Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_33272.288ON92692648010.0
ADL213W2.288ON90888824560.0
SAKL0E07634g2.288ON97490024270.0
NDAI0G006702.288ON96889823900.0
KAFR0H033002.288ON96689123510.0
NCAS0G037802.288ON95789423330.0
KLTH0G10406g2.288ON96391023150.0
Suva_14.3242.288ON96890223150.0
TBLA0B059502.288ON99588823150.0
KLLA0E08317g2.288ON92189223010.0
YNL023C (FAP1)2.288ON96591722750.0
Smik_14.3082.288ON96589122740.0
Kpol_1039.452.288ON96890222730.0
TDEL0G021902.288ON93689222680.0
Kwal_27.115182.288ON95390222650.0
KNAG0H019902.288ON97388622530.0
Skud_14.3062.288ON97089122460.0
ZYRO0A01936g2.288ON95388622150.0
TPHA0D015302.288ON96291322030.0
CAGL0M06919g2.288ON95689421760.0
Kwal_8.565singletonOFF10365702.3
Smik_11.2741.286ON551120753.1
ZYRO0A05566g5.612ON456109743.4
TBLA0I02620singletonON3166100753.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3327
         (926 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...  1853   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   950   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...   939   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...   925   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...   910   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...   903   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...   896   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...   896   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...   896   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   890   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...   880   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...   880   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...   880   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...   878   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   877   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...   872   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...   869   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...   857   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...   853   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...   842   0.0  
Kwal_8.565 s8 (9259..9570) [312 bp, 103 aa] {OFF} [contig 311] FULL    32   2.3  
Smik_11.274 Chr11 complement(459047..460702) [1656 bp, 551 aa] {...    33   3.1  
ZYRO0A05566g Chr1 (453204..454574) [1371 bp, 456 aa] {ON} simila...    33   3.4  
TBLA0I02620 Chr9 complement(605456..614956) [9501 bp, 3166 aa] {...    33   3.8  

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score = 1853 bits (4801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 908/926 (98%), Positives = 908/926 (98%)

Query: 1   MLNTXXXXXXXXXXXXXXXXXXADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMY 60
           MLNT                  ADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMY
Sbjct: 1   MLNTSERSSEVEEVSYSDYLSEADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMY 60

Query: 61  ACSNCYRVYDYECIMEWAKKSSKRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEK 120
           ACSNCYRVYDYECIMEWAKKSSKRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEK
Sbjct: 61  ACSNCYRVYDYECIMEWAKKSSKRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEK 120

Query: 121 NATYPNSCGQTCGASICKHGCASTCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKP 180
           NATYPNSCGQTCGASICKHGCASTCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKP
Sbjct: 121 NATYPNSCGQTCGASICKHGCASTCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKP 180

Query: 181 KLSCKLPCGLPLPCGVHTCQKICHSGPCGRCNTVMSGKFKCYCGSNHLDSIICKDVAVTK 240
           KLSCKLPCGLPLPCGVHTCQKICHSGPCGRCNTVMSGKFKCYCGSNHLDSIICKDVAVTK
Sbjct: 181 KLSCKLPCGLPLPCGVHTCQKICHSGPCGRCNTVMSGKFKCYCGSNHLDSIICKDVAVTK 240

Query: 241 MSRSGKHKKWIGVFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCG 300
           MSRSGKHKKWIGVFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCG
Sbjct: 241 MSRSGKHKKWIGVFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCG 300

Query: 301 NTTLIDMQQKREKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQ 360
           NTTLIDMQQKREKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQ
Sbjct: 301 NTTLIDMQQKREKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQ 360

Query: 361 ERTFLTPCQFDGKPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESL 420
           ERTFLTPCQFDGKPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESL
Sbjct: 361 ERTFLTPCQFDGKPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESL 420

Query: 421 IEAEHICFKNCNRKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTV 480
           IEAEHICFKNCNRKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTV
Sbjct: 421 IEAEHICFKNCNRKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTV 480

Query: 481 RPNCNYPCINTLRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQN 540
           RPNCNYPCINTLRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQN
Sbjct: 481 RPNCNYPCINTLRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQN 540

Query: 541 DISCGRKCAAKLTNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPD 600
           DISCGRKCAAKLTNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPD
Sbjct: 541 DISCGRKCAAKLTNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPD 600

Query: 601 VPCLEEVVVSCGCGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSE 660
           VPCLEEVVVSCGCGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSE
Sbjct: 601 VPCLEEVVVSCGCGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSE 660

Query: 661 STNKAEHGSSSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSL 720
           STNKAEHGSSSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSL
Sbjct: 661 STNKAEHGSSSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSL 720

Query: 721 HFKPMKAPQRQFVHELSKAFGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRM 780
           HFKPMKAPQRQFVHELSKAFGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRM
Sbjct: 721 HFKPMKAPQRQFVHELSKAFGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRM 780

Query: 781 KTFQKERRDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFD 840
           KTFQKERRDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFD
Sbjct: 781 KTFQKERRDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFD 840

Query: 841 ECLKQTLLKDPQFRLINSNAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSA 900
           ECLKQTLLKDPQFRLINSNAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSA
Sbjct: 841 ECLKQTLLKDPQFRLINSNAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSA 900

Query: 901 HKLTADFNKTSQALNNSFISTEDPDF 926
           HKLTADFNKTSQALNNSFISTEDPDF
Sbjct: 901 HKLTADFNKTSQALNNSFISTEDPDF 926

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/888 (50%), Positives = 601/888 (67%), Gaps = 5/888 (0%)

Query: 23  ADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSS 82
           A  +G+PYYE+ + ++++G  YQCLICTVE+D++C MYAC  CYRVYDYECI  WA K++
Sbjct: 11  AKLEGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKAT 70

Query: 83  KRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCA 142
             + D TWKCPNCYH   KV PK R TCWCGKQ+N + N   PNSCGQTCGA IC+HGC+
Sbjct: 71  STTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCS 130

Query: 143 STCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKI 202
             CHLGPH +CMV +  KC+CGK+TE+I CY+ KA K   SC  PCGLP+PCG+H C+++
Sbjct: 131 KLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERV 190

Query: 203 CHSGPCGRCNTVMSGKFKCYCGSNHLDSIICKDVAVTKMSRSGKHKKWIGVFSCKNIREV 262
           CH+GPCG C   ++G  KCYCG    + ++C +V+V   S+  K+K WIG F+C  +REV
Sbjct: 191 CHNGPCGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIGAFACDRMREV 250

Query: 263 RYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIPTCD 322
            Y C +HSF+E C   PS   R  CPYSP  C TC CG T L ++   R  CTD I +C 
Sbjct: 251 PYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSCG 310

Query: 323 QRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIKCEN 382
           + CGK LSCG HTCPMTCH G CMDPCL I E+KC+C++R FL PCQF   PSC  KCE+
Sbjct: 311 KVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCES 370

Query: 383 LMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGLHHC 442
           LMSCRRHRC +RCCSG+P ++ R+S        +DES +EA+H+C K+CNR L CG+H C
Sbjct: 371 LMSCRRHRCAERCCSGRPHSVKRNSRRