Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_33282.289ON25425412681e-179
ADL212W2.289ON2512467981e-107
NDAI0G006802.289ON2552567046e-93
CAGL0M06897g2.289ON2482516653e-87
KLLA0E08295g2.289ON2662446389e-83
YNL024C2.289ON2462516351e-82
Smik_14.3072.289ON2462516351e-82
Skud_14.3052.289ON2492546342e-82
SAKL0E07612g2.289ON2522526324e-82
NCAS0G03850singletonON2512526324e-82
NCAS0G037702.289ON2512526324e-82
KNAG0H019802.289ON2492506255e-81
Suva_14.3232.289ON2532536194e-80
KLTH0G10428g2.289ON2512446003e-77
KAFR0H032902.289ON2452525923e-76
Kwal_27.115132.289ON2512445882e-75
Suva_4.5321.325ON4161481492e-10
KLLA0E21539g1.325ON4001411465e-10
Smik_2.4141.325ON4171281457e-10
Ecym_55131.325ON3961151422e-09
KAFR0C042501.325ON3911331403e-09
KNAG0C018001.325ON4211531385e-09
Skud_2.4031.325ON4171451369e-09
NDAI0J028604.352ON3471811342e-08
AER240W1.325ON3901001315e-08
Suva_12.2204.352ON3371601289e-08
TDEL0D019401.325ON4051491271e-07
YBR271W (EFM2)1.325ON4191331271e-07
ZYRO0G20548g1.325ON3971391253e-07
NCAS0B074101.325ON4141491253e-07
Smik_10.4224.352ON3401521243e-07
Skud_10.3524.352ON3361531233e-07
TPHA0I026501.325ON4211481191e-06
YJR129C4.352ON3391531181e-06
KNAG0B067204.352ON2831601172e-06
SAKL0D06798g1.325ON4211311182e-06
NDAI0B047301.325ON4321311172e-06
Kpol_1066.171.325ON4351591155e-06
TBLA0D052001.325ON3991461147e-06
Kwal_47.166354.352ON3221751138e-06
CAGL0I09438g1.325ON4061321112e-05
KAFR0E042804.352ON3151381092e-05
SAKL0G18106g4.352ON3351411065e-05
Kpol_1028.814.352ON3361621022e-04
Ecym_11274.352ON3201381003e-04
CAGL0M00572g4.352ON327130994e-04
AER161C4.352ON316134994e-04
NCAS0J021504.352ON322136986e-04
ZYRO0B14916g4.352ON298133977e-04
Kwal_14.25501.325ON418133960.001
TDEL0D006404.352ON327189940.002
KLTH0D17996g4.352ON317140930.002
TPHA0L003404.352ON341202920.003
KLTH0H10560g1.325ON417149920.004
TBLA0B061504.352ON316134790.13
KLLA0B04444g4.352ON308143750.39
NDAI0G029103.163ON96767702.5
TBLA0A100905.255ON312130683.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3328
         (254 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   493   e-179
ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   311   e-107
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   275   6e-93
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   260   3e-87
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   250   9e-83
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   249   1e-82
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   249   1e-82
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   248   2e-82
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   248   4e-82
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               248   4e-82
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   248   4e-82
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   245   5e-81
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   243   4e-80
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   235   3e-77
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   232   3e-76
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   231   2e-75
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    62   2e-10
KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]...    61   5e-10
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    60   7e-10
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    59   2e-09
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    59   3e-09
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    58   5e-09
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    57   9e-09
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    56   2e-08
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    55   5e-08
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    54   9e-08
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    54   1e-07
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    54   1e-07
ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]...    53   3e-07
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    53   3e-07
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    52   3e-07
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    52   3e-07
TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {O...    50   1e-06
YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON} ...    50   1e-06
KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {...    50   2e-06
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    50   2e-06
NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa] ...    50   2e-06
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    49   5e-06
TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa] ...    49   7e-06
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    48   8e-06
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    47   2e-05
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    47   2e-05
SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]...    45   5e-05
Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON} (1820...    44   2e-04
Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to...    43   3e-04
CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar ...    43   4e-04
AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON} Sy...    43   4e-04
NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {O...    42   6e-04
ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa] ...    42   7e-04
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    42   0.001
TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.35...    41   0.002
KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} simil...    40   0.002
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    40   0.003
KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {...    40   0.004
TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4....    35   0.13 
KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar...    33   0.39 
NDAI0G02910 Chr7 complement(673122..676025) [2904 bp, 967 aa] {O...    32   2.5  
TBLA0A10090 Chr1 complement(2482142..2483080) [939 bp, 312 aa] {...    31   3.3  

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  493 bits (1268), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 240/254 (94%), Positives = 240/254 (94%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD
Sbjct: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60

Query: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT 120
           FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT
Sbjct: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT 120

Query: 121 LCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSPVDLILAADCVYLEKAFPLLEM 180
           LCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSPVDLILAADCVYLEKAFPLLEM
Sbjct: 121 LCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSPVDLILAADCVYLEKAFPLLEM 180

Query: 181 KLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYIKQRTHIFQ 240
           KLLELTANQEVQPVVLMSYRKRR              VITELTDFKRYDEYIKQRTHIFQ
Sbjct: 181 KLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYIKQRTHIFQ 240

Query: 241 LVRRSSIKQQQARA 254
           LVRRSSIKQQQARA
Sbjct: 241 LVRRSSIKQQQARA 254

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  311 bits (798), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 188/246 (76%), Gaps = 3/246 (1%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           MT+ F +VFE+LV   PIEHLG SDLS+QG+LDPPLKI+EDGGESGCGGKVWIAG LLC+
Sbjct: 1   MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCE 60

Query: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT 120
           F+LEKSKDG++LS+F    +QF  ++ELGSGTGLVGLC+G+H   +   D +VYITDI+ 
Sbjct: 61  FILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG 120

Query: 121 LCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSPVDLILAADCVYLEKAFPLLEM 180
           LCPLM +NV +N L+G VHPR LFWG+ L  EF  +  P+DL+LAADCVYLEKAFPLLE 
Sbjct: 121 LCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQ--PIDLVLAADCVYLEKAFPLLEK 178

Query: 181 KLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYIKQRTHIFQ 240
            LL+LTA  E QP+VLMSY+KRR               I E+ DFK Y++Y +QRT++FQ
Sbjct: 179 TLLDLTAG-ESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYLFQ 237

Query: 241 LVRRSS 246
           LVR+ +
Sbjct: 238 LVRKPA 243

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  275 bits (704), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 176/256 (68%), Gaps = 13/256 (5%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           M D+F S F++LV   P+EHLG SDLSF GRL  PLKI+EDGGESGCGGKVWIAGELLC+
Sbjct: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60

Query: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT 120
           F+LEKS    LL+ +  N KQF K++ELGSGTGLVGLCIG+    +   D+D YITDID 
Sbjct: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120

Query: 121 LCPLMARNVRMNNLEGRVHPRELFWGDELPAEF------RNK------DSPVDLILAADC 168
           + PLM +N+++N +E  V   EL+WG+ L   F      R+K      +  VDLILAADC
Sbjct: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAADC 180

Query: 169 VYLEKAFPLLEMKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRY 228
           VYLEKAFPLLE  LL+LT   E  P +LM+YRKRR               I E+ DF++Y
Sbjct: 181 VYLEKAFPLLEKTLLDLTEG-ETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKY 239

Query: 229 DEYIKQRTHIFQLVRR 244
           + Y+KQRTH+FQL+R+
Sbjct: 240 EYYLKQRTHLFQLIRQ 255

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  260 bits (665), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 169/251 (67%), Gaps = 10/251 (3%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           M D+    F +L+ + P+EH+G SDL+F G L P LKIYEDGGESGCGGKVWIAGELLC+
Sbjct: 1   MEDILG--FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCE 58

Query: 61  FLLEKSKDGQLLSKFVKNGK-QFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDID 119
           F+LEKS+DG+LL  ++ +    F  VLELGSGTGLVGLC+G+         +  YITDID
Sbjct: 59  FILEKSRDGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDID 118

Query: 120 TLCPLMARNVRMNNLEGRVHPRELFWGDELPAEF------RNKDSPVDLILAADCVYLEK 173
            L PLM +NV +N ++ +V  +EL WG+ LP EF          S +DL+LAADCVYLEK
Sbjct: 119 QLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEK 178

Query: 174 AFPLLEMKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYIK 233
           AFPLLE  LL+LT      PV+LM+YRKRR               +  + DFK YD+Y+K
Sbjct: 179 AFPLLEKTLLDLTECDN-PPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLK 237

Query: 234 QRTHIFQLVRR 244
           QRTH+FQLVR+
Sbjct: 238 QRTHLFQLVRK 248

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  250 bits (638), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 139/244 (56%), Positives = 172/244 (70%), Gaps = 5/244 (2%)

Query: 1   MTDV-FASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLC 59
           M DV F+S FEELVP  PIEHLG  D+SF G+L  PL I EDGGESGCGGKVWIAGELLC
Sbjct: 25  MGDVPFSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLC 84

Query: 60  DFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDID 119
           +++LEKS    LLS    +G   N VLELGSGTGLVGLC+G+ +  +E +D +VYI+DID
Sbjct: 85  EYILEKSDKEHLLSHLFPDG-NCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDID 143

Query: 120 TLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSPVDLILAADCVYLEKAFPLLE 179
            L  LM  N+++N L+ +VH   L+WG+ LP  F  K  PVDL+LAADCVYLE AFPLLE
Sbjct: 144 QLLGLMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKK--PVDLVLAADCVYLEAAFPLLE 201

Query: 180 MKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYIKQRTHIF 239
             LLELT  + V P++LM+Y+KRR               I E+ DF  +D+Y+KQRTH+F
Sbjct: 202 KTLLELTDGENV-PIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLF 260

Query: 240 QLVR 243
           QL+R
Sbjct: 261 QLMR 264

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  249 bits (635), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 172/251 (68%), Gaps = 12/251 (4%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           M  +F   F +LV   P EHLG +DLSF G+L P LKI EDGGESGCGGKVWIAGELLC+
Sbjct: 1   MESIFGG-FGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59

Query: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM--HNIMHEVNDMDVYITDI 118
           ++LEKS D  LLSK V   KQF KVLELGSGTGLVGLC+G+   N  H  +   VY+TDI
Sbjct: 60  YILEKSVD-HLLSKTVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFH--DGTKVYVTDI 116

Query: 119 DTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSP-----VDLILAADCVYLEK 173
           D L PL+ RN+ ++ ++  V  REL+WG+ L A+F  ++       VDL+LAADCVYLE+
Sbjct: 117 DKLIPLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEE 176

Query: 174 AFPLLEMKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYIK 233
           AFPLLE  LL+LT      PV+LM+Y+KRR               + E+TDF +++ Y+K
Sbjct: 177 AFPLLEKTLLDLTHCIN-PPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLK 235

Query: 234 QRTHIFQLVRR 244
           +RTH+FQL+R+
Sbjct: 236 ERTHLFQLIRK 246

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  249 bits (635), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 174/251 (69%), Gaps = 12/251 (4%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           M  +F   F +LV   P EHLG +DLSF G+L P LKI EDGGESGCGGKVWIAGELLC+
Sbjct: 1   MDSIFGG-FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCE 59

Query: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM--HNIMHEVNDMDVYITDI 118
           ++LEKS D  LLSK V   K+F KVLELGSGTGLVGLC+G+   N+ H  +   VY+TDI
Sbjct: 60  YILEKSVD-HLLSKTVDGKKRFKKVLELGSGTGLVGLCVGLLEKNVYH--DGTKVYVTDI 116

Query: 119 DTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKD-----SPVDLILAADCVYLEK 173
           D L PL+ RN+ ++ ++  V  REL WG+ L A+F  ++     + VDL+LAADCVYLEK
Sbjct: 117 DKLVPLLKRNIELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEK 176

Query: 174 AFPLLEMKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYIK 233
           AFPLLE  LL+LT +    PV+LM+Y+KRR               + E+++F ++D Y+K
Sbjct: 177 AFPLLEKTLLDLT-DCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLK 235

Query: 234 QRTHIFQLVRR 244
           QRTH+FQL+R+
Sbjct: 236 QRTHLFQLIRK 246

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  248 bits (634), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 133/254 (52%), Positives = 174/254 (68%), Gaps = 12/254 (4%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           M  +F   FE+LV     EHLG +DLSF G+L P LKI EDGGESGCGGKVWIAGELLC+
Sbjct: 1   MDTIFGG-FEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59

Query: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM--HNIMHEVNDMDVYITDI 118
           ++LEKS    LLS+     +QF KVLELGSGTGLVGLC+G+   N  H+ +   VY+TDI
Sbjct: 60  YILEKSLH-HLLSEATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGS--KVYVTDI 116

Query: 119 DTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKD-----SPVDLILAADCVYLEK 173
           D L PL+ RN+ ++ ++  V  REL+WG+ L  +F  ++     + VDL+LAADCVYLEK
Sbjct: 117 DKLVPLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEK 176

Query: 174 AFPLLEMKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYIK 233
           AFPLLE  LL+LT N    PV+LM+Y+KRR               + E+TDF ++D Y+K
Sbjct: 177 AFPLLERTLLDLT-NCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLK 235

Query: 234 QRTHIFQLVRRSSI 247
           QRTH+FQL+R+ ++
Sbjct: 236 QRTHLFQLIRKHTV 249

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  248 bits (632), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 139/252 (55%), Positives = 182/252 (72%), Gaps = 10/252 (3%)

Query: 1   MTDV--FASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELL 58
           M DV  F + F +LVP+ P EHLG SDLSF G+L PPLKI+EDGGESGCGGKVWIAGELL
Sbjct: 1   MEDVLQFTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELL 60

Query: 59  CDFLLEKSKDGQLLSKFVKNGK---QFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYI 115
           C+FLLEKS    L S++  + +      K++ELGSGTGLVGLC+G+ N  +++ D+D+Y+
Sbjct: 61  CEFLLEKSDQQGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYV 120

Query: 116 TDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEF---RNKDSPVDLILAADCVYLE 172
           TDID L  LM RN+++N LE  V P+EL+WG+ L  EF   R+    VDLILAADCVYLE
Sbjct: 121 TDIDQLVTLMDRNIKLNELE-HVFPKELWWGEPLKPEFAPTRSNQRQVDLILAADCVYLE 179

Query: 173 KAFPLLEMKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYI 232
           KAFPLLE+ LL+LT+ ++  P++LMSY+KRR               + E+ +F R+D Y+
Sbjct: 180 KAFPLLEVTLLDLTSCKD-PPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYL 238

Query: 233 KQRTHIFQLVRR 244
           KQ+TH+FQLVR+
Sbjct: 239 KQKTHLFQLVRK 250

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  248 bits (632), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 168/252 (66%), Gaps = 10/252 (3%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           M  +F   FE LV   P+EHLG SDLSF G+L  PLKI+EDGGESGCGGKVWIAGELLCD
Sbjct: 1   MDGIFGD-FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCD 59

Query: 61  FLLEKSKDGQLLSKFVKNG-KQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDID 119
           F+LEKS    LL+K+  +G ++F  VLELGSGTGLVGLC+G+        ++ V+ITDID
Sbjct: 60  FILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDID 119

Query: 120 TLCPLMARNVRMNNLEGRVHPRELFWGDEL-----PAEFRN--KDSPVDLILAADCVYLE 172
            L PLM RN+ +N +   V    L+WG+ L     P+   N  K + VDLILAADCVYLE
Sbjct: 120 QLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLE 179

Query: 173 KAFPLLEMKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYI 232
            AFPLLE  LL+LT + E  PV+LMSYRKRR               + E+ DF +Y+ Y+
Sbjct: 180 DAFPLLERTLLDLTES-ETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYL 238

Query: 233 KQRTHIFQLVRR 244
           K RTH+FQL RR
Sbjct: 239 KMRTHLFQLARR 250

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  248 bits (632), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 168/252 (66%), Gaps = 10/252 (3%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           M  +F   FE LV   P+EHLG SDLSF G+L  PLKI+EDGGESGCGGKVWIAGELLCD
Sbjct: 1   MDGIFGD-FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCD 59

Query: 61  FLLEKSKDGQLLSKFVKNG-KQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDID 119
           F+LEKS    LL+K+  +G ++F  VLELGSGTGLVGLC+G+        ++ V+ITDID
Sbjct: 60  FILEKSGTEDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDID 119

Query: 120 TLCPLMARNVRMNNLEGRVHPRELFWGDEL-----PAEFRN--KDSPVDLILAADCVYLE 172
            L PLM RN+ +N +   V    L+WG+ L     P+   N  K + VDLILAADCVYLE
Sbjct: 120 QLVPLMQRNIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLE 179

Query: 173 KAFPLLEMKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYI 232
            AFPLLE  LL+LT + E  PV+LMSYRKRR               + E+ DF +Y+ Y+
Sbjct: 180 DAFPLLERTLLDLTES-ETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYL 238

Query: 233 KQRTHIFQLVRR 244
           K RTH+FQL RR
Sbjct: 239 KMRTHLFQLARR 250

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  245 bits (625), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 167/250 (66%), Gaps = 9/250 (3%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           M ++F S F +LV   PIEH G+ D+SF GRL+P L+I+EDGGESGCGGKVW+AGELLCD
Sbjct: 1   MNEIFGS-FGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCD 59

Query: 61  FLLEKSKDGQLLSKF-VKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDID 119
           +++EKS +  LL+ +     ++F  ++ELGSGTGLVGLC+ +         + V ITDID
Sbjct: 60  YIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDID 119

Query: 120 TLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFR------NKDSPVDLILAADCVYLEK 173
            L PLM +N+ +N +   +   EL+WG+ L   F       +K + VDLILAADCVYLEK
Sbjct: 120 QLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEK 179

Query: 174 AFPLLEMKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYIK 233
           AFPLLE  LL+LT N    PV+LM+YRKRR               + E+TDF  YD+Y+K
Sbjct: 180 AFPLLEKTLLDLT-NCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLK 238

Query: 234 QRTHIFQLVR 243
           QRTH+F+L+R
Sbjct: 239 QRTHLFELIR 248

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  243 bits (619), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 134/253 (52%), Positives = 172/253 (67%), Gaps = 12/253 (4%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           M  +F   FE+LV     EH G +DLSF G+L P LKI EDGGESGCGGKVWIAGELLC+
Sbjct: 1   MDGIFGG-FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCE 59

Query: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM--HNIMHEVNDMDVYITDI 118
           ++LEKS D  LLS+ V   + F KVLELGSGTGLVGLC+G+   N  H  ++  VY+TDI
Sbjct: 60  YILEKSDD-HLLSETVHEKRPFMKVLELGSGTGLVGLCVGLLEKNKFH--DNTKVYVTDI 116

Query: 119 DTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKD-----SPVDLILAADCVYLEK 173
           D L PLM RN+ ++ ++  V  REL+WG+ L  +F  ++     + VDL+LAADCVYLEK
Sbjct: 117 DRLVPLMERNIELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEK 176

Query: 174 AFPLLEMKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYIK 233
           AFPLLE  LL+LT N    PV+LM+Y+KRR               + E+ DF ++D Y+K
Sbjct: 177 AFPLLEKTLLDLT-NCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLK 235

Query: 234 QRTHIFQLVRRSS 246
           Q+TH+FQLVR+ S
Sbjct: 236 QKTHLFQLVRKCS 248

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  235 bits (600), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 129/244 (52%), Positives = 158/244 (64%), Gaps = 7/244 (2%)

Query: 5   FASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCDFLLE 64
           F + F +LVP+ P+EH G SDL+F GR+ P LKI+EDGGESGCGGK+WIAGELLC++LLE
Sbjct: 7   FTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLE 66

Query: 65  KSKDGQLLSK---FVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDTL 121
            S D  +LSK    +   K F  +LELGSGTGLVGLC G     +  N   V+ITDID L
Sbjct: 67  NSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGGN-AKVHITDIDQL 125

Query: 122 CPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNK--DSPVDLILAADCVYLEKAFPLLE 179
             LM  NV +N L   V   +L+WG+ L  EF      +  DL+LAADCVYLE AFPLLE
Sbjct: 126 VRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETAFPLLE 185

Query: 180 MKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYIKQRTHIF 239
             LL+LT   E  PVVLMSYRKRR               +  +T F R D+++KQRTH+F
Sbjct: 186 KTLLDLTKG-ETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLF 244

Query: 240 QLVR 243
           QL+R
Sbjct: 245 QLIR 248

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  232 bits (592), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 122/252 (48%), Positives = 160/252 (63%), Gaps = 15/252 (5%)

Query: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60
           M +VF   +  L+ T PIEHLG++DLSF G+L P +KIYEDGG SGCGGKVWIAGELLC+
Sbjct: 1   MNEVFGE-YVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCE 59

Query: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT 120
           +L+EKS    LL            +LELGSGTGLVG+C+G+        D+ V ITDI  
Sbjct: 60  YLIEKSDSENLLCD-----GSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114

Query: 121 LCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKD--------SPVDLILAADCVYLE 172
           L PLM RN+ +N +      +EL WG +LP+E+            S VDL++AADCVY E
Sbjct: 115 LVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAE 174

Query: 173 KAFPLLEMKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYI 232
           KAFPLLE  LL+LT N +  P++LM+YRKRR               + E+ DF  +++Y+
Sbjct: 175 KAFPLLEKILLDLT-NCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYM 233

Query: 233 KQRTHIFQLVRR 244
           KQRTH+F+L R+
Sbjct: 234 KQRTHLFELKRK 245

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  231 bits (588), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 129/244 (52%), Positives = 159/244 (65%), Gaps = 7/244 (2%)

Query: 5   FASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCDFLLE 64
           F + F +LVP+ P+EHLG SDLSF G+++P LKI+EDGGE+GCGGK+W+AGELLCD+LLE
Sbjct: 7   FTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELLCDYLLE 66

Query: 65  KSKDGQLLSKFVKN---GKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDTL 121
            S    +LSK +        F  +LELGSGTGLVGLC G    +H  +   VYITDID L
Sbjct: 67  NSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHG-DRTKVYITDIDRL 125

Query: 122 CPLMARNVRMNNLEGRVHPRELFWGDELPAEF--RNKDSPVDLILAADCVYLEKAFPLLE 179
             LM  NV +N+L   V    L WG+ L  +F    K   VDL+LAADCVYLE AFPLLE
Sbjct: 126 VGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLETAFPLLE 185

Query: 180 MKLLELTANQEVQPVVLMSYRKRRXXXXXXXXXXXXXXVITELTDFKRYDEYIKQRTHIF 239
             LL+LT   +  P VLMSYRKRR               I  +T+F RYD Y+K++TH+F
Sbjct: 186 KTLLDLTEG-DTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKKQTHLF 244

Query: 240 QLVR 243
           QLVR
Sbjct: 245 QLVR 248

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 73/148 (49%), Gaps = 16/148 (10%)

Query: 32  LDPPLKIYEDG-GESGCGGKVW----IAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVL 86
           L+  + +YE        G K W    I  +LL D+L         +      G +  KVL
Sbjct: 201 LNSAIPLYEPSLTADNLGWKTWGSSLILSQLLVDYLHTTG-----MPPAANCGTKRIKVL 255

Query: 87  ELGSGTGLVGLCIGMH-NIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFW 145
           ELGSGTGLVGL        ++ ++++++Y+TD+  +   + +NV +NNLE  V    L W
Sbjct: 256 ELGSGTGLVGLSWAAKWKELYGIHNIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVLDW 315

