Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_33312.292ON70870835260.0
SAKL0E07546g2.292ON71870922840.0
Skud_9.822.292ON72271322460.0
ADL209C2.292ON70471622160.0
KLLA0E08229g2.292ON70471022140.0
KAFR0J013402.292ON72871522120.0
Smik_9.882.292ON72471322110.0
YIL091C (UTP25)2.292ON72171721900.0
Suva_9.1082.292ON72271521850.0
KNAG0A054002.292ON72171721770.0
KLTH0G10494g2.292ON74773821720.0
NCAS0B062302.292ON72371521430.0
NDAI0B035302.292ON73972221340.0
ZYRO0A02002g2.292ON70970821190.0
Kwal_27.115032.292ON72773321080.0
TDEL0G022202.292ON71071221000.0
TBLA0B059702.292ON71972020990.0
TPHA0D015202.292ON71671620690.0
Kpol_1039.462.292ON70470620550.0
CAGL0D04180g2.292ON70071320110.0
ZYRO0D05346g7.80ON109357781.1
TPHA0B017904.310ON207454752.6
Kwal_26.71637.88ON622109742.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3331
         (708 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...  1362   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   884   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   869   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   858   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   857   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   856   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   856   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   848   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   846   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   843   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   841   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   830   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   826   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   820   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   816   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   813   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   813   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   801   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   796   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   779   0.0  
ZYRO0D05346g Chr4 (458096..461377) [3282 bp, 1093 aa] {ON} simil...    35   1.1  
TPHA0B01790 Chr2 complement(396879..403103) [6225 bp, 2074 aa] {...    33   2.6  
Kwal_26.7163 s26 (243008..244876) [1869 bp, 622 aa] {ON} YAL016W...    33   2.6  

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score = 1362 bits (3526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/708 (94%), Positives = 666/708 (94%)

Query: 1   MDSKRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEER 60
           MDSKRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEER
Sbjct: 1   MDSKRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEER 60

Query: 61  TAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISASLXXXX 120
           TAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISASL    
Sbjct: 61  TAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISASLDDSV 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPYM 180
                                 RDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPYM
Sbjct: 121 DKDEEVEEDDGVYSDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPYM 180

Query: 181 HDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXXXXXXXXX 240
           HDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNG              
Sbjct: 181 HDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLTPLSK 240

Query: 241 XXVDPIFQYRDLLFEYEDFSQETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQELL 300
             VDPIFQYRDLLFEYEDFSQETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQELL
Sbjct: 241 TLVDPIFQYRDLLFEYEDFSQETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQELL 300

Query: 301 DQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSFQ 360
           DQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSFQ
Sbjct: 301 DQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSFQ 360

Query: 361 HVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLSS 420
           HVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLSS
Sbjct: 361 HVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLSS 420

Query: 421 IEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLIF 480
           IEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLIF
Sbjct: 421 IEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLIF 480

Query: 481 TKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVDE 540
           TKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVDE
Sbjct: 481 TKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVDE 540

Query: 541 PDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSDQ 600
           PDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSDQ
Sbjct: 541 PDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSDQ 600

Query: 601 RQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGKN 660
           RQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGKN
Sbjct: 601 RQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGKN 660

Query: 661 AFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           AFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK
Sbjct: 661 AFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/709 (61%), Positives = 540/709 (76%), Gaps = 16/709 (2%)

Query: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEERTAH 63
           K GRK+LR ITR     + +  +    E   +++ +E A+      ++  ++D E +   
Sbjct: 22  KTGRKELRTITRANARHANESKDDFENEPDMSSEEEELAD-NKPRSDEEEEEDIETKKQK 80

Query: 64  VYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYET----DEVATISASLXXX 119
           VY ALL++L S HP  + K     K  +   E++ N     ET    DE   I  +L   
Sbjct: 81  VYNALLTLLESEHPHKKSK-----KNREGGKEKQGNLQEGVETYSDEDEEEAIENALVET 135

Query: 120 XXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPY 179
                                   D FE HFN +SE+   KL +AF++K ++Y+S K+P 
Sbjct: 136 NDDEDDVGSDINGDEDDEDKA---DSFELHFNNVSELQATKLASAFRDKKIRYKSVKVP- 191

Query: 180 MHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXXXXXXXX 239
           ++++E FI+S+P +EG  GS  V   P CK ++HSYF+K+KLK+ N              
Sbjct: 192 VNEDEFFIYSRPTVEGEDGSSVV--APSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQ 249

Query: 240 XXXVDPIFQYRDLLFEYEDFSQETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQEL 299
              VDP+FQY+DLL+EY  + QE EYRDLY LH+LNH+YKTRDRIL+N+ KLQ+N DQEL
Sbjct: 250 KNLVDPMFQYQDLLYEYRSYEQEEEYRDLYALHVLNHVYKTRDRILRNSQKLQDNSDQEL 309

Query: 300 LDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSF 359
           LDQGFTRPKVL+V PTR+ AY I+ KII+KSGLDQVDK+ KF+DQF++ SLPP+SKPKSF
Sbjct: 310 LDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLPPSSKPKSF 369

Query: 360 QHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLS 419
           +H+FKGNTNDFFVLG KFTRKTLKLYSNFYQSDVI CSPLGIQLILENTDKKKRQDDFLS
Sbjct: 370 KHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLS 429

Query: 420 SIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLI 479
           SIE++V+DQLHS+E+QN +H+ +IFQHINKIPQ+QHD+DFSRIRMWYIN+QA LFRQT++
Sbjct: 430 SIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMV 489

Query: 480 FTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVD 539
           FTKY SPFANSLINGKC N +GR+KN   + PEKS+INQLGLKVRQ+F RFDL  GS++D
Sbjct: 490 FTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMD 549

Query: 540 EPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSD 599
           EPDYRFKFFTSV +  I KSTGYEDGILLYIPDYTD++RVRN+ +++T +LFG+I EYS+
Sbjct: 550 EPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSE 609

Query: 600 QRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGK 659
           Q+Q+TSNRALFQQGKVKVLLYTERLHHFRRY+IKGVKSVIFYKPP+NPEFY+E++R IGK
Sbjct: 610 QKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGK 669

Query: 660 NAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           +AFLG+ADLNISTVRC YCKLD LSLER+VG+KRAAVLT  QNEIYEFK
Sbjct: 670 SAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/713 (59%), Positives = 534/713 (74%), Gaps = 16/713 (2%)

Query: 4   KRGRKQLRKITRIGRNRSED----KANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEE 59
           KRGR++LRKI R    R+ED    K +  A E  G ND D  +++   +     D+D  E
Sbjct: 18  KRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVSDVGSEDDLDVGDED--E 75

Query: 60  RTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYET---DEVATISASL 116
           +   VY ALL+IL S HPE +R + K E+++D   +   +G+ N E+   D+   I   L
Sbjct: 76  KKKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQ--SDGNENAESEPVDDQLEIENGL 133

Query: 117 XXXXXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTK 176
                                     +DPFE HFNQ+ E D + L  AFK K ++Y+S K
Sbjct: 134 LGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSVK 193

Query: 177 LPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXXXXX 236
            P ++ +E +I+++PV+ G + S    ++P    +I+SYF+K++LK+ NG          
Sbjct: 194 AP-LNGDESYIYAQPVVVGEESS---VESPYKSSSIYSYFLKQRLKIQNGLQDKKIDPLN 249

Query: 237 XXXXXXVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKLQEND 295
                 VDP+FQY+D+L+EY+ + + E EYRDLYTLH+LNHIYKTRDRILKNN +LQ+N 
Sbjct: 250 ALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNNQRLQDNP 309

Query: 296 DQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSK 355
           D E LDQGFTRPKVL+V PTR+ AY +++KII KSG+DQVDKK KF DQF +DSLPP SK
Sbjct: 310 DTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSK 369

Query: 356 PKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQD 415
           P+SFQH+FKGNTNDFFV+G+KFTRK +KLYSNFYQSD+IVCSPLGIQ+ILENTDKKKRQD
Sbjct: 370 PRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQD 429

