Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_33302.291ON72722971e-36
ADL210W2.291ON72722571e-30
NDAI0G006902.291ON72722441e-28
TPHA0C034302.291ON72722413e-28
NCAS0G037602.291ON72722406e-28
SAKL0E07568g2.291ON72722397e-28
KAFR0H032802.291ON72722399e-28
TDEL0G022102.291ON72722381e-27
Cgla_YGOB_Anc_2.2912.291ON72722381e-27
ZYRO0A01980g2.291ON72722381e-27
TBLA0B069702.291ON72712381e-27
Kpol_1003.412.291ON72722362e-27
KLLA0E08251g2.291ON72722329e-27
KNAG0H019702.291ON72722293e-26
Kwal_YGOB_Anc_2.2912.291ON72722283e-26
Smik_14.3062.291ON72722284e-26
YNL024C-A (KSH1)2.291ON72722284e-26
KLTH0G10472g2.291ON72722275e-26
Skud_14.3042.291ON72722275e-26
Suva_14.3222.291ON72722241e-25
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3330
         (72 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to ...   119   1e-36
ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic homo...   103   1e-30
NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291...    99   1e-28
TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291...    97   3e-28
NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}...    97   6e-28
SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON...    97   7e-28
KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}...    97   9e-28
TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291...    96   1e-27
Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72...    96   1e-27
ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly s...    96   1e-27
TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON} Anc_2.2...    96   1e-27
Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON} (99502..9...    96   2e-27
KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON...    94   9e-27
KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}...    93   3e-26
Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72 a...    92   3e-26
Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON...    92   4e-26
YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON} ...    92   4e-26
KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly s...    92   5e-26
Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON...    92   5e-26
Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON...    91   1e-25

>Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to
          Ashbya gossypii ADL210W
          Length = 72

 Score =  119 bits (297), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 58/72 (80%), Positives = 58/72 (80%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALFKF              TYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL
Sbjct: 1  MSALFKFSSLLQIILLLICSSTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACIVMVANQFNS
Sbjct: 61 ACIVMVANQFNS 72

>ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL024CX; YNL024CX
          was overlooked in Saccharomyces cerevisiae
          Length = 72

 Score =  103 bits (257), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 51/72 (70%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALFKF              TYVH QWPSLLERYK+H VL IFWKFARIGERASPYVS+
Sbjct: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60

Query: 61 ACIVMVANQFNS 72
          ACI M  NQ NS
Sbjct: 61 ACIAMAINQINS 72

>NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score = 98.6 bits (244), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 49/72 (68%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TYVH QWPS+L+RYK HG L  FWK ARIGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYVHSQWPSILDRYKDHGALGAFWKMARIGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  NQFNS
Sbjct: 61 ACIIMAINQFNS 72

>TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score = 97.4 bits (241), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 49/72 (68%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TY+H QWPSL +RYK  GVLS FWK +RIGERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSSTYIHSQWPSLFDRYKDTGVLSTFWKLSRIGERASPYVSI 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  NQFNS
Sbjct: 61 ACIIMAVNQFNS 72

>NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score = 97.1 bits (240), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 48/72 (66%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TYVH QWPSLL+RYK H  L  FWK ARIGERASPYVSL
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  NQFNS
Sbjct: 61 ACIIMAINQFNS 72

>SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON}
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping, microarray-based
          expression analysis, and genome-wide homology searching
          Length = 72

 Score = 96.7 bits (239), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 51/72 (70%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TY+H QWPSLL+RYK HG+L++FWKFAR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI M  +QF S
Sbjct: 61 ACICMAISQFKS 72

>KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score = 96.7 bits (239), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 45/72 (62%), Positives = 48/72 (66%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TY+H QWPSLLERYK H  L IFWK AR+GER SPYVSL
Sbjct: 1  MSALFNFSSLLQVLLLLICSCTYIHTQWPSLLERYKDHEALGIFWKMARVGERGSPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  NQFNS
Sbjct: 61 ACILMAVNQFNS 72

>TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score = 96.3 bits (238), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 45/72 (62%), Positives = 49/72 (68%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TYVH QWPSLL+RYK HGV   FWK AR+GERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  NQFNS
Sbjct: 61 ACILMAINQFNS 72

>Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score = 96.3 bits (238), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 49/72 (68%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TY+H QWPSLL+RYK H +L  FWK ARIGERASPYVS+
Sbjct: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  NQFNS
Sbjct: 61 ACILMAINQFNS 72

>ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score = 96.3 bits (238), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 50/72 (69%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TYVH QWPSLL+RYK HGVLS FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKGHGVLSAFWKMARVGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  +Q NS
Sbjct: 61 ACILMALSQLNS 72

>TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score = 96.3 bits (238), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 44/71 (61%), Positives = 47/71 (66%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TY+HCQWPSLL+RYK H  L  FWK ARIGERASPYVSL
Sbjct: 1  MSALFSFRSMLQVILLLICSSTYIHCQWPSLLDRYKNHSTLGAFWKMARIGERASPYVSL 60

Query: 61 ACIVMVANQFN 71
          ACI M  +QFN
Sbjct: 61 ACIAMAISQFN 71

>Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON}
          (99502..99720) [219 nt, 73 aa]
          Length = 72

 Score = 95.5 bits (236), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 47/72 (65%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TY+H QWPS L+RYK   VL  FWK ARIGERASPYVSL
Sbjct: 1  MSALFNFTSLLQVILLLICSSTYIHSQWPSFLDRYKDQSVLGAFWKLARIGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  NQFNS
Sbjct: 61 ACIIMAVNQFNS 72

>KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON}
          highly similar to uniprot|Q8TGJ3 Saccharomyces
          cerevisiae YNL024C-A Identified by gene-trapping
          microarray-based expression analysis and genome-wide
          homology searching
          Length = 72

 Score = 94.0 bits (232), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 49/72 (68%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TY+H Q PSLL+RYK  G+L +FWKFARIGERASPYVSL
Sbjct: 1  MSALFNFKSLLQVILLFICSCTYIHAQRPSLLDRYKDSGILGVFWKFARIGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI M  +QFNS
Sbjct: 61 ACIAMAVSQFNS 72

>KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score = 92.8 bits (229), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 48/72 (66%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TYVH QWPSLL+RYK+H  L  FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKEHEALGAFWKMARLGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  NQF S
Sbjct: 61 ACILMALNQFMS 72

>Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score = 92.4 bits (228), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 43/72 (59%), Positives = 48/72 (66%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TY+H QWPSLL+RYK H +L  FWK ARIGERASPYVSL
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKDHSMLGAFWKCARIGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  NQF +
Sbjct: 61 ACIIMAVNQFQT 72

>Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score = 92.4 bits (228), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 49/72 (68%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              +YVH QWPSLL+RYK H VL  FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  +QFNS
Sbjct: 61 ACILMAISQFNS 72

>YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON}
          KSH1Essential protein suggested to function early in
          the secretory pathway; inviability is suppressed by
          overexpression of Golgi protein Tvp23p; ortholog of
          human Kish
          Length = 72

 Score = 92.4 bits (228), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 49/72 (68%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              +YVH QWPSLL+RYK H VL  FWK AR+GERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  +QFNS
Sbjct: 61 ACILMAISQFNS 72

>KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score = 92.0 bits (227), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 49/72 (68%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              TY+H QWPSLL+RYK+H +L  FWK ARIGERASPYVS+
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSI 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  NQF +
Sbjct: 61 ACIIMAVNQFQT 72

>Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score = 92.0 bits (227), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 45/72 (62%), Positives = 49/72 (68%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              +YVH QWPSLL+RYK H VL  FWK ARIGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVLLLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  +QFNS
Sbjct: 61 ACILMAISQFNS 72

>Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score = 90.9 bits (224), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 48/72 (66%)

Query: 1  MSALFKFXXXXXXXXXXXXXXTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60
          MSALF F              +YVH QWPSLL+RYK H V   FWK ARIGERASPYVSL
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVFGAFWKMARIGERASPYVSL 60

Query: 61 ACIVMVANQFNS 72
          ACI+M  +QFNS
Sbjct: 61 ACILMAISQFNS 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.137    0.454 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,984,702
Number of extensions: 117037
Number of successful extensions: 288
Number of sequences better than 10.0: 20
Number of HSP's gapped: 288
Number of HSP's successfully gapped: 20
Length of query: 72
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 27
Effective length of database: 48,321,429
Effective search space: 1304678583
Effective search space used: 1304678583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 59 (27.3 bits)