Query: 146 GDELPAEFRNK---DSPVDLILAADCVY 170
            +  P  F N+   +   D+IL AD +Y
Sbjct: 316 TN--PQNFINQFGHEMDFDIILVADPIY 341

>KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 400

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 70/141 (49%), Gaps = 20/141 (14%)

Query: 32  LDPPLKIYEDGGES-GCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGS 90
           LD  +K+YE    S   G K W +  +L   ++            +  GK   +VLELGS
Sbjct: 200 LDTSIKLYEPALTSDNLGLKTWGSSLMLSQKIIG-----------IPAGK---RVLELGS 245

Query: 91  GTGLVGLCIGMHNIMHEVN-DMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFWGDEL 149
           GTGLVG+    + + H +N D  +++TD+  + P +  NVR+NNL   V    L W D L
Sbjct: 246 GTGLVGIS---YALTHSINGDSVIFLTDLPEILPNLQYNVRLNNL-NDVTADVLDWTDPL 301

Query: 150 PAEFRNKDSPVDLILAADCVY 170
               +  + P D I+ AD +Y
Sbjct: 302 SFTEKYGNEPFDTIVIADPIY 322

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 70/128 (54%), Gaps = 9/128 (7%)

Query: 48  GGKVWIAGELLCDFLLEKSKDGQLLSKFVKN-GKQFNKVLELGSGTGLVGLCIGMH-NIM 105
           G K W +  +L   ++++     +   FV N G +  KVLELGSGTGLVGL        +
Sbjct: 219 GWKTWGSSLILSQLVVDRLHTADM--DFVANRGTKRIKVLELGSGTGLVGLSWASKWKEL 276

Query: 106 HEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNK---DSPVDL 162
           + +++ ++++TD+  +   + +NV +NNL+  V    L W +  P  F ++   ++  D+
Sbjct: 277 YGIDNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTN--PQSFIDRFGYENEFDI 334

Query: 163 ILAADCVY 170
           IL AD +Y
Sbjct: 335 ILIADPIY 342

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 61/115 (53%), Gaps = 5/115 (4%)

Query: 57  LLCDFLLEKSKDGQL-LSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYI 115
           L  D L  K+  G L LS  V       KVLELG+GTGLVG+    + I H+ +   + +
Sbjct: 211 LTNDNLGLKTWGGSLVLSHRVHRIPACEKVLELGAGTGLVGIS---YAIAHQASTPQIIL 267

Query: 116 TDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSPVDLILAADCVY 170
           TD+  + P +  N+++NNL+  VH  EL W D      ++     D+IL +D +Y
Sbjct: 268 TDLPDIVPNLRSNIKLNNLKN-VHAAELDWTDHSTFIAQHGGDKFDMILVSDPIY 321

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 69/133 (51%), Gaps = 15/133 (11%)

Query: 46  GCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIM 105
             G K W +  +L + L ++  D   L  F  NGK   ++LELGSGTGLVG+ +     +
Sbjct: 192 NLGWKTWGSSLILSNILCDRI-DENFLKSF--NGK---RILELGSGTGLVGISVASK--L 243

Query: 106 HEVNDMD---VYITDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNK--DSPV 160
            E+  +D   +Y+TD+  +   + +N+ +N L  RV    L W +  P  F +   D+  
Sbjct: 244 EEIGVLDEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVLDWTN--PESFVSNYGDTRF 301

Query: 161 DLILAADCVYLEK 173
           D++L +D +Y  K
Sbjct: 302 DVLLISDPIYSSK 314

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 73/153 (47%), Gaps = 14/153 (9%)

Query: 25  DLSFQGRLDPPLKIYEDG-GESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFN 83
           D  FQ RL   + +YE        G K W +  +L   L++K        +  K G    
Sbjct: 200 DFKFQ-RLQTTVTLYEPSLTNDNLGWKTWGSSLILSRILIDKLP----FPEPPKVGHPPF 254

Query: 84  KVLELGSGTGLVGL---CIGMHNIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHP 140
           +VLELGSGTGLVG+   C        E +++ +Y+TD+  +   + +NV++N LE  V  
Sbjct: 255 RVLELGSGTGLVGISWACKWRELYGIEDSNLQIYLTDLPEIVDNLKKNVQLNKLEHAVVA 314

Query: 141 RELFWGDELPAEF---RNKDSPVDLILAADCVY 170
             L W +  P  F    N +   DLIL AD +Y
Sbjct: 315 DVLDWTN--PYNFIERYNGEQSFDLILVADPIY 345

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 73/145 (50%), Gaps = 8/145 (5%)

Query: 31  RLDPPLKIYEDG-GESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELG 89
            L+  + +YE        G K W +  +L   L++      +      N K+  KVLELG
Sbjct: 201 NLNNAIPLYEPSLTADNLGWKTWGSSLILSQLLVDYLHTVGVHITASCNQKKI-KVLELG 259

Query: 90  SGTGLVGLCIGMH-NIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFWGDE 148
           SGTGLVGL        ++  + M++++TD+  +   + +NV +NNL+  V    L W + 
Sbjct: 260 SGTGLVGLSWASKWKELYGTDKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTN- 318

Query: 149 LPAEFRNK---DSPVDLILAADCVY 170
            P +F ++   ++  D+IL AD +Y
Sbjct: 319 -PQDFIDRFGHENEFDIILVADPIY 342

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 81/181 (44%), Gaps = 21/181 (11%)

Query: 8   VFEELVPTPPIEHLGASDLSFQGRLDPPLKIYED-------GGESGCGGKVWIAGELLCD 60
           ++E+ +   PI++   +      R++  +KI           G+S  G + W     L  
Sbjct: 95  IYEKYMELIPIKYDAEASDIIMYRINENIKIKVXXEQPNIISGKSTTGFRTWEGAVYLSK 154

Query: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT 120
           FL+    +  L+ K          V+ELG+GTGLV LCI  +++   +    VY+TD D+
Sbjct: 155 FLINNC-EKYLIEK--------TDVIELGAGTGLVSLCILENDLQKGIKRDKVYVTDGDS 205

Query: 121 --LCPLMARNVRMNNL---EGRVHPRELFWGDELPAEFRNKDSPVDLILAADCVYLEKAF 175
             +  ++ +N  +NN+   +  V  R+L+W D         +  + L++ AD  Y     
Sbjct: 206 ELVSSILNKNFELNNVNIEDENVILRKLWWNDPNEKIAGEDNGKIGLVVGADITYDNSVI 265

Query: 176 P 176
           P
Sbjct: 266 P 266

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 51/100 (51%), Gaps = 5/100 (5%)

Query: 71  LLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDTLCPLMARNVR 130
           LLS+ V       +VLELG+GTGLVG+   + NI    +  DV++TD+  + P +  N+ 
Sbjct: 218 LLSRRVAGFTGKKRVLELGAGTGLVGIAYALANI----DADDVFVTDLPEIVPNLRHNLA 273

Query: 131 MNNLEGRVHPRELFWGDELPAEFRNKDSPVDLILAADCVY 170
           +NNL   V    L W D       + +   D I  AD +Y
Sbjct: 274 LNNLTN-VRASVLDWSDPTSFLHEHGELQFDAIFVADPIY 312

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 53.9 bits (128), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 72/160 (45%), Gaps = 17/160 (10%)

Query: 42  GGESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM 101
              S  G + W A   + DFL+ +     LL     + K+   VLE+G+GTG+V L + +
Sbjct: 129 SAASTTGFRTWEAALYMGDFLMHEP----LLELVHGDDKKKLNVLEIGAGTGIVSLVL-L 183

Query: 102 HNIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHP----RELFWG-DELPAEFRNK 156
           H     V+ M V   D D +   + RN  +N+      P    + L+WG D +P E    
Sbjct: 184 HKYREYVSKMYVTDGDSDLVETQLRRNFELNDAWREQSPDIRLQRLWWGSDRVPDE---- 239

Query: 157 DSPVDLILAADCVYLEKAFPLLEMKLLELTANQEVQPVVL 196
              V+L++AAD  Y    FP L   L E  A    +  +L
Sbjct: 240 ---VNLVVAADVTYDSTIFPELCQCLAECLAMSHCKVCLL 276

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 72/149 (48%), Gaps = 15/149 (10%)

Query: 26  LSFQGRLDPPLKIYEDG-GESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNK 84
            +F+G L  P++IYE        G K W A  +L   L+       +L++   N K   +
Sbjct: 192 FTFEG-LPSPIEIYEPSLTADNLGWKTWGASFILSQKLI------NVLAESTFNFKP--R 242

Query: 85  VLELGSGTGLVGLCIGMHNIMHEVN-DMDVYITDIDTLCPLMARNVRMNNLEGRVHPREL 143
           VLELGSGTGL G+      +    N   ++++TD+  +   + +NV +N +E       L
Sbjct: 243 VLELGSGTGLAGISWLCKWVQKYGNGHTEIFLTDLPVIVANLQKNVEVNKVESFATVSAL 302

Query: 144 FWGDELPAEFRNK--DSPVDLILAADCVY 170
            W D  P +F N   D   D+++ +D +Y
Sbjct: 303 DWTD--PTDFINSYTDDEFDILIVSDPIY 329

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 69/133 (51%), Gaps = 16/133 (12%)

Query: 48  GGKVW----IAGELLCDFL--LEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM 101
           G K W    I  +L+ D L  L  +    L +  +K  K    VLELG+GTGLVGL   +
Sbjct: 218 GWKTWGSSLILSQLVVDHLDYLHTTNVNMLANSDIKQIK----VLELGAGTGLVGLSWAL 273

Query: 102 H-NIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNK---D 157
               ++   ++++++TD+  +   + +NV +NNL   V    L W +  P +F +K   +
Sbjct: 274 KWKELYGTENIEIFVTDLPEIVTNLKKNVSLNNLGDFVQAEILDWTN--PHDFIDKFGHE 331

Query: 158 SPVDLILAADCVY 170
           +  D+IL AD +Y
Sbjct: 332 NEFDVILIADPIY 344

>ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 397

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 71/139 (51%), Gaps = 14/139 (10%)

Query: 36  LKIYEDG-GESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGL 94
           ++IYE        G K W +  +L   L+      +++  F  N  + ++VLELGSGTGL
Sbjct: 192 IEIYEPSLTADNLGWKTWGSSFILSQKLI------KIVPHF--NPTKLHRVLELGSGTGL 243

Query: 95  VGLCIGMHNI-MHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEF 153
            G+   M  I +H  ++++++ TD+  + P + +NV +N +        L W    P +F
Sbjct: 244 AGISWLMKWIEIHGNSNIEMFFTDLQEIVPNLRKNVEINGISDNSVVDTLDWT--CPEDF 301

Query: 154 RNKDSP--VDLILAADCVY 170
            +K S    D+I+ +D +Y
Sbjct: 302 VDKYSSEKFDIIIVSDPIY 320

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 71/149 (47%), Gaps = 31/149 (20%)

Query: 36  LKIYEDG-GESGCGGKVWIAGELLCD---FLLEKSKDGQLLSKFVKNGKQFNKVLELGSG 91
           +++YE        G K W A  +L      LLEK+KD + +           +VLELGSG
Sbjct: 208 IQLYEPSLTADNLGWKTWGASLILSQKVVNLLEKNKDQKHIHPL--------RVLELGSG 259

Query: 92  TGLVGLC--------IGMHNIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHPREL 143
           TGLVG+          G  NI       ++++TD+  +   + +NV+ N+L   V    L
Sbjct: 260 TGLVGIAWASKWRQSFGTENI-------EMFVTDLPDIVANLKKNVQTNDLTTFVEADIL 312

Query: 144 FWGDELPAEF--RNKDSPVDLILAADCVY 170
            W +  P +F  ++ D   D+IL AD +Y
Sbjct: 313 DWTN--PDDFIEKHGDEKFDVILVADPIY 339

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 71/152 (46%), Gaps = 14/152 (9%)

Query: 42  GGESGCGGKVWIAGELLCDFLLEKS-KDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIG 100
              S  G + W A   + DFL+ K  ++  L  +  +  K+   VLE+G+GTG+V L + 
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQELALTQEEQEEDKKKLNVLEIGAGTGIVSLVLS 186

Query: 101 MHNIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHP----RELFWG-DELPAEFRN 155
             N  + VN M V   D D +   + +N  +N+      P    + L+WG D++P +   
Sbjct: 187 -QNYRNFVNKMYVTDGDSDLVERQLKKNFELNDALSEHKPDIRFQRLWWGSDKVPDD--- 242

Query: 156 KDSPVDLILAADCVYLEKAFPLLEMKLLELTA 187
               +DL++ AD  Y    FP L   L E  A
Sbjct: 243 ----IDLVVGADVTYDSTIFPELCKCLAECLA 270

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 73/153 (47%), Gaps = 19/153 (12%)

Query: 42  GGESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM 101
              S  G + W A   + DFL+  +K  Q L+   K  ++   VLE+G+GTG+V L + +
Sbjct: 127 SAASTTGFRTWEAALYMGDFLI--NKPLQQLALMQKEDRKKLNVLEIGAGTGIVSLVL-L 183

Query: 102 HNIMHEVNDMDVYITDIDT--LCPLMARNVRMNNLEGRVHP----RELFWG-DELPAEFR 154
                 VN M  Y+TD D+  +   + RN  +N+      P    + L+WG D +P +  
Sbjct: 184 EKYREFVNRM--YVTDGDSNLVERQLKRNFELNDALCENGPDVKLQRLWWGSDRIPDD-- 239

Query: 155 NKDSPVDLILAADCVYLEKAFPLLEMKLLELTA 187
                +DL++AAD  Y    FP L   L E  A
Sbjct: 240 -----IDLVVAADVTYDSTIFPELCQCLAECLA 267

>TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {ON}
           Anc_1.325 YBR271W
          Length = 421

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 67/148 (45%), Gaps = 21/148 (14%)

Query: 36  LKIYEDG-GESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVK-NGKQFNKV--LELGSG 91
           +K+YE        G K W +  +L  +L+         +K++  N     KV  LELG+G
Sbjct: 202 VKLYEPSLTADNLGWKTWGSSLVLSQYLINN------FNKYINVNNCHVRKVRVLELGAG 255

Query: 92  TGLVGL---CIGMHNIMHEVN----DMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELF 144
           TGLVG+   C     +    N    +M++++TD+  +   +A+NV  N L        L 
Sbjct: 256 TGLVGISWGCKWKEEVTSAGNENLQNMELFLTDLPEITNNLAKNVSTNELSDFCKVDVLN 315

Query: 145 WGDELPAEFRN--KDSPVDLILAADCVY 170
           W D  P  F N   + P   IL AD +Y
Sbjct: 316 WTD--PTSFTNTHTEEPFQYILIADPIY 341

>YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON}
           Putative protein of unknown function; predicted
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 339

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 70/153 (45%), Gaps = 17/153 (11%)

Query: 42  GGESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM 101
              S  G + W A   + DFL+ K        +   +GK+   VLE+G+GTG+V L I +
Sbjct: 127 SAASTTGFRTWEAALYMGDFLIHKPLQELAPVQGQDDGKKKLNVLEVGAGTGIVSLVI-L 185

Query: 102 HNIMHEVNDMDVYITDIDT--LCPLMARNVRMNNL----EGRVHPRELFWG-DELPAEFR 154
                 VN M  Y+TD D+  +   + RN  +NN     E  +  + L+WG D +P +  
Sbjct: 186 QKYHEFVNKM--YVTDGDSNLVETQLKRNFELNNEVRENEPDIKLQRLWWGSDRVPED-- 241

Query: 155 NKDSPVDLILAADCVYLEKAFPLLEMKLLELTA 187
                +DL++ AD  Y     P L   L E  A
Sbjct: 242 -----IDLVVGADVTYDPTILPDLCECLAECLA 269

>KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {ON}
           Anc_4.352 YJR129C
          Length = 283

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 69/160 (43%), Gaps = 27/160 (16%)

Query: 48  GGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHE 107
           G + W A   L   L+E  +        +  GK    VLELG GTGL  + +G   ++ E
Sbjct: 107 GFRTWRAATSLSKLLVEHRE--------LTRGK---TVLELGCGTGLSSITVG---VLDE 152

Query: 108 VNDMDVYITDIDT--LCPLMARNVRMNNLEGRVHPRELFWG--DELPAEFRNKDSPVDLI 163
              +  Y+TD DT  L  +   N+ +N +E  V  + L W   D +P +       +D++
Sbjct: 153 YKKL--YVTDGDTGILSEVTTPNLSLNKVERDVQCQRLVWASEDRVPGD-------IDVV 203

Query: 164 LAADCVYLEKAFPLLEMKLLELTANQEVQPVVLMSYRKRR 203
           + AD  Y    FP L   L E     + Q  +L    + R
Sbjct: 204 VGADITYDPTVFPELCTCLDECLQQPKCQCAILACTERNR 243

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 60/131 (45%), Gaps = 16/131 (12%)

Query: 48  GGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIG--MHNIM 105
           G K W A       +L +    +  S F   G    +VLELGSGTGLVG+          
Sbjct: 220 GLKTWGAS-----LILSQKICNRFNSIFAGTGNLL-RVLELGSGTGLVGITFSCKYKESK 273

Query: 106 HEVNDMDVYITDIDTLCPLMARNVRMNNLEGR----VHPRELFWGDELPAEFRNK--DSP 159
             +   ++Y+TD+  + P + +NV +NNL  +    V    L W +  P  F  K  D  
Sbjct: 274 TALGSCEMYLTDLPEIVPNLQKNVEINNLNSQSGLAVCADVLDWTN--PVSFTEKYGDDK 331

Query: 160 VDLILAADCVY 170
            D+IL AD +Y
Sbjct: 332 FDVILIADPIY 342

>NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa]
           {ON} Anc_1.325 YBR271W
          Length = 432

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 66/131 (50%), Gaps = 14/131 (10%)

Query: 43  GESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMH 102
           G    G  + ++ EL+ D  LE +K+        K  K   +VLELG+GTGLVG+     
Sbjct: 233 GWKTWGSSLILSQELVND--LETNKNN-------KKSKSIRRVLELGAGTGLVGIAWACK 283

Query: 103 -NIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNK--DSP 159
              ++    +++++TD+  +   + +NV+ N+L+  V    L W +  P +F  K  D  
Sbjct: 284 WRQLYGNESIEMFVTDLPDIVTNLRKNVQNNDLDDFVVADVLDWTN--PEDFIKKYSDEK 341

Query: 160 VDLILAADCVY 170
            D IL AD +Y
Sbjct: 342 FDTILIADPIY 352

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 68/159 (42%), Gaps = 28/159 (17%)

Query: 31  RLDPPLKIYEDG-GESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFN------ 83
            LD  +K+YE        G K W +  +L           Q +  F+ N K  N      
Sbjct: 215 NLDQTVKLYEPSLTADNLGWKTWGSSLIL----------SQKMVNFLNNYKYSNQSDDKL 264

Query: 84  KVLELGSGTGLVGLCIG--MHNIMHEVN-----DMDVYITDIDTLCPLMARNVRMNNLEG 136
           ++LELG+GTGLVG+        +M   N     + ++ +TD+  +   + RN+ +NNL  
Sbjct: 265 RILELGAGTGLVGISWSCKWKEMMKLTNGNNLPNTEIILTDLPEIVGNLQRNISINNLND 324

Query: 137 RVHPRELFWGDELPAEF--RNKDSPVDLILAADCVYLEK 173
                 L W +  P  F     +   D+IL AD +Y  K
Sbjct: 325 IARASVLDWTN--PKSFIQEYSNEKFDIILVADPIYSPK 361

>TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa]
           {ON} Anc_1.325 YBR271W
          Length = 399

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 66/146 (45%), Gaps = 19/146 (13%)

Query: 30  GRLDPPLKIYEDGGES-GCGGKVWIAGELLCDFL--LEKSKDGQLLSKFVKNGKQFNKVL 86
             L+  +K+YE    S   G K W +  +L + +  LE             +G    +VL
Sbjct: 190 NNLEKTIKLYEPALTSDNLGHKTWGSSLVLANRIPTLENC-----------SGSSKPRVL 238

Query: 87  ELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDTLCPLMARNVRMNNL--EGRVHPRELF 144
           ELGSGTGLVG+    + I H      V++TD+  + P +  N ++N+L     V    L 
Sbjct: 239 ELGSGTGLVGIT---YTISHSNEFSQVFLTDLPEIVPNLRTNAKLNDLSTHNSVIADVLD 295

Query: 145 WGDELPAEFRNKDSPVDLILAADCVY 170
           W +      +  D   D+IL AD +Y
Sbjct: 296 WTNHDSFVEKYGDIQFDIILIADPIY 321

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 76/175 (43%), Gaps = 28/175 (16%)

Query: 14  PTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCDFLLEKSKDGQLLS 73
           P+P    +     S    +D   + Y        G + W A   L ++L++  +      
Sbjct: 100 PSPTFTDIIRYRFSSDVAVDVQEQPYLLCASGTTGFRTWEAALYLAEYLVQNQE------ 153

Query: 74  KFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDID-TLCPLMAR-NVRM 131
                  +F+++LELG+GTGLV L       + +    ++Y+TD D TL     R N ++
Sbjct: 154 --YYAQDRFSRILELGAGTGLVSLVWSQ---LFQATMKELYVTDGDSTLVEQAIRYNFQL 208

Query: 132 NN--------LEGRVHPRELFWGDELPAEFRNKDSPVDLILAADCVYLEKAFPLL 178
           NN        L+ +   + L+WG+++  +       VD++LAAD  Y     P L
Sbjct: 209 NNVTAAPANTLDCQYKFQRLWWGEDVVPD-------VDIVLAADVTYDASVVPSL 256

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 60/132 (45%), Gaps = 17/132 (12%)

Query: 46  GCGGKVW----IAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM 101
             G K W    I GE++  +L        L S F  N K   + LELG+GTGLVG+    
Sbjct: 209 NLGWKTWGSSLILGEIVVSYL------ENLSSTFESNRKV--RTLELGAGTGLVGIAWAA 260

Query: 102 HNIMHEVND-MDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNK--DS 158
                  N   ++Y+TD+  +   +  NV++NNL+       L W +  P  F  K  + 
Sbjct: 261 KWRDKFCNSKTEIYLTDLPEIVDNLKDNVKINNLQDIATADVLDWTN--PDTFTEKYGNE 318

Query: 159 PVDLILAADCVY 170
             D I+ AD +Y
Sbjct: 319 RFDYIVIADPIY 330

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 65/138 (47%), Gaps = 25/138 (18%)

Query: 45  SGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNI 104
           S  G + W A   LCD++   + D + L     NG   + VLELG+GTGL  L +     
Sbjct: 113 STTGFRTWEAASYLCDYI--SNVDTESL-----NG--CSTVLELGAGTGLCSLTLLKGKF 163

Query: 105 MHEVNDMDVYITDIDT--LCPLMARNVRMNNLEG----RVHPRELFWG-DELPAEFRNKD 157
             ++    VY+TD DT  +   +  N ++N +E     +V  + L WG D +P +     
Sbjct: 164 QDDLK--KVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGEDSIPND----- 216

Query: 158 SPVDLILAADCVYLEKAF 175
             +D ++ AD  Y +  F
Sbjct: 217 --IDCVIGADVTYDDTLF 232

>SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]
           {ON} similar to uniprot|P47163 Saccharomyces cerevisiae
           YJR129C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 335

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 69/141 (48%), Gaps = 25/141 (17%)

Query: 45  SGCGG-KVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIG--M 101
           SG  G + W A   L   L + S   +++ +    GK    V+ELG+GTG+V +      
Sbjct: 138 SGTTGFRTWEAALYLSQHLCKNS--DEIMDEL---GKDQITVVELGAGTGIVSMTWAKLQ 192

Query: 102 HNIMHEVNDMDVYITDIDT--LCPLMARNVRMNNLEG-RVHPRELFW-GDELPAEFRNKD 157
           HN + +     +Y+TD D+  +   M RN ++NN+ G +   ++L+W  D++P       
Sbjct: 193 HNRLEK-----LYVTDGDSSLVENQMHRNAQLNNVGGPKYCFQKLWWNSDDVPDN----- 242

Query: 158 SPVDLILAADCVYLEKAFPLL 178
              DLILAAD  Y     P L
Sbjct: 243 ---DLILAADVTYDSSVIPDL 260

>Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON}
           (182083..183093) [1011 nt, 337 aa]
          Length = 336

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 72/162 (44%), Gaps = 34/162 (20%)

Query: 28  FQGRLDPPLKI------YEDGGESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQ 81
            Q R +  +KI      Y        G + W A   +  F +E    G L +   KN   
Sbjct: 114 IQYRFNDSIKIKLEETPYVVSAAGTTGFRTWEAALFMTSFFVET---GYLDTMSKKN--- 167

Query: 82  FNKVLELGSGTGLV--GLCIGMHNIMHEVNDMDVYITDIDT--LCPLMARNVRMNNLE-- 135
              +LELG+GTGLV  GLC    + + +     +Y+TD D+  +   + +N   N L   
Sbjct: 168 ---ILELGAGTGLVSIGLCKQYEDSIDK-----IYVTDGDSQLVEGQLLKNFNENELSHN 219

Query: 136 GRVHPRELFWG-DELPAEFRNKDSPVDLILAADCVYLEKAFP 176
            RV  ++L+W  D++P +       +DLI+AAD  Y     P
Sbjct: 220 DRVILQKLWWNVDDVPLD-------LDLIVAADVTYDSSVVP 254

>Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to
           Ashbya gossypii AER161C
          Length = 320

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 53/138 (38%), Gaps = 27/138 (19%)

Query: 43  GESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLC---I 99
                G + W A   LC +L E                +F  +LELG+GTG+V L    +
Sbjct: 126 ASGSTGFRTWEAALYLCHYLCESRP-------------RFGTMLELGAGTGIVSLTWHKL 172

Query: 100 GMHNIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFWG-DELPAEFRNKDS 158
                M    D D  I         ++  V ++  +G VH + L W  D +P        
Sbjct: 173 QSGQFMTYATDGDKNIIGKQLKETFISNGVDLD--KGNVHLQRLLWNVDSIPKN------ 224

Query: 159 PVDLILAADCVYLEKAFP 176
             D+ILAAD  Y   A P
Sbjct: 225 --DIILAADVTYDHTAIP 240

>CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129c
          Length = 327

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 16/130 (12%)

Query: 43  GESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMH 102
                G + W A   L  +L+++     + +         +++LELGSGTGLV L   ++
Sbjct: 126 ANGSTGNRTWEAAVYLGLYLIDQCASNVVAAP--------SRILELGSGTGLVSL---LY 174

Query: 103 NIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSP--V 160
             ++  + + +   D D +   +  N+ +N+L+  +  ++L WG   P +  + D+    
Sbjct: 175 QQLYPFDKLTMTDGDWDVVRKRIPGNLSLNDLKPGLEVKQLVWG---PRDANSGDNQWDY 231

Query: 161 DLILAADCVY 170
           DLIL +D  Y
Sbjct: 232 DLILGSDLTY 241

>AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR129C
          Length = 316

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 56/134 (41%), Gaps = 31/134 (23%)

Query: 48  GGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHE 107
           G + W A   L D+L              +   + +  LELG+GTGLV L       +  
Sbjct: 129 GHRTWEAALYLADYL-------------CRVPLRQSVALELGAGTGLVSLA-----WLRS 170

Query: 108 VNDMDVYITDIDT--LCPLMARNVRMNNLEG--RVHPRELFWG-DELPAEFRNKDSPVDL 162
             +   YITD D+  L   +A N+ +N L    R   R L+W  DE+P          D+
Sbjct: 171 RPESSAYITDGDSALLEGHLAENLALNGLRSSPRASLRRLWWNVDEVPQN--------DI 222

Query: 163 ILAADCVYLEKAFP 176
           +LAAD  Y     P
Sbjct: 223 VLAADVTYDSTVLP 236

>NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {ON}
           Anc_4.352
          Length = 322

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 62/136 (45%), Gaps = 25/136 (18%)

Query: 48  GGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHE 107
           G + W A   L  +L++           + +    + +LELG+GTGLV L I   + M +
Sbjct: 123 GFRTWAASVYLSKYLVDHE------DALINDD---DNILELGAGTGLVSLTIASMDKMKD 173

Query: 108 VNDMDVYITDIDT--LCPLMARNVRMN--NLEGRVHPRELFWGDELPAEFRNKDSP---- 159
                +Y+TD D+  +   M  N +MN  N++  +  ++L+W         + D P    
Sbjct: 174 NKLRRMYVTDGDSELVSGQMQDNFQMNEVNVDNHIKLQKLWWN--------SPDQPIPER 225

Query: 160 VDLILAADCVYLEKAF 175
           V++++ AD  Y    F
Sbjct: 226 VNVVIGADVTYDSTCF 241

>ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa]
           {ON} weakly similar to uniprot|P47163 Saccharomyces
           cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 298

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 56/133 (42%), Gaps = 30/133 (22%)

Query: 48  GGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHE 107
           G + W A   LC +L  +               Q N+VLE+G+GTGLV   + +    H+
Sbjct: 117 GHRTWEASLYLCQYLFRQDW-----------LPQVNEVLEIGAGTGLVSTALALAG--HQ 163

Query: 108 VNDMDVYITDIDTLCPLMARNVR--MNNLEGRVHPRELFWGDELPAEFRNKDSPVDLILA 165
           V       TD D   P++   +R   N  E  +  + L WG + P +        DL++A
Sbjct: 164 VTS-----TDGD---PMVVEQLRKTFNLNEVNIEAQVLEWGLQKPPK-------SDLVVA 208

Query: 166 ADCVYLEKAFPLL 178
           AD  Y     P L
Sbjct: 209 ADVTYDTAVIPSL 221

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 64/133 (48%), Gaps = 23/133 (17%)

Query: 48  GGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMH- 106
           G K W A  +L   + +K      LS F     +  ++LELG+GTGLVG+   +  I+  
Sbjct: 221 GLKTWGASLVLARKICQK------LSTF--EPSENLRILELGAGTGLVGIAF-IQKILEV 271

Query: 107 -EVNDMDVYITDIDTLCPLMARNVRMN------NLEGRVHPRELFWGDELPAEFRNK--D 157
                  V++TD+  + P + +NV +N      N+E  V    L W D  P+ F+ K   
Sbjct: 272 GSTQKFRVHLTDLPDIVPNLQKNVDLNKCNREPNVEVAVD--VLDWTD--PSSFQEKYGY 327

Query: 158 SPVDLILAADCVY 170
              D++L AD +Y
Sbjct: 328 KKFDVLLIADPIY 340

>TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.352
           YJR129C
          Length = 327

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 79/189 (41%), Gaps = 35/189 (18%)

Query: 1   MTDVFAS--VFEELVPTPPIEHLGASDLS-FQGRLDPPLKI------YEDGGESGCGGKV 51
           +TDV+ S  ++E+ V    ++   A+     Q R+ P +K+      Y        G + 
Sbjct: 80  VTDVWLSEWLYEKYVALLDVKQPSATTTDVIQYRISPQVKVKIEETPYLISASGTTGFRT 139

Query: 52  WIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDM 111
           W A   L  +L             +  G   +KVLELG+GTG+V   + + N       +
Sbjct: 140 WEAALYLSLYLATSCP--------ITEG---SKVLELGAGTGMVSATLALTN----PGRL 184

Query: 112 D-VYITDIDTLCPLMAR-NVRMNNLE-GRVHPRELFWG-DELPAEFRNKDSPVDLILAAD 167
           D +Y+TD D      AR N  +N +E    +  +L W  D +P +        D ++AAD
Sbjct: 185 DKLYVTDGDWHLTQQARKNFSLNGIETSNTYFEQLRWNEDPVPTKL-------DYVVAAD 237

Query: 168 CVYLEKAFP 176
             Y     P
Sbjct: 238 VTYDSTVVP 246

>KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} similar
           to uniprot|P47163 Saccharomyces cerevisiae YJR129C
           Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 317

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 27/140 (19%)

Query: 48  GGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHE 107
           G + W +   L ++L E         +F  +  +F++ LELG+GTGLV +       + +
Sbjct: 124 GFRTWESALYLSEYLAEN------FPEF--SAGKFSRALELGAGTGLVSIAWAK---LFK 172

Query: 108 VNDMDVYITDID-TLCPLMAR-NVRMNNLEGR-VHP------RELFWGDELPAEFRNKDS 158
               ++ +TD D +L    AR N ++N ++ R  H       + L+WG++   E      
Sbjct: 173 GYIKELIVTDGDSSLVEQAARVNFKLNGIDTRECHGDCAYKFQRLWWGEDAVPE------ 226

Query: 159 PVDLILAADCVYLEKAFPLL 178
            VD++LAAD  Y     P L
Sbjct: 227 -VDIVLAADVTYDSSVIPSL 245

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 86/202 (42%), Gaps = 37/202 (18%)

Query: 14  PTPPIEHLGASDLSFQGRLDPPLKI------YEDGGESGCGGKVWIAGELLCDFLLEKSK 67
           PTP  + +       Q R++  +KI      Y        G + W A   L  +L++   
Sbjct: 108 PTPTTKDV------IQYRINNQIKIKIEESPYLISAAGTTGFRTWEAAVYLTKYLIDLGF 161

Query: 68  DGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT--LCPLM 125
             + +             LELGSGTG+V   IG+    ++     +YITD D+  L   +
Sbjct: 162 PPETV---------MENTLELGSGTGMVS--IGLVK-KYKDQITTLYITDGDSQLLEGQL 209

Query: 126 ARNVRMNNLEG--RVHPRELFWG-DELPAEFRNKDSPVDLILAADCVYLEKAFPLLEMKL 182
           +RNV +N ++    V  ++L W  D +P         +DLI+AAD  Y     P L   +
Sbjct: 210 SRNVMLNGIDSSDSVKLQKLRWNEDHIPDN-------LDLIVAADVTYDSSVIPSLCHCI 262

Query: 183 LE-LTANQEVQPVVLMSYRKRR 203
           L+   ++ +   V  ++  +R 
Sbjct: 263 LDCFKSSNKCSTVCYLAATRRN 284

>KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 417

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 70/149 (46%), Gaps = 18/149 (12%)

Query: 30  GRLDPPLKIYEDGGES-GCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLEL 88
           G L   +K++E    S   G K W A  +L   L E        SKF +  ++  ++LEL
Sbjct: 198 GGLRTGVKLHEPALTSDNLGLKTWGASLVLARKLCEN------FSKFER--QRDLRILEL 249

Query: 89  GSGTGLVGLCIGMHNIMHEVN---DMDVYITDIDTLCPLMARNVRMNNLEGR----VHPR 141
           G+GTGLVG+ + +   M E N   +  +++TD+  +   +  NV++N    R    V+  
Sbjct: 250 GAGTGLVGISLVLK--MLESNSGHNCSMHLTDLPEIVTNLKENVKINCCNSRSDLKVYAD 307

Query: 142 ELFWGDELPAEFRNKDSPVDLILAADCVY 170
            L W +    E        D++L AD VY
Sbjct: 308 VLDWTNPDSFEKTYGAHKFDVLLIADPVY 336

>TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4.352
           YJR129C
          Length = 316

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 57/134 (42%), Gaps = 25/134 (18%)

Query: 42  GGESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM 101
            G    G + W A   +  +LLE    G               V+E+G+GTG+V + I  
Sbjct: 120 SGNGTTGLRTWEAALYMILYLLEHPVRGN--------------VVEIGAGTGMVSIGIMK 165

Query: 102 HNIMHEVNDMDVYITDIDTLCP--LMARNVRMNNL--EGRVHPRELFWGDELPAEFRNKD 157
              M   N   V +TD D       + +N ++N +  + RV  +++ W ++      N D
Sbjct: 166 ---MQGQNISSVLVTDGDEYVANKQLPKNFQLNGIVDDTRVKFQKIRWNED---HLVNGD 219

Query: 158 SP-VDLILAADCVY 170
            P VD ++ AD  Y
Sbjct: 220 GPNVDYLVGADVTY 233

>KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 308

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 65/143 (45%), Gaps = 20/143 (13%)

Query: 43  GESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGM- 101
            +   G + W A   LC ++ +          FV +    + +LELG GTG++ +   M 
Sbjct: 110 AQGTTGFRTWEAALFLCHYMTQHP------GLFVTHD---SLMLELGCGTGIISILYKMI 160

Query: 102 HNIMHEVNDMDVYITDIDT-LCPLMARNVRMN---NLEGRVHP--RELFWGDELPAEFRN 155
            +   +     + +TD D+ L   ++ N ++N   + +G V+   + L W ++  + +  
Sbjct: 161 KDSQGDCKAGTIIVTDGDSNLLQQVSTNFQLNGSLSNDGDVNIGFQRLRWNEDELSNY-- 218

Query: 156 KDSPVDLILAADCVYLEKAFPLL 178
             + +DLILAAD  Y     P L
Sbjct: 219 --NEIDLILAADVTYDTSVIPDL 239

>NDAI0G02910 Chr7 complement(673122..676025) [2904 bp, 967 aa] {ON}
           Anc_3.163 YOL063C
          Length = 967

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 9/67 (13%)

Query: 119 DTLCPLMARNVRMNNLEGRVHPRELFWGDELPAE-----FRNKDSPVD--LILAADCVYL 171
           +T+ P   R   ++N   +VH  EL    E  +E     F+ KD   D  L+  ADC+YL
Sbjct: 747 ETVSPSSQRKWSIHNHATKVH--ELLANIEDGSERSLTGFKLKDLNDDFFLVTTADCIYL 804

Query: 172 EKAFPLL 178
            KA PLL
Sbjct: 805 LKAHPLL 811

>TBLA0A10090 Chr1 complement(2482142..2483080) [939 bp, 312 aa] {ON}
           Anc_5.255 YKL150W
          Length = 312

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 24/130 (18%)

Query: 20  HLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCDFLLEKSKDGQLLSKFVKNG 79
           +   +DL+ +G  D  +K+Y +G  +       I    L + LL K   G LL KF    
Sbjct: 112 YTPVTDLNKKGSFDLVIKVYPEGKMTN-----HIFNLKLNETLLFK---GPLL-KFDYPK 162

Query: 80  KQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDTLCPLMARNVRMNNLEGRVH 139
             FN++  LG+GTG+  L   + +I+ +               P    N ++N L G   
Sbjct: 163 NTFNEITLLGAGTGITPLYQILTSILSD---------------PDQQPNTKINLLYGNKT 207

Query: 140 PRELFWGDEL 149
           P+++    EL
Sbjct: 208 PQDILLKPEL 217

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.140    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,057,560
Number of extensions: 1110001
Number of successful extensions: 2512
Number of sequences better than 10.0: 59
Number of HSP's gapped: 2472
Number of HSP's successfully gapped: 59
Length of query: 254
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 147
Effective length of database: 41,212,137
Effective search space: 6058184139
Effective search space used: 6058184139
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)