPISF+VGGLYCGLS                    +
Sbjct: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63

Query: 62  -GSGKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVN 120
            G+  + +  + IYYLQH              ++++L ++++  +    S   +   NV 
Sbjct: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNVF 123

Query: 121 ESLLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180
                       N  S          +V+PWQ +L H+T +F L+EGFFTVL IQAIGET
Sbjct: 124 S-----------NHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGET 172

Query: 181 GRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240
            RWL  + NSNTW               ++YLYRIYVTPIW LSVQTA+LLGFTLS+V G
Sbjct: 173 NRWLLDEMNSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCG 232

Query: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLS-K 299
           +GL+GI+S  GS IESSLFFAY+VRCIYEISP+LA TA  EI +V+   WQ  Q  LS  
Sbjct: 233 IGLFGIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTT 292

Query: 300 NNLLTYYNTFV-SNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIILQ 358
           NNLL+YY   V  NAE  W+S++ +                       S     T I   
Sbjct: 293 NNLLSYYQDVVLKNAEMVWESIVLRTK--------------------NSDATTFTAIQPL 332

Query: 359 TQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATR 418
            + W     IW F K F + +P SI  +  VTLK+A ES++PA++ NL FRVLVFYSATR
Sbjct: 333 NKLWHAFTPIWKFFKGFVLSVPSSIGGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATR 392

Query: 419 IIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLN 476
           IIPALQ+       +SR++M ++YWYSPCI+IAMYTHLIL+YSGELN+DLC+WGC     
Sbjct: 393 IIPALQRKNTRELRKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNSDLCLWGCSE--K 450

Query: 477 FSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513
           +    + K  ++ W FWNWCN+F+T+LIY  ELIG +
Sbjct: 451 WFGSGQPKIEINTWVFWNWCNIFWTVLIYGSELIGGK 487

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  411 bits (1056), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 229/518 (44%), Positives = 301/518 (58%), Gaps = 39/518 (7%)

Query: 2   LSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXXN 61
           LS+  ++S R   A FYL   L++IPISF+VGGL CGLS                     
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  GSGK-FKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVN 120
             G+ +    + +YY QH              ++D+L  ++ +            + N +
Sbjct: 64  HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKN------------KYNES 111

Query: 121 ESLLQLLSLP-PGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179
           ES L+ L      N+ +          +V+PWQ++L  +TP+FTL+EGFFT+LAIQA+GE
Sbjct: 112 ESFLEALKNSLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGE 171

Query: 180 TGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239
           T RWL    NSNTW               ++YLYRIYVTPIWPLS+QTA+LLG  LS+V 
Sbjct: 172 TNRWLSNDLNSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVC 231

Query: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-S 298
           GLGLYGI+S KGS IESSLFFAY+VRCIYEISP+LA TA  EI  +  D WQ  Q  L +
Sbjct: 232 GLGLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPT 291

Query: 299 KNNLLTYY-NTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIIL 357
            +NLL Y+ N  + NAE  W S + +                 +         K +LI  
Sbjct: 292 ADNLLCYFHNVILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFE--------KVSLI-- 341

Query: 358 QTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSAT 417
                   +  W F KNF+  +P SI+E   VT+KMA ES++PA++ NL FRVL+FYSAT
Sbjct: 342 -------SKPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSAT 394

Query: 418 RIIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFP-W 474
           RIIPALQ+       +SR++M+ +YWYSPCI+IAMYTHLIL+YSGEL  DLCIWGC   W
Sbjct: 395 RIIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKW 454

Query: 475 LNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512
                  + + +VD+W FWNWCN+F T+L+YA ELIGS
Sbjct: 455 FGVD---QPEIIVDSWGFWNWCNIFCTILVYATELIGS 489

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  410 bits (1053), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 235/515 (45%), Positives = 302/515 (58%), Gaps = 75/515 (14%)

Query: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXX 60
           ++ + +L+++R  L   YLFLVLITIPISFQVGGL CGLS                    
Sbjct: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101

Query: 61  N-GSGKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNV 119
           + GS     L++LIYYLQH               +      +DSD V   S+ F    NV
Sbjct: 102 DRGSA----LSTLIYYLQHLLIPSILFMFLSYFEN------IDSDTV--DSEYFKVFWNV 149

Query: 120 NESLLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179
                                      +VKPWQ  L+H+TP FTL EG FT+LAIQAIGE
Sbjct: 150 ---------------------------MVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGE 182

Query: 180 TGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239
           T RWL+  + SN W               +FY YRIYVTP+W LS  +A+LLGFT S+V 
Sbjct: 183 TERWLKMSRRSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVC 242