Query: 416 DFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFR 475
           DFLSSIE++V+DQLHS+E+QN +H+L+IF H+NKIP +QH++DFSRIRMWYIN+QA+ FR
Sbjct: 430 DFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFR 489

Query: 476 QTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTG 535
           QT++FTKY+SP  NSLING+C N +GR+KN R I PE S+I QLGLK+RQ+F RFD    
Sbjct: 490 QTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGN 549

Query: 536 SSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEIT 595
           S V+EPDYRFKFFTSV +P I KSTGYEDGIL+YIPDYTDF+R+RNY K++T ILFG+I 
Sbjct: 550 SIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDIN 609

Query: 596 EYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIR 655
           EYS QRQ+ +NR+LFQQG++KV+LYTERLHH+RRY IKGVKSVIFYKPP+NPEFY E +R
Sbjct: 610 EYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVR 669

Query: 656 CIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
            IGKNAF GN DLNISTVRC Y KLD +SLERIVG+KRAAVL+ +Q E+YEFK
Sbjct: 670 FIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  858 bits (2216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/716 (60%), Positives = 533/716 (74%), Gaps = 29/716 (4%)

Query: 1   MDSKRGRKQLRKITRIGR--NRSEDKANGS---ALEKRGNNDGDEYAEIAMGEHEKAADD 55
           MD KRGRKQLR ITRIGR  +  ED+A       +E+     G++ +    G H   A+D
Sbjct: 10  MDGKRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEE--AQAGEQTSNRKRGNH--PAED 65

Query: 56  DQEERTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISAS 115
           D   R +  YGALL++L++ H + R+KR++  +   A   E          D    I+A+
Sbjct: 66  DGGARESQSYGALLTLLSAEHGKQRKKRLRKAEAEAAEAAEAG-------EDPEEAITAA 118

Query: 116 LXXXXXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYEST 175
           L                          +D F+ HFN++S  D  +LDAAFK    QY   
Sbjct: 119 LENSAQDAEDAEDAFDDSGESDEE---QDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQ 175

Query: 176 KLPYMHDNEGFIFSKPVI--EGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXX 233
           K       E  ++SKPV   EG +G        V   ++  Y +K++L++HNG       
Sbjct: 176 K--EARGEEEILYSKPVASSEGTEGP-----VRVPARSLRGYAIKQRLRMHNGLTADDPE 228

Query: 234 XXXX-XXXXXVDPIFQYRDLLFEYEDFSQETEYRDLYTLHILNHIYKTRDRILKNNHKLQ 292
                     +DP+FQY+D+L+EYE + +E EYR+LYTLHILNH+YKTRDRILKNN KLQ
Sbjct: 229 KPLTPQQKVLLDPMFQYQDILYEYEGYDREREYRELYTLHILNHVYKTRDRILKNNQKLQ 288

Query: 293 ENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPP 352
           +N DQELLDQGFTRPK LVV PTR TAYD+++ ++ +SG++QVDKKSKFKDQFY+ SLPP
Sbjct: 289 DNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPP 348

Query: 353 TSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKK 412
            SKPKSFQHVFKGNTNDFFVLGMKFTRK ++LYSNFYQSDVIVCSPLG+QLI+ENTDKKK
Sbjct: 349 ASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKK 408

Query: 413 RQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQAR 472
           RQDDFLSSIE++V+DQLHS+EFQN AHV +IF HINKIPQ+Q D+DFSRIRMWYI DQA+
Sbjct: 409 RQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAK 468

Query: 473 LFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDL 532
           LFRQT++FT+Y+SPFAN+L+N KC NW+GR K+ R +S EKS I QLGLK+RQ+F RF++
Sbjct: 469 LFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEV 528

Query: 533 FTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFG 592
             GS+VDEPD+RFKFFTSV VP I+K+TGY+ GILLYIP+YTDF+RVRNY KD+TRILFG
Sbjct: 529 LGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFG 588

Query: 593 EITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQE 652
           +I EYSDQRQ+TSNRALFQ G++KVLLYTERLHHFRR+++KGVKSVI YKPPSNPEFYQE
Sbjct: 589 DINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQE 648

Query: 653 LIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           L+R IGK+AFLG ADLNI+TVRC Y K+DSL+LERIVG+KRAAVLT  QNE+YEFK
Sbjct: 649 LLRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  857 bits (2214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/710 (60%), Positives = 525/710 (73%), Gaps = 19/710 (2%)

Query: 4   KRGRKQLRKITRIG--RNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEERT 61
           K GRKQLR+ITR G  R R +D+A  + L     +D D        E E     D E+  
Sbjct: 9   KSGRKQLREITRAGQKRVRYDDEATVADLTPDNESDSDNAEPSVAAERE-----DVEQHR 63

Query: 62  AHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEER--KNGSRNYETDEVATISASLXXX 119
              Y ALL++L S HPE + K  K  K      EE   +N   N E DE   I  +L   
Sbjct: 64  GQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSE-DEQQNIENALDDV 122

Query: 120 XXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPY 179
                                   DPFE HF++ SE      D  FK+KTV+Y+S+K   
Sbjct: 123 SGGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSSKTD- 181

Query: 180 MHDNEGFIFSKPVIEGLKGSDAVNDTPV-CKGNIHSYFMKKKLKVHNGXXXXXXXXXXXX 238
           + + E  I+SKP +      D     PV  K  + SYF+K+KLK+ N             
Sbjct: 182 VSEEESLIYSKPCL------DDEEVLPVKGKQTLSSYFIKQKLKLANDFQNNGLPLTEIQ 235

Query: 239 XXXXVDPIFQYRDLLFEYEDFSQETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQE 298
               VDP+FQY+D+L+EY+D++ E +YRDLY+LH LNH+YKTRDRILKNN KLQEN+D+E
Sbjct: 236 KEL-VDPMFQYKDMLYEYDDYADEDQYRDLYSLHALNHVYKTRDRILKNNQKLQENNDEE 294

Query: 299 LLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKS 358
           LLDQGFTRPKVL+V PTR+ A+ I+ KI++KSGLDQ DKKSKF+DQF+EDSLPPTSKPKS
Sbjct: 295 LLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKS 354

Query: 359 FQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFL 418
           FQH+F+GNTNDFFVLG+KFTRK+LK+YSNFYQSD+I+CSPLGIQLILENTDKKKRQDDFL
Sbjct: 355 FQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFL 414

Query: 419 SSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTL 478
           SSIE++++DQLHS+E+QN  HV +IFQHINKIP++Q ++DFSRIRMWYIN+QA+ FRQT+
Sbjct: 415 SSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTI 474

Query: 479 IFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSV 538
           +FTKY+SPFANS++NGKC N +GR+KN R I PE+S+I QLGLKVRQ+F RFDL  G+++
Sbjct: 475 VFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTAL 534

Query: 539 DEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYS 598
           DEPDYRFKFFTSV VP I KSTGYEDGILLYIPDYTDF+RVRNY K++T I+FGEI EYS
Sbjct: 535 DEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYS 594

Query: 599 DQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIG 658
           +Q+Q+TSNRA FQ GKVKVLLYTERLHHFRRY+IK VKSVIFYKPP NPEFY E++R IG
Sbjct: 595 NQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIG 654

Query: 659 KNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           KN FLGN D+NISTVRC Y K+D LSLER+VGSKRAAVL   QNE+YEFK
Sbjct: 655 KNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  856 bits (2212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/715 (59%), Positives = 535/715 (74%), Gaps = 12/715 (1%)

Query: 4   KRGRKQLRKITRIGRNRSED---KANGSALEKRGNNDGDEYAEIAMG-----EHEKAADD 55
           KRGRK+LR I R G  +  D     NG ++ +      +E +  A G     E    A D
Sbjct: 16  KRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANGDDVGDEVGDEASD 75

Query: 56  DQEERTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDE-VATISA 114
           D+EE    VYGALL+IL S HPE ++++ +         E++     + E ++    I  
Sbjct: 76  DEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQDESDASEEEEDETQQIEN 135

Query: 115 SLXXXXXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYES 174
           +L                          +DPFE HFN + E  T+KLD +FK   ++Y+S
Sbjct: 136 ALMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDIKYKS 195

Query: 175 TKLPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXXX 234
           TKLP   D E  IFSKPVI+  +    V +  V K +IHSYF+K++LK+ N         
Sbjct: 196 TKLPISED-EYAIFSKPVIKSDEIESPV-ELSVNKSSIHSYFLKQRLKMQNNLMDPKVDP 253

Query: 235 XXXXXXXXVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKLQE 293
                   VDP+FQY+D+L++Y+ + + E EYRDLY+LH+LNH+YKTRD+ILKNN +LQ+
Sbjct: 254 LTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQRLQD 313

Query: 294 NDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPT 353
           N+D E LDQGFTRPKVL+V PTR+TAY +IEKII KSG+DQVDKK KFKDQF+EDSLPP+
Sbjct: 314 NNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDSLPPS 373

Query: 354 SKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKR 413
           SKPKSFQ +FKGNTNDFFVLG+KFTRK +KLYSNFYQSD+I+CSPLGIQ+ILENTDKKKR
Sbjct: 374 SKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKR 433

Query: 414 QDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARL 473
           QDDFLSSIE++++DQLHS+E+QN +H+ +I  HINKIPQ+QHD+DFSR+RMWYINDQA+L
Sbjct: 434 QDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYINDQAKL 493

Query: 474 FRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLF 533
           FRQT++FTKY+SP ANSL+NGKC NWSGR+KN + IS   S+I+++G+K+RQ+F RF+  
Sbjct: 494 FRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQRFETV 553

Query: 534 TGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGE 593
            GS VDEPDYRFKFFTSVTVP I K+TGYEDG L+YIP+YTD++RVRNY KD+T ILFG+
Sbjct: 554 NGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTILFGD 613

Query: 594 ITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQEL 653
           I EYSDQ+Q+ SNR+LFQQG+VKVLLYTERLHH+RRY+IKGVK+V+FY+PP NPEFY E+
Sbjct: 614 INEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEFYTEV 673

Query: 654 IRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           +R IGKNAFLGN DLNISTVRC Y KLD+LSLE IVGSKRA VL  +QNE+YEFK
Sbjct: 674 VRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/713 (58%), Positives = 535/713 (75%), Gaps = 14/713 (1%)

Query: 4   KRGRKQLRKITRIGRNRSEDKA----NGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEE 59
           KRGR++LRKI R    R++D++    +  A E   +   D+ ++I   E +    +D+E 
Sbjct: 18  KRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKISDIG-SEEDNLDVEDEEG 76

Query: 60  RTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYE---TDEVATISASL 116
           +   VY ALL+IL S HPE +R++ + ++   A  +   N + N E    DE   I   L
Sbjct: 77  KKEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYEPVDEQLEIENGL 136

Query: 117 XXXXXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTK 176
                                     +DPFE HFNQ+SE   + L  AFK K+++Y+S K
Sbjct: 137 LGDREDDNDDDSNENEKDDMDSEDE-QDPFESHFNQVSEKYVDDLSNAFKSKSIKYKSVK 195

Query: 177 LPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXXXXX 236
              + D+E +I++KP    + G +A+ ++P    +I+SYF+K++LKV NG          
Sbjct: 196 AS-LGDDESYIYAKPF---MVGEEALVESPYRSSSIYSYFLKQRLKVQNGLLDKKIDPLT 251

Query: 237 XXXXXXVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKLQEND 295
                 +DP+FQY+D+L+EY+ + + E+EYRDLY LH+LNHIYKTRDRILKNN +LQ+N 
Sbjct: 252 CMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDRILKNNQRLQDNP 311

Query: 296 DQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSK 355
           D E LDQGFTRPKVL+V PTR  AY +++KII KSG+DQVDKK KF DQF +DSLPP SK
Sbjct: 312 DTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPESK 371

Query: 356 PKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQD 415
           PKSFQH+FKGNT+DFFV+G+KFTRK +KLYSNFYQSD+I+CSPLGIQ+ILENTDKKKRQD
Sbjct: 372 PKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQD 431

Query: 416 DFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFR 475
           DFLSSIE++V+DQLHS+E+QN +H+ +IF HINKIP +QH++DFSRIRMWYIN+QA+LFR
Sbjct: 432 DFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKLFR 491

Query: 476 QTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTG 535
           QT++FTKY+SP ANSLING+CCN +GR+KN + I  E S+I QLGLKVRQ+F RFD+   
Sbjct: 492 QTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFDIIGN 551

Query: 536 SSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEIT 595
           S ++EPDYRFKFFTSV +P I KS GYEDGIL+YIPDYTDF+R+RNY K++T ILFG+I 
Sbjct: 552 SIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMKEKTTILFGDIN 611

Query: 596 EYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIR 655
           EYS+QRQ+ +NR+LFQQG++KV+LYTERLHH+RRY+IKGVKSV+FYKPP+NPEFY E +R
Sbjct: 612 EYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNETVR 671

Query: 656 CIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
            IGKNAFLGN DLNISTVRC Y KLD LSLERIVG+KRAAVL+ +Q E+YEFK
Sbjct: 672 FIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/717 (58%), Positives = 533/717 (74%), Gaps = 25/717 (3%)

Query: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGN--------NDGDEYAEIAMGEHEKAADD 55
           KRGR++LRKI      RS  +  G + E   +        +D DE +++  G+      +
Sbjct: 18  KRGRQELRKI-----KRSSARTEGGSTETLEDVAEDIDHRSDEDEVSDVDSGDDFDI--E 70

Query: 56  DQEERTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYE---TDEVATI 112
           D+E +   VY ALL+IL S HPE +R+R + +++  A  E  ++   N E    D+   I
Sbjct: 71  DEEGKKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLEI 130

Query: 113 SASLXXXXXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQY 172
              L                          +DPFE HFNQ+ E   +KL  AFK K+V+Y
Sbjct: 131 ENGLLGNHEDDNDDDSSGDEKDIDSEDE--QDPFESHFNQVPEKFVDKLSNAFKTKSVKY 188

Query: 173 ESTKLPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXX 232
           +S K   + D+E +I++KPV+    G +A+ ++P    +I+SYF+K++LKV NG      
Sbjct: 189 KSVK-GSLSDSESYIYAKPVV---IGEEALVESPYRSSSIYSYFLKQRLKVQNGLLDKKT 244

Query: 233 XXXXXXXXXXVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKL 291
                     VDP+FQY+D+L+EY+ + + E EYRDLY LH+LNHIYKTRDRILKNN +L
Sbjct: 245 DPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQRL 304

Query: 292 QENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLP 351
           Q+N D E LDQGFTRPKVL+V PTR  AY +++KII KSG+DQVDKK KF DQF +DSLP
Sbjct: 305 QDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLP 364

Query: 352 PTSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKK 411
           P SKPKSFQH+F+GNTNDFFV+G+KFTRK +KLYSNFYQSD+IVCSPLGIQ+ILENTDKK
Sbjct: 365 PKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKK 424

Query: 412 KRQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQA 471
           KRQDDFLSSIE++V+DQLHS+E+QN +H+ +IF H+NKIP +QH++DFSRIRMWYIN+QA
Sbjct: 425 KRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQA 484

Query: 472 RLFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFD 531
           +LFRQT++FTKY+SP ANSLING+C N +GR+KN + I  E S+I Q GLK+RQ+F RFD
Sbjct: 485 KLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFD 544

Query: 532 LFTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILF 591
           +   S ++EPDYRFKFFTSV +P I KSTGYEDGIL+YIPDYTDF+R+RNY K++T ILF
Sbjct: 545 IIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILF 604

Query: 592 GEITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQ 651
           G+I EYS QRQ+ +NR+LFQQG++KV+LYTERLHH+RRY+IKGVKSV+FYKPP+NPEFY 
Sbjct: 605 GDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYN 664

Query: 652 ELIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           E++R IGKNAFLGN DLNISTVRC Y KLD LSLERIVG+KRAAVL+ +Q EIYEFK
Sbjct: 665 EVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/715 (58%), Positives = 532/715 (74%), Gaps = 20/715 (2%)

Query: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAAD---DDQEER 60
           KRGR+++RKI R    R+ED  + + ++       +  AE A+ +    +D    D+EE+
Sbjct: 18  KRGRQEMRKIKRTTARRTED-VDTNEVDHVAEESVETKAEDAISDAGSESDLDIGDEEEK 76

Query: 61  TAHVYGALLSILNSAHPEIRRKRVKVE-KTTDAVVEERKNGSRNYE-TDEVATISASLXX 118
              VY ALL+IL S HPE +RK+ K   +  +AV +   N + + E  D+   I   L  
Sbjct: 77  QEKVYDALLTILKSEHPEPKRKKTKATGENNEAVDQTGVNENTDSEPVDDQLEIENGLLS 136

Query: 119 XXXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLP 178
                                   +DPFE HFNQ+SE   + +  AFK   ++Y+S K P
Sbjct: 137 DQEDDSDDDGDENEQDEVDSEDE-QDPFESHFNQVSEKYVDDVSNAFKANNIKYKSVKSP 195

Query: 179 YMHDNEGFIFSKPVIEGLKGSDAVNDTPVCK----GNIHSYFMKKKLKVHNGXXXXXXXX 234
            + D+E  I+SKPV+ G       ++TPV +     +I+SYF+K++LK+ NG        
Sbjct: 196 -LGDDESCIYSKPVVNG-------DETPVERPYKSSSIYSYFLKQRLKIQNGLLDKKIDP 247

Query: 235 XXXXXXXXVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKLQE 293
                   VDP+FQY+D+L+EY+ + + E EYRDLYTLH LNHIYKTRDRILKNN +LQ+
Sbjct: 248 LTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTRDRILKNNQRLQD 307

Query: 294 NDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPT 353
           N D E LDQGFTRPKVL+V PTR+ AY +++KII KSG+DQVDKK KF DQF +DSLPP+
Sbjct: 308 NPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKFYDQFRDDSLPPS 367

Query: 354 SKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKR 413
           SKPKSFQH+F+GNT+DFFV+G+KFTRK +KLYSNFYQSD+IVCSPLGIQ+ILENTDKKKR
Sbjct: 368 SKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKR 427

Query: 414 QDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARL 473
           QDDFLSSIE++V+DQLHS+E+QN +H+ +IF HINKIP +QH++DFSRIRMWYIN+QA+L
Sbjct: 428 QDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAKL 487

Query: 474 FRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLF 533
            RQT++FTKY+SP ANSLING+C N +GR+KN + I  E S+I QLGLK+RQ+F RFD+ 
Sbjct: 488 LRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGLKIRQIFQRFDII 547

Query: 534 TGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGE 593
             S ++EPDYRFKFFTSV +P I KSTGYEDGIL+YIPDYTDF+R+RNY K++T ILFG+
Sbjct: 548 GNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGD 607

Query: 594 ITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQEL 653
           I EYS Q+Q+ +NR+LFQQG+VKVLLYTERLHH+RRY+IKGVK+VIFYKPP+NPEFY E 
Sbjct: 608 INEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFYKPPNNPEFYNET 667

Query: 654 IRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           +R IGKNAFLGN DLNISTVRC Y KLD LSLERIVG+KRA VL+ +Q E+YEFK
Sbjct: 668 VRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQKEVYEFK 722

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/717 (58%), Positives = 519/717 (72%), Gaps = 12/717 (1%)

Query: 3   SKRGRKQLRKITRIGRNRSEDKA--NGSALEKRGNNDGDEYAEIA-MGEHEKAADDDQEE 59
            KRGRK+LR + R  +  + D      + +E       D+   ++   E    +D D E 
Sbjct: 6   GKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSDSDAEA 65

Query: 60  RTAHVYGALLSILNSAHPEIRRKRVKVEK---TTDAVVEERKNGSRNYETDEVATISASL 116
           R   VYGALL+IL S HPE ++++ K        D ++    N     E +E   I  ++
Sbjct: 66  RKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHEELEEENEEEQIDNAI 125

Query: 117 XXXXXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTK 176
                                     +DPFE HFNQ  E + N LDAAFK K +QY S K
Sbjct: 126 LDNRTQSDSEDEQDVAAEEFDSEDE-QDPFESHFNQFPETEINTLDAAFKSKQLQYRSVK 184

Query: 177 LPYMH----DNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXX 232
           L         +E  I+S+P + G K           K +I SYF+KK+LK+ N       
Sbjct: 185 LQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLLENKP 244

Query: 233 XXXXXXXXXXVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKL 291
                     VDP+FQY+D+L+EYE++ + E EYR LY LH LNH+YKTRDRILKNN +L
Sbjct: 245 DNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQRL 304

Query: 292 QENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLP 351
           QEN D E LDQGFTRPKVL++APTR+TAY I+  II+KSG+DQVDK+ KFKDQFYEDSLP
Sbjct: 305 QENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSLP 364

Query: 352 PTSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKK 411
           P+SKPKSFQ +FKGNTNDFFVLGMKFTRK +KLYSNFYQSD+IVCSPLG+Q+I+ENTDKK
Sbjct: 365 PSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKK 424

Query: 412 KRQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQA 471
           KRQDDFLSSIE+ ++DQLHS+E+QN +H+ +IF+H+N IP +QHD+DFSRIRMWYINDQA
Sbjct: 425 KRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQA 484

Query: 472 RLFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFD 531
           R FRQT++FTKY+SP ANS+INGKC NWSGR+KN R +S E S I +L L+VRQ+F RF+
Sbjct: 485 RFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFE 544

Query: 532 LFTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILF 591
           +  GS VDEPDYRFKFFTSV +P I KSTGYEDGIL+YIP+YTD++RVRNY K++TRILF
Sbjct: 545 VTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILF 604

Query: 592 GEITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQ 651
           G+I EYS Q+Q+T+NR+LFQQG++KVLLYTERLHH+RRY+IKGVKSVIFYKPPS+PEFY 
Sbjct: 605 GDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYT 664

Query: 652 ELIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           E++R IG+NAFLGN DLNISTVRC Y KLD+L+LE +VG++RA VL   QNEIYEFK
Sbjct: 665 EVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/738 (59%), Positives = 524/738 (71%), Gaps = 42/738 (5%)

Query: 3   SKRGRKQLRKITRIG---RNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEE 59
           SK GRKQLR I +     R  +E+ AN        NN  +  AE  +   E       + 
Sbjct: 20  SKSGRKQLRTIRKASGPRRGLAEESANEE------NNGSETEAEDKLAAPELNEPAQDQR 73

Query: 60  RTAHVYGALLSILNSAHPEIRRKRVKVE-KTTDA----------VVEERKNGSRNYETDE 108
                Y ALL++L + H    R++ K + K T A            E R N     + DE
Sbjct: 74  AGGEAYAALLTLLKAEHGGPARRKTKTDDKKTSADPTSNVKDEEESESRDNEDEEEDEDE 133

Query: 109 VATISASLXXXXXXXXXXXXXXXXXXXXXXXXXXR------------------DPFEYHF 150
            A I  +L                          R                  D  E HF
Sbjct: 134 EAAIENALMDEHTSGDEDDEGDDGSHQDDINGVTREGGDATELAAGFEEEDKPDTLEIHF 193

Query: 151 NQISEMDTNKLDAAFKEKTVQYESTKLPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKG 210
           N +SE DTN LDAAFK K V+Y S KL ++  N+ FI+S+P +     S AV+  P    
Sbjct: 194 NSVSEKDTNALDAAFKAKEVRYRSCKL-HVDKNQEFIYSRPTLVNEPAS-AVS-APDGSQ 250

Query: 211 NIHSYFMKKKLKVHNGXXXXXXXXXXXXXXXXVDPIFQYRDLLFEYEDFSQETEYRDLYT 270
           +++SYF+K++LK+ N                 VDP+FQY+DLL+EYED+ +ETEYRDLY 
Sbjct: 251 SLNSYFIKQRLKIQNDLLDSQDKLTPLQKQI-VDPMFQYQDLLYEYEDYDKETEYRDLYA 309

Query: 271 LHILNHIYKTRDRILKNNHKLQENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKS 330
           LH+LNHIYKTRDRILKNN +LQEN DQELLDQGFTRPKVL+VAPTR+ AYDI+ KII KS
Sbjct: 310 LHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILSKIIQKS 369

Query: 331 GLDQVDKKSKFKDQFYEDSLPPTSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQ 390
           GLDQVDKK+KFKDQF++++LPP+ KPKSFQ +FKGNTNDFFVLG KFTRKT+KLYSNFYQ
Sbjct: 370 GLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKLYSNFYQ 429

Query: 391 SDVIVCSPLGIQLILENTDKKKRQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKI 450
           SD+I+CSPLGIQLILENTDKKKRQDDFLSSIE+LVVDQLHS+EFQN  H+ SIF+HINKI
Sbjct: 430 SDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIFEHINKI 489

Query: 451 PQKQHDSDFSRIRMWYINDQARLFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYIS 510
           PQ+QHD+DFSRI+MWYINDQA+LFRQTLIFTK+ SPFANSLINGKC N++GR+KN R I 
Sbjct: 490 PQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWKNHRVIF 549

Query: 511 PEKSAINQLGLKVRQVFHRFDLFTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYI 570
           PE S++ QLG++ R +F RFDL   S  +EPD RFK F SV VP I KSTGYEDGILLYI
Sbjct: 550 PENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYEDGILLYI 609

Query: 571 PDYTDFLRVRNYFKDQTRILFGEITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRY 630
           PDYTDF+RVRNY +++T ILFG+I EYS+QRQ+TSNRA+FQQG+VKVLLYTERLHHFRRY
Sbjct: 610 PDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERLHHFRRY 669

Query: 631 QIKGVKSVIFYKPPSNPEFYQELIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVG 690
           +IKGVK+VIFYKPP+NPEF++E+ R +GK+AFLG ADLNIS VRC + KLD LSLERIVG
Sbjct: 670 EIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLSLERIVG 729

Query: 691 SKRAAVLTRSQNEIYEFK 708
           ++RAAVLT   NE YEFK
Sbjct: 730 TERAAVLTHGPNETYEFK 747

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/715 (58%), Positives = 526/715 (73%), Gaps = 17/715 (2%)

Query: 4   KRGRKQLRKITRIGRNR--SEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEERT 61
           KRGR++LR I R    +  S++  N S +      D +E       E E+  D D+EE+ 
Sbjct: 16  KRGRQELRTIRRSAGAKVSSQEVFNSSIV------DDEEQELNESNESEQEEDIDEEEKK 69

Query: 62  AHVYGALLSILNSAHPEI---RRKRVKVEKT-TDAVVEERKNGSRNYETDEVATISASLX 117
             VYGALL+IL S HPE+   ++KRV   K+  D   E   +  ++ E DE   I   L 
Sbjct: 70  NKVYGALLTILKSEHPELKKKKKKRVDDSKSGEDKGSELASDDGKDDEIDEAQQIEDGLA 129

Query: 118 XXXXXXXXXXXXXXXXXXXXX---XXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYES 174
                                       +DPFE HFNQ+SE   + L+ AF   +V+Y+S
Sbjct: 130 RGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGSVKYKS 189

Query: 175 TKLPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXXX 234
           TK   + DN+  I S P I G + ++   D+     +IHSYF+K++L+V N         
Sbjct: 190 TK-SVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDMLDSKKDP 248

Query: 235 XXXXXXXXVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKLQE 293
                   VDP+FQYRD+L EY  + + E EYRDLY LH LNH+YKTRDRILK+N +LQ+
Sbjct: 249 LGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRILKDNGRLQD 308

Query: 294 NDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPT 353
           N D E  DQGFTRPKVL+V PTR+TAY++I KII KSGLDQVDKK KF DQF++++LPP+
Sbjct: 309 NSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHDETLPPS 368

Query: 354 SKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKR 413
           SKPKSFQH+FKGNTNDFFVLG+KFTRK +KLYSNFYQSD+IVCSPLG+Q+I+ENTDKK R
Sbjct: 369 SKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDKKNR 428

Query: 414 QDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARL 473
           QDDFLSSIE+L++DQLHS+E+QN AHV +IF H+NKIP++QH++DFSRIRMWYINDQARL
Sbjct: 429 QDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYINDQARL 488

Query: 474 FRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLF 533
           FRQT+IFTKYV+P AN+LIN +C NW+GR+KN   I PE SAI+QLGLKV+Q F RFD+ 
Sbjct: 489 FRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTFQRFDMM 548

Query: 534 TGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGE 593
            GS +DEPDYRFK F+SV +P I KST Y DGIL+YIPDYTD++R+RNY K++T +LFG+
Sbjct: 549 GGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKTTLLFGD 608

Query: 594 ITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQEL 653
           I EYS+QR++ SNR+LFQQG+VKVLLYTERLHH+RRY++KGVKSV+FYKPP+NPEFY E+
Sbjct: 609 INEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNPEFYNEV 668

Query: 654 IRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           +R IGK+AFLGNADLNISTVR  YCKLD LSLERIVGSKRA +L  +QNE+YEF+
Sbjct: 669 VRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEFQ 723

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/722 (57%), Positives = 527/722 (72%), Gaps = 25/722 (3%)

Query: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADD-------- 55
           KRGR++LR I R    +S   +N +      +ND +E  +    E E+  +D        
Sbjct: 26  KRGRQELRTIRRSAAKKSRYDSNVTE-----HNDTEELLQEESEEGEEDEEDDQSEQEEV 80

Query: 56  DQEERTAHVYGALLSILNSAHPEIRRKRVKVEKT-TDAVVEERKNGSRNYET-------D 107
           D++ER   VYGALL+IL + HPE + KR   EK   + V +   N + + ET       D
Sbjct: 81  DEDERKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSIIEED 140

Query: 108 EVATISASLXXXXXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKE 167
           E   I   L                          +DPFE HFN+ +E   +KL AAF+ 
Sbjct: 141 ETEQIENGLLDRDDEQSDDDQLNDSNDVESDDE--QDPFESHFNKPTEQFVDKLHAAFES 198

Query: 168 KTVQYESTKLPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGX 227
           + ++Y++TK+  + D+   I SKP I G +       +     +I SYF+K++LK+ N  
Sbjct: 199 REIKYKATKI-VIDDSHSVISSKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNL 257

Query: 228 XXXXXXXXXXXXXXXVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILK 286
                          +DP+FQY+D+L+EY+ + + E EYRDLY LH LNH+YKTRDRILK
Sbjct: 258 LNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILK 317

Query: 287 NNHKLQENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFY 346
           NN +LQ+N D E LDQGFTRPKVL+V PTR+TAY++ +KII KSGLDQVDKK KF DQF 
Sbjct: 318 NNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFK 377

Query: 347 EDSLPPTSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILE 406
           +DSLPP+SKPKSFQ +FKGNTNDFFVLG+KFTRK +KLYSNFYQSD+IVCSPLG+Q+I+E
Sbjct: 378 DDSLPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVE 437

Query: 407 NTDKKKRQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWY 466
           NTDKKKRQDDFLSSIE+L+VDQLHSLE+QN AH+ +IF H+NKIP +QHD+DFSRIRMWY
Sbjct: 438 NTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWY 497

Query: 467 INDQARLFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQV 526
           INDQA+LFRQT++FTKYVSP AN++IN +C NW GR+KN + ++PE S+I +LGLK++Q+
Sbjct: 498 INDQAKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQI 557

Query: 527 FHRFDLFTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQ 586
           F RFD+  GS VDEPDYRFK FTSV +P I KST Y+DGIL+YIPDYTD++R+RNY K++
Sbjct: 558 FQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEK 617

Query: 587 TRILFGEITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSN 646
           TRILFG+I EYS+QR++ SNR+L QQG+VKVLLYTERLHH+RRY+IKGVKSV+FYKPP+N
Sbjct: 618 TRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTN 677

Query: 647 PEFYQELIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYE 706
           PEFY E++R IGKNAFLGN DLNISTVR  YCKLD LSLERIVG+KRA +L  +QNE+YE
Sbjct: 678 PEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYE 737

Query: 707 FK 708
           FK
Sbjct: 738 FK 739

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/708 (59%), Positives = 516/708 (72%), Gaps = 18/708 (2%)

Query: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADD--DQEERT 61
           KRGRK LR I R  RN  E        E       +E  E++    E A ++  +QE+  
Sbjct: 17  KRGRKDLRSIRR-ARNDKE-----PVEEPEIPVASEEDGELSEDSEEDATNEVQEQEDSK 70

Query: 62  AHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISASLXXXXX 121
              YGALL+IL S HPE  R+R + +K  D  +++  +       DE   + A+L     
Sbjct: 71  EKAYGALLTILKSEHPE-DRQRERRKKKQD--LQDPSSSDDELSEDEKGEVEANLVDTPG 127

Query: 122 XXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPYMH 181
                                RDPFE HFN  SE   + LD A+K+K +  +S K+  + 
Sbjct: 128 EEEPQSEEELSEGDEDESEDERDPFESHFNMQSE-SIDSLDEAWKQKKIVNKSGKI-RVD 185

Query: 182 DNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXXXXXXXXXX 241
           D+E  I++K     L G     + P  KG++ SY +K+KLK+ N                
Sbjct: 186 DDESLIYTKT----LAGKGQEFELPSHKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRK 241

Query: 242 XVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQELL 300
            VDPIFQYRDLL+EYED+ Q E EYRDLY LH+LNHIYKTRDRILK+N +L  N D E L
Sbjct: 242 IVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRILKDNQRLATNPDGEFL 301

Query: 301 DQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSFQ 360
           DQGFTRPKVL+VAPTR+TAY I+ K+I+KSGLDQVDKKSK +DQF+ED LPP+SKPKSF+
Sbjct: 302 DQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFR 361

Query: 361 HVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLSS 420
           H FKGNTNDFFVLG+KFTRK ++LYSNFYQSD+IVCSPLG+QLILENTD+KKRQDDFLSS
Sbjct: 362 HTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSS 421

Query: 421 IEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLIF 480
           IE++++DQL+S+EFQN +H+ +IF H+NKIP++QHD+DF R+RMWYIN+QA+L RQTLIF
Sbjct: 422 IELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIF 481

Query: 481 TKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVDE 540
           T+YV+P AN L+NGKC N  GR+KN   I+ E+S++++LG +VRQ+F R DL   S VDE
Sbjct: 482 TRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDE 541

Query: 541 PDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSDQ 600
           PDYRF+FFTSV VP I KSTGYEDGILLYIPDY DF+RVRNY KD+T ILFG+I EYSD 
Sbjct: 542 PDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDV 601

Query: 601 RQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGKN 660
           RQ+TS R+LFQQG++KVLLYTERLHHFRRY+IKGVKSVIFY+PPSNPEFY E++R IGK+
Sbjct: 602 RQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKS 661

Query: 661 AFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           AFLG+ DLNISTVRC Y KLD L+LERIV SKRAAVLT  QNEIYEFK
Sbjct: 662 AFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/733 (57%), Positives = 519/733 (70%), Gaps = 52/733 (7%)

Query: 3   SKRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEERTA 62
           +K GRKQLR I +  R  S+ K     +E       +E  E+     E+     ++E   
Sbjct: 20  TKGGRKQLRSIRKASRYDSK-KPEDEPVE----TPEEEINEVEDVHEERTEVSRKQESNG 74

Query: 63  HVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEER------------------------K 98
             Y ALL++L + H    +K+VK     +   E +                        +
Sbjct: 75  EAYAALLTLLKAEHG-TGKKKVKAGPQGEGSGESQISEISPEAEQDEEEEEEEEEETAIE 133

Query: 99  NGSRNY---ETDEVATISASLXXXXXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISE 155
           NG   +   + DE A I                               DP E HFN + E
Sbjct: 134 NGLAEHLDSDGDEAAEIG---------------DEEDDNNGDQDENASDPLEAHFNSVPE 178

Query: 156 MDTNKLDAAFKEKTVQYESTKLPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSY 215
            DT+ LD AFK K V+Y S+K+  +  NE FI+S+P +  L+    +   P    ++  Y
Sbjct: 179 KDTDALDQAFKTKQVRYRSSKIK-ISKNEEFIYSRPDL-NLESRTPIQ-VPQGTQSLSPY 235

Query: 216 FMKKKLKVHNGXXXXXXXXXXXXXXXXVDPIFQYRDLLFEYEDFSQETEYRDLYTLHILN 275
           F+K++LK+ N                 VDPIFQY+DLL+EYE++ QETEYRDLY LH L+
Sbjct: 236 FIKQRLKIQNDLLDSKNNLTPLQKKI-VDPIFQYQDLLYEYENYDQETEYRDLYALHALD 294

Query: 276 HIYKTRDRILKNNHKLQENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQV 335
           HIYKTRDRILKNN +LQ+N DQE+LDQGFTRPKVL+V PTR+ AY ++ KII+KSGLDQV
Sbjct: 295 HIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGLDQV 354

Query: 336 DKKSKFKDQFYEDSLPPTSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIV 395
           DKKSKF+DQFY+DSLPP  KPKSFQ VFKGNTNDFFVLG KFTRKT+KLYSNFYQSD+IV
Sbjct: 355 DKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDIIV 414

Query: 396 CSPLGIQLILENTDKKKRQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQH 455
           CSPLGIQLILENTDKKKRQDDFLSSIE+LV+DQLHS+EFQN  H+ SIF+HINKIPQ+QH
Sbjct: 415 CSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQQQH 474

Query: 456 DSDFSRIRMWYINDQARLFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSA 515
           D+DFSRI+MWYINDQA+LFRQTLIFT++ +PFANSLINGKC N++GR+KN   +  EKS+
Sbjct: 475 DADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEKSS 534

Query: 516 INQLGLKVRQVFHRFDLFTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTD 575
           ++QLG++ R VF RFD+  G++ DEPD+RFK F SV VP I +STGYEDGILLYIPDYTD
Sbjct: 535 LSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPDYTD 594

Query: 576 FLRVRNYFKDQTRILFGEITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGV 635
           F+RVRNY +++T ILFG+I+EYS+QRQ+T+NRALFQQG+VKVLLYTERLHHFRRY+IKGV
Sbjct: 595 FIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEIKGV 654

Query: 636 KSVIFYKPPSNPEFYQELIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAA 695
           K+VIFYKPP+NPEF++E +R + K+AFLG ADLNIS VRC Y KLD L+LERIVG++RAA
Sbjct: 655 KTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGTERAA 714

Query: 696 VLTRSQNEIYEFK 708
           +LT   NE YEFK
Sbjct: 715 ILTHGPNETYEFK 727

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/712 (56%), Positives = 522/712 (73%), Gaps = 26/712 (3%)

Query: 4   KRGRKQLRKITRIGRNRSEDKAN----GSALEKRGNNDGDEY-AEIAMGEHEKAADDDQE 58
           KRGRK+LR I R  RN++ ++       S  E + +++G ++  EIA        ++D+E
Sbjct: 18  KRGRKELRSIRRPQRNKAHEEPEHLNESSEGEVKNHHNGMQHNEEIA------NVEEDEE 71

Query: 59  ERTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISASLXX 118
            +   VYGALL+ILNS HP+ + K+       +  V+ RK  S +   ++       L  
Sbjct: 72  NKRRKVYGALLTILNSEHPKPKPKQ-------EVTVQSRKEDSESDVEEDERDEVEQLED 124

Query: 119 XXXXXXXX-XXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKL 177
                                    +D F+ HFNQ+ E   +KLDAAFKE+ ++Y+S K+
Sbjct: 125 NLARVDENPSEDDLSEDADEESDDEQDTFDSHFNQVPENVVDKLDAAFKERQLKYKSAKV 184

Query: 178 PYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXXXXXX 237
           P + +NE  ++SKP++  L+      + P    ++ SY  K++LK+ N            
Sbjct: 185 P-IGENESMVYSKPLL--LEDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEHENLTSTQR 241

Query: 238 XXXXXVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDD 296
                VDP+ QY DLL+EY  + + E EYRDLY LH+LNH+YKTRD+ILKNN ++ +N D
Sbjct: 242 TL---VDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPD 298

Query: 297 QELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKP 356
            + LDQGFTRPKVL+V PTR+TAY ++EKIIDKSG+DQ+DKK KF+DQF+E+SLPP+SKP
Sbjct: 299 ADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPPSSKP 358

Query: 357 KSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDD 416
           KSFQHVFKGNTNDFFVLG+KFTRK +KLYSNFYQSD+I+CSPLGIQLILENTDKKKRQDD
Sbjct: 359 KSFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDD 418

Query: 417 FLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQ 476
           FLSSIE+ + DQLHS+E+QN +HV++IF H+N IPQ+QHD+DF R+R+WYIN+QA+LFRQ
Sbjct: 419 FLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQ 478

Query: 477 TLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGS 536
           T+IFTKYVSP AN+LIN KC N +GR+KN  +I P +S+I +LGLKVRQ+F R DL   S
Sbjct: 479 TMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAAS 538

Query: 537 SVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITE 596
            ++E D+RFKFFTSV +P I KSTGYEDGIL+YIPDY DF+RVRNY K++T I+FG+I E
Sbjct: 539 ILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINE 598

Query: 597 YSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRC 656
           YS+Q+Q+ SNRALFQQG+ KVLLYTERLHHFRRY+IKGVKSV+FY+PP+NPEFY E++R 
Sbjct: 599 YSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRF 658

Query: 657 IGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           I K+A LG  DLNISTVR  Y KLD +SLERIVG+KRAA+LT  QNE+YEFK
Sbjct: 659 IAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/720 (56%), Positives = 514/720 (71%), Gaps = 31/720 (4%)

Query: 4   KRGRKQLRKI-------------TRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHE 50
           KRGR Q R I             TRI +   ED+   S+ E   N   D+ AE+      
Sbjct: 16  KRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDE---SSDEDVSNTSIDKEAEVT----- 67

Query: 51  KAADDDQEERTAHVYGALLSILNSAHPEIR-RKRVKVEKTTDAVVEERKNGSRNYETDEV 109
                +  E+   VY AL++IL S H E + R  +      + + +E  +    +ET+E 
Sbjct: 68  -----EDLEKKKQVYDALVTILKSEHKEPKMRDNLNETSKEEHLTDEDLDEDEKFETEEQ 122

Query: 110 ATISASLXXXXXXXXXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKT 169
              +  L                           DPF+ HFNQ +E  TNK   AFK K 
Sbjct: 123 EIENNLLSIKDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKNKQ 182

Query: 170 VQYESTKLPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXX 229
           ++Y S K   +++ E  I+S+P I  L+       +PV K +IHSY +KK+LK++N    
Sbjct: 183 IKYRSIKYK-INEYESSIYSEPRI--LEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLD 239

Query: 230 XXXXXXXXXXXXXVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNN 288
                        VDP+FQY+D+L+EY ++ + E EYR LY LH+LNHIYKTRDRILKNN
Sbjct: 240 PAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNN 299

Query: 289 HKLQENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYED 348
            K+Q+N D E LDQGFTRPKVL+VAPTR+  Y I+ +II KSG+DQ+DKKSKF+DQFYE+
Sbjct: 300 SKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEE 359

Query: 349 SLPPTSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENT 408
           SL P SKPKSFQ VFKGN+ND+FVLG+KFTRK +KLYSNFYQSD+IVCSPLG+ +ILENT
Sbjct: 360 SLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENT 419

Query: 409 DKKKRQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYIN 468
           DKKKRQDDFLSSIE++++DQLHS+EFQN +HV SIF+HINKIP++QHD+DFSRI+MWYIN
Sbjct: 420 DKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYIN 479

Query: 469 DQARLFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFH 528
           DQA+LFRQT+IFTKY+SP AN  +NGKC NWSGR+KN + I+P +S+I QLGL+V+Q+FH
Sbjct: 480 DQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFH 539

Query: 529 RFDLFTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTR 588
           RFD+  GS VDEPDYRFK+FTSV V  I KST YEDG+L+YI DYTD++RVRNY K++T 
Sbjct: 540 RFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTT 599

Query: 589 ILFGEITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPE 648
           ILFG+I EYSDQ+QV SNRALFQQ +VKVLLYTERLHHFRRY+IKGVK+++FYK P+NPE
Sbjct: 600 ILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPE 659

Query: 649 FYQELIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           FY E++R IGKNAF GN D+NIS VR  Y KLD L+LERI+G+KRAAVLT  QNE YEFK
Sbjct: 660 FYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/716 (55%), Positives = 525/716 (73%), Gaps = 19/716 (2%)

Query: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEE---- 59
           KRGR QLR I R    +  +         + N++      +  GE  ++  DD ++    
Sbjct: 9   KRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGEEAESESDDAKDEEDV 68

Query: 60  --RTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRN-YETDEVATISASL 116
             +   VYGALL+IL S HP    ++ K +K  +   E+  N S + Y   +   I   L
Sbjct: 69  GKKRNQVYGALLTILKSEHP----EKKKQKKKFNQEKEDAYNASDDEYNVSDKQEIENGL 124

Query: 117 XXXXXXXXXXXXXXXXXXXXXXXXXXRDP-FEYHFNQISEMDTNKLDAAFKEKTVQYEST 175
                                         F+ HFNQ+ E   +K+   F  K ++Y S 
Sbjct: 125 EDQQDDNEDENENDMENMENDDESDDDTDLFDIHFNQVPENVVDKISNGFDNKKIKYVSK 184

Query: 176 K--LPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXX 233
           K  LP+ H+ + FI+SKP+++   G+    ++P+ K ++ SYF+KK+L++ N        
Sbjct: 185 KIQLPH-HEKDFFIYSKPIVDD--GNKHKVESPIKKSSLDSYFIKKRLEITNNLLDGKDN 241

Query: 234 XXXXXXXXXVDPIFQYRDLLFEYEDF-SQETEYRDLYTLHILNHIYKTRDRILKNNHKLQ 292
                    VDP+FQY D+L EYE++ S E EYR+LYTLHILNH+YKTRD++LK+N +LQ
Sbjct: 242 LTKLQKSL-VDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLKDNQRLQ 300

Query: 293 ENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPP 352
           EN++ E LDQGFTRPKVL+V PTR+TAY+++E II KSGLDQV+KK KFK QF+EDSLPP
Sbjct: 301 ENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFFEDSLPP 360

Query: 353 TSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKK 412
           +SKPKSFQ +FKGNTNDFFVLG+KFTRK LKLYSNFYQSDVI+CSPLG+ +I ENTDKKK
Sbjct: 361 SSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITENTDKKK 420

Query: 413 RQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQAR 472
           +QDDFLSSIE+ ++DQLHS+E+QN +H+++IF+H+NKIP++QHD+DFSRIRMWYINDQAR
Sbjct: 421 KQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWYINDQAR 480

Query: 473 LFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDL 532
           LFRQT+IFTKYVSP AN++INGKC N +GR++N+  ++ E+S++ +LGLK+RQ+F RFDL
Sbjct: 481 LFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQIFQRFDL 540

Query: 533 FTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFG 592
             G+  DEPD+RFKFF SV +  I KSTGYEDGIL+YIP+Y+D++RVRNY K++T +LFG
Sbjct: 541 VGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEKTTLLFG 600

Query: 593 EITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQE 652
           +I EYSDQR++ SNR+LFQQG+VKVLLYTERLHH+RRY+IKGVKSVIFY PP+NPEFY E
Sbjct: 601 DINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTNPEFYNE 660

Query: 653 LIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           ++R IGKNAFLGN D+NI+TVR  Y KLDSLSLERIVG++RAAVL+R++NE+YEFK
Sbjct: 661 VVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYEFK 716

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/706 (56%), Positives = 510/706 (72%), Gaps = 15/706 (2%)

Query: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEERTAH 63
           KRGR +LR I R   NRS+   +   +     N+    +     E    A+ +  +R   
Sbjct: 13  KRGRTELRSIRR--PNRSQHSKHDQQVVHESENEDSLESSSDDDEDIAQAEAENSDRKEK 70

Query: 64  VYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISASLXXXXXXX 123
           VYGALL+ILNS HPE  RK+ K   +TD V         + + +    +++         
Sbjct: 71  VYGALLTILNSEHPE--RKKHK-SHSTDFV------KEIDEQEEIEQGMASESEEEDEEN 121

Query: 124 XXXXXXXXXXXXXXXXXXXRDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPYMHDN 183
                               D FE HFN +S+   + + A FK+K ++Y+S K   +   
Sbjct: 122 DEEESNEGDEEEEEEPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYS-LDKK 180

Query: 184 EGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXXXXXXXXXXXV 243
           E  IF KP++  L   D   D PV   +  SYF+K++LK+ N                 +
Sbjct: 181 ESAIFGKPLL--LTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLL 238

Query: 244 DPIFQYRDLLFEYEDF-SQETEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQELLDQ 302
           DP+FQY+D+L EY ++ + E EYR+LY+LH+LNHIYKTRD+ILK+N +LQENDD E LDQ
Sbjct: 239 DPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQ 298

Query: 303 GFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSFQHV 362
           GFTRPKVL+V PTR+TAY ++E II+KSGLDQ+DKK KFKDQF++DSLPPTSKPKSF+HV
Sbjct: 299 GFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHV 358

Query: 363 FKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLSSIE 422
           FKGNTNDFFVLGMKFTRK +KLYSNFYQSD+I+CSPLGIQ+ILENTDKKKRQDDFLSSIE
Sbjct: 359 FKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIE 418

Query: 423 MLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLIFTK 482
           +++VDQLHS+E+QN +HV +I +HINKIPQ+Q ++DFSRIRMWYINDQA+  RQT++FT+
Sbjct: 419 VMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTR 478

Query: 483 YVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVDEPD 542
           Y+SP AN++INGKC N +GR+KN + IS E S+I QLG+K++Q+F RFDL  G+ VDE D
Sbjct: 479 YISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESD 538

Query: 543 YRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSDQRQ 602
           YRFK+FTSV +  I KSTGYEDGIL+YIP+YTD++R+RNY K++T ILF EI EYS Q+Q
Sbjct: 539 YRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQ 598

Query: 603 VTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGKNAF 662
           + SNR++FQQG+ KVLLYTERLHH+RRY++KG+KSVIFYKPP+NPEFY E+IR   KNAF
Sbjct: 599 LDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAF 658

Query: 663 LGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
           LG +D+NIST+R  Y KLD L+L+RIVGSKRAA+L   QNE Y+FK
Sbjct: 659 LGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/713 (55%), Positives = 507/713 (71%), Gaps = 23/713 (3%)

Query: 4   KRGRKQLRKITRIGRNRSEDKANGSALEKRGNNDGDEYAEIAMGEHEKAADD-DQEERTA 62
           KRGRK+LR I R  R + E +A+ + +E  G+       E      EK  DD ++E+   
Sbjct: 3   KRGRKELRSIRRAKRTKIEPEAD-AGVESSGS-----VLEAGPAVEEKVQDDGEKEDDKE 56

Query: 63  HVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISASLXXXXXX 122
            VY ALL+IL S H E + K  +     ++  EE +     Y  D  A   +        
Sbjct: 57  QVYNALLTILKSEHKEDKVKTHRDHDEEESEAEEEEQAEDQY-NDAFADGESD-----DE 110

Query: 123 XXXXXXXXXXXXXXXXXXXXRDPFEYHFN-QISEMDTNKLDAAFKEKTVQYESTKLPYMH 181
                               +DPF+ HFN + +      L  A K+  ++Y+S KL    
Sbjct: 111 DDDEDEQAQEQEEIESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGS 170

Query: 182 DNEG-----FIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGXXXXXXXXXX 236
            +E       IFS P IEG   +  + D P  K ++ SYF+KK+L++ N           
Sbjct: 171 ADEDQVQEDAIFSVPYIEG--ETPKIED-PKLKCSLSSYFLKKRLRIQNNLLDTESNALT 227

Query: 237 XXXXXXVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKLQEND 295
                 VDP+ QY+D+L+EY+ + + E EYRDLYTLH+LNH+YKTRD+I+KNN KLQ+N 
Sbjct: 228 DLQRKIVDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNP 287

Query: 296 DQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSK 355
           D E LDQGFTRPKVL++APTR++AY I+ K+I+KSGLDQVDKK KF+DQFY+ S PP+SK
Sbjct: 288 DSEFLDQGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSK 347

Query: 356 PKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQD 415
           PKSFQH+FKGNTND+FVLG+KFTRK +KLYSNFYQSD+IVCSPLG+Q+I+ENTDKKKRQD
Sbjct: 348 PKSFQHIFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQD 407

Query: 416 DFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFR 475
           DFLSS+E+ ++DQ HS+E+QN  H+ +IF H+NKIPQ+QHD+DFSRIRMWYINDQA+ FR
Sbjct: 408 DFLSSVEVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFR 467

Query: 476 QTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTG 535
           QT+IFTKY+SP ANSL+N KC N  GR+KN + +S E S++  +GLKVRQ+F RF++   
Sbjct: 468 QTMIFTKYISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGN 527

Query: 536 SSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEIT 595
           S  DEPDYRFKFFTSV +  I KSTGY+DG L+YIP+Y+D++RVRNY K++T ILFG+I 
Sbjct: 528 SVADEPDYRFKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDIN 587

Query: 596 EYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIR 655
           EYS+QR +TSNR LF QG++KVLLYTERLHHFRRY++KGVK+V+FYKPPS+PEFY+E++R
Sbjct: 588 EYSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVR 647

Query: 656 CIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708
            IGK  FLG+ADLNISTVRC Y KLD L+LE+IVG+KR  VLT  QNE YEFK
Sbjct: 648 YIGKTVFLGDADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>ZYRO0D05346g Chr4 (458096..461377) [3282 bp, 1093 aa] {ON} similar
           to uniprot|P31380 Saccharomyces cerevisiae YAL019W FUN30
           Protein whose overexpression affects chromosome
           stability potential Cdc28p substrate homolog of Snf2p
          Length = 1093

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 23  DKA--NGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEERTAHVY--GALLSILNSA 75
           DKA  N   ++KRG +DG+  AE  M   E+ + D+ EERT  V     +L  LN+A
Sbjct: 240 DKARENHMKMKKRGGSDGEATAEEEMSGDEEGSADEYEERTPEVNIDEQILHFLNTA 296

>TPHA0B01790 Chr2 complement(396879..403103) [6225 bp, 2074 aa] {ON}
            Anc_4.310 YLR430W
          Length = 2074

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 271  LHILNHIYKTRDRILKNNHKLQ-ENDDQELLDQGFTRPKVLVVAPTRNTAYDII 323
            L I+ HI  T+D + KN  K+  E +    L+Q   R KVL+ AP+ N A D I
Sbjct: 1373 LGIVGHILTTQDALPKNIIKVPGEQNSSPALEQTLKRKKVLICAPS-NAAVDEI 1425

>Kwal_26.7163 s26 (243008..244876) [1869 bp, 622 aa] {ON} YAL016W
           (TPD3) - protein phosphatase 2A regulatory subunit A
           [contig 47] FULL
          Length = 622

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 9/109 (8%)

Query: 376 KFTRKTLKLYSNFYQSDVIVCS-------PLGIQLILENTDKKKRQD-DFLSSI-EMLVV 426
           KF ++ L LY    Q D  +         P+ I L+ +N D     D D++S + + +V 
Sbjct: 177 KFRKELLALYLQLVQDDTPMVRRAAGKNLPVLIDLLTQNPDLSTSDDWDYISGMFQKIVS 236

Query: 427 DQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFR 475
           D   S++F     ++SI +  NK     H  D  R  +  I D+A   R
Sbjct: 237 DTQDSVKFLAVDVLVSILKFFNKKNDTTHSKDLLRSAIQLITDEAWRVR 285

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,718,608
Number of extensions: 3549719
Number of successful extensions: 11522
Number of sequences better than 10.0: 35
Number of HSP's gapped: 11847
Number of HSP's successfully gapped: 41
Length of query: 708
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 591
Effective length of database: 40,065,477
Effective search space: 23678696907
Effective search space used: 23678696907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)