Query: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-S 298
           G+GLYGI +G GS +ESSLFFAYMVR +YEISP++A+ AM EIF +V +TW++ Q  L  
Sbjct: 243 GIGLYGI-NGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPK 301

Query: 299 KNNLLTYYNTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIILQ 358
           K+NLL        N  + W  +++                       T    K   ++ Q
Sbjct: 302 KDNLL---ELMTKNYRAIWSQIVEH----------------------TPRNHKYIKMMDQ 336

Query: 359 TQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATR 418
            +W L    +W+  KNF+  +P SI EI +VT KMAKES+ PAV+ NLVFR+L+FYSATR
Sbjct: 337 CKWIL--NPLWNSVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATR 394

Query: 419 IIPALQKATGATQS-RKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNF 477
           IIP LQ+ T   +S R++M  +YWYSPCI+IAMYTHLILRYSG+L NDLCIWGCFP+   
Sbjct: 395 IIPTLQRNTKERRSFRRIMNFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGCFPY--- 451

Query: 478 SAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512
             +T  K VVD+WSFWNWCN++ T+LIYA+EL+GS
Sbjct: 452 --ETEPKIVVDSWSFWNWCNIYSTMLIYALELMGS 484

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  407 bits (1045), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 223/520 (42%), Positives = 307/520 (59%), Gaps = 43/520 (8%)

Query: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXX 60
           +LS+ ++R +R     FYL   LI+IP+SF++GG++CGLS                    
Sbjct: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62

Query: 61  NGSGKFKL-LASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNV 119
               +F + L SLIYY QH              ++D+L R++       + K  +   N 
Sbjct: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKD----GTEKIEVLVANQ 118

Query: 120 NESLLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179
           +  +         +E +          +VKPW+++L ++TP+F L EGFFT+LAIQAIGE
Sbjct: 119 DLMV---------SESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGE 169

Query: 180 TGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239
           T RWL  +KNSN+W               ++YLYRIYVTPIW LS QTATLLG  LSL F
Sbjct: 170 TNRWLSDEKNSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTF 229

Query: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLS- 298
           GLG++GIIS +GS +ESSLFFAY+VRCIYEISP+LA TA  EI ++  + WQ  QG L  
Sbjct: 230 GLGIHGIISERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPI 289

Query: 299 KNNLLTYYNTFV-SNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTL--I 355
            +N+L YY + +  N E  W++ L K                      T   +  TL   
Sbjct: 290 TDNILNYYRSVILKNTEMIWEAFLSK----------------------TKQHSNHTLNSF 327

Query: 356 ILQTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYS 415
                +W+    +W F KNF++ +P SI E+  + L+MA ESI+PAV+ NL FRVL+FYS
Sbjct: 328 FTAENFWIHFNPLWKFFKNFTISVPFSISELSGMMLQMASESISPAVVVNLCFRVLIFYS 387

Query: 416 ATRIIPALQKAT--GATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFP 473
           ATRIIP+LQ+     + +SR++M+++YWYSPCI+IAMYTHLIL+YSGEL  +L +WG   
Sbjct: 388 ATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCILIAMYTHLILQYSGELKRELYLWGPDS 447

Query: 474 WLNF-SAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512
            L+F   K  +  VVD+WSFWNWCN+F+T+LIY  EL G+
Sbjct: 448 KLSFLVDKEENNIVVDSWSFWNWCNIFWTILIYGGELFGT 487

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  360 bits (925), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/515 (39%), Positives = 290/515 (56%), Gaps = 36/515 (6%)

Query: 4   RGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXXN-G 62
           + L+RS++  L  FYL  ++ TIPISF++GGLYCGL+                      G
Sbjct: 6   KNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNIIARRWG 65

Query: 63  SGKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVNES 122
           S    ++ S  +Y Q+               ++ L + + S      +   +  G++  S
Sbjct: 66  SKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVS 125

Query: 123 LLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGETGR 182
           +   L                    VKPWQ +L ++TP FTL EGFFT+L IQ IGE   
Sbjct: 126 VKNWLLF-----------YYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNT 174

Query: 183 WLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFGLG 242
           WL++++NSN W               ++YLYRIY TPIW LSV  ATLLGFTLSLV  LG
Sbjct: 175 WLKHERNSNIWIISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLG 234

Query: 243 LYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLS-KNN 301
           +YGI+S  GS IESSLFFAY+VRCIYEI+P+LA TA  E  + + + WQ     L+  + 
Sbjct: 235 IYGIVSHNGSVIESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADG 294

Query: 302 LLTY-YNTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIILQTQ 360
            ++Y Y++F   A  FW     +                 Y M + S      L+++++ 
Sbjct: 295 FISYFYDSFHMQAHKFWTLFTSRTPYYGYLH--------NYCMDYPS------LVMIRSN 340

Query: 361 WWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATRII 420
           ++     IW   K  +  +P SI E+  +T++MA +S++PA+I NL FR+++FYSATRII
Sbjct: 341 FY----PIWETLKTLTFSVPTSISELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRII 396

Query: 421 PALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNFS 478
           PA+QK T +   + R +M+ +YWYSPCI+IAMYTHLIL+YSGEL  DLC+WGC     + 
Sbjct: 397 PAIQKRTRSETRKIRGIMKALYWYSPCILIAMYTHLILQYSGELKKDLCLWGCDS--TWF 454

Query: 479 AKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513
            + + +  VDAWSFWNWCN+F+T++IY  ELIG +
Sbjct: 455 GEDQERINVDAWSFWNWCNIFWTIIIYGSELIGGK 489

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  363 bits (931), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 208/557 (37%), Positives = 312/557 (56%), Gaps = 72/557 (12%)

Query: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXX--XXXXXXXXXXXXX 58
           ++ RG++ S    L  FYL  +++TIPISF++GG+YCGLS                    
Sbjct: 50  LIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITK 109

Query: 59  XXNGSGKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVD-------SDAVGASSK 111
               +   +LLAS ++Y+Q+              N+  L   +        ++  G ++K
Sbjct: 110 RLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169

Query: 112 GFIF-----------------EGNVNESLLQLLSLPPGNEGSVASXXXXXXXI------- 147
             I                  E N    +LQL     GN  SV         I       
Sbjct: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGN--SVPDPQKLNSWILFFYYYY 227

Query: 148 --VKPWQYMLLHATPYFTLTEGFFTVLAIQAIGETGRWLRYKKNSNTWXXXXXXXXXXXX 205
             +KPW+++L+++TP+FTL EGFFT+L IQ IGET  WL+ +K+S+ W            
Sbjct: 228 IFIKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVI 287

Query: 206 XXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFGLGLYGIISGKGSTIESSLFFAYMVR 265
              ++YL RIYVTP W L+V TA++LGFTLS+V GLG++GI+S  GS IESSLFFAY+VR
Sbjct: 288 TATLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVR 347

Query: 266 CIYEISPQLALTAMTEIFQVVHDTWQLQQGTLS-KNNLLTYYNTFVSNAESFWDSLLKKX 324
           CIYE+SP+LA++A  E  +  ++ WQ+ Q  ++  +N+LTY   ++ +A S + S+    
Sbjct: 348 CIYEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHL 407

Query: 325 XXXXXXXXXXXXXXFGYSMPFTSTIAKDTLIILQTQWWLKCQQIWSFTKNFSVGIPRSIH 384
                           +       I+K+ ++          +Q W F KNF++ +P SI+
Sbjct: 408 ----------------FPKTIELGISKNLIV----------KQFWVFLKNFTINVPSSIN 441

Query: 385 EILMVTLKMAKESINPAVITNLVFRVLVFYSATRIIPALQKAT--GATQSRKLMRIIYWY 442
           +++ +T +MA +SI+PA+I NL FR+++FYSATRIIPA+Q+ T   A      M  +YW+
Sbjct: 442 DLIQITAQMAVDSISPAIIINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWF 501

Query: 443 SPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNFSAKTRS------KWVVDAWSFWNWC 496
           SPC++IAMYTHLIL++SGEL  ++C+W C  WL+ S+  +S        +VD+WSFWNWC
Sbjct: 502 SPCMLIAMYTHLILQFSGELKKNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWC 561

Query: 497 NLFFTLLIYAVELIGSR 513
           N+F+T++IYA ELIG R
Sbjct: 562 NIFWTIIIYASELIGGR 578

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  326 bits (836), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 193/538 (35%), Positives = 282/538 (52%), Gaps = 38/538 (7%)

Query: 4   RGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXXNGS 63
           + + +SIR     FYL  VLITIP +F++GGLYCGLS                       
Sbjct: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTL 65

Query: 64  GKFK-LLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGA-SSKGFIFEGNVNE 121
             F  LL++L+YYLQH              +   L  ++ ++      S  +  + + ++
Sbjct: 66  NNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSK 125

Query: 122 SLLQLLSLPPGNEGSVASXXXXXXXIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGETG 181
           S+ Q                      V+PW Y+L H+TP+FTL EGFFT+L IQAIGET 
Sbjct: 126 SVSQ--------NFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETY 177

Query: 182 RWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFGL 241
            WL  KK    +               + +LY+IY   +W LS+QTA+LLG T+SLV  +
Sbjct: 178 CWLLLKKQKKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTV 237

Query: 242 GLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLS-KN 300
           G++GI S  GS IESSLF  Y++RC YEISP+L+ +A TEI   + + WQ  QG+++   
Sbjct: 238 GIFGIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTE 297

Query: 301 NLLTYYNTFV---SNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLII- 356
           ++L YYN  +    N+   ++S   K                  +    + I K + +I 
Sbjct: 298 HILFYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIH 357

Query: 357 ------LQTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRV 410
                 +   W +    I+   K+F + IP S+  +  VT K+A +S++P+++ NL FRV
Sbjct: 358 LIGFKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRV 417

Query: 411 LVFYSATRIIPALQKATG--ATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCI 468
           L+FYSATRIIPA+Q+       +SR  ++  Y +SPCIVIAMYT+LIL+YSGEL NDLCI
Sbjct: 418 LIFYSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCI 477

Query: 469 WGC----------FPWLNFSAKTRS-----KWVVDAWSFWNWCNLFFTLLIYAVELIG 511
           WGC             +N    +       +++V++W FWNWCN+F T+ IY  EL+G
Sbjct: 478 WGCDIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  318 bits (816), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/526 (36%), Positives = 282/526 (53%), Gaps = 55/526 (10%)

Query: 4   RGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSXXXXXXXXXXXXXXXXXXXXNGS 63
           + L  S RF  A  YL  VL+T+PI+FQ+GGL CGL+                       
Sbjct: 6   KNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAIARKLR 65

Query: 64  -GKFKLLASLIYYLQHXXXXXXXXXXXXXXNSDQLQRLVDSDAVGASSKGFIFEGNVNES 122
             +F    + +YY Q+              +  +L                I   + N S
Sbjct: 66  WQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELS---------------ISMSDENPS 110

Query: 123 LLQLLSLPPGNE----GSVASXXXXXXXIVKP-WQYMLLHATPYFTLTEGFFTVLAIQAI 177
           +  + S+   N+     +++           P W++ L ++TP F L EGFFT+LAIQ I
Sbjct: 111 METITSILKNNDTYPSKTISFIYKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVI 170

Query: 178 GETGRWLRYKKNSNTWXXXXXXXXXXXXXXXMFYLYRIYVTPIWPLSVQTATLLGFTLSL 237
           GET  WL   KNS+ W               ++Y+Y+IYVTP+W LS Q A+LL FT SL
Sbjct: 171 GETNIWLTTVKNSSIWIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSL 230

Query: 238 VFGLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGT- 296
           V G+ +YGI+S +GS +ESSLFFAY+V CIYEISP +A TAM +IF  + ++WQ+ Q   
Sbjct: 231 VGGVAIYGIVSHRGSVVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNF 290

Query: 297 -LSKNNLLTYYNTFVSNAESFWDSLLKKXXXXXXXXXXXXXXXFGYSMPFTSTIAKDTLI 355
            +S N L+ YYN+ + N + F    + K                 +S  F S + +   I
Sbjct: 291 FISDNLLIYYYNSLIKNVDEFIKLKIIKLTTKD-----------NFSNKFNSLLFQCVKI 339

Query: 356 ILQTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYS 415
             ++      + I   +K F++GIP SI+E+  +TLKMA ESI+P ++ NL +RVL+FY+
Sbjct: 340 SKKS-----FKFILKLSKRFTLGIPSSIYELYSITLKMASESISPVILVNLCYRVLIFYA 394

Query: 416 ATRIIPALQKATGA--------TQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLC 467
           ATRIIPAL+  +            + K M+++YWYSPCI+IAMYT+LIL+YSGEL ++  
Sbjct: 395 ATRIIPALESRSNGFSNNNIKTKSNSKFMKVLYWYSPCILIAMYTNLILQYSGELKSEFK 454

Query: 468 IWGCFPWLNFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513
           +W        +    ++ VVD+W FWNWCN+F+T+ +Y  ELIG R
Sbjct: 455 LW--------NNSNNNEVVVDSWRFWNWCNIFWTITLYGSELIGGR 492

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,308,995
Number of extensions: 1547313
Number of successful extensions: 4401
Number of sequences better than 10.0: 21
Number of HSP's gapped: 4360
Number of HSP's successfully gapped: 34
Length of query: 513
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 399
Effective length of database: 40,409,475
Effective search space: 16123380525
Effective search space used: 16123380525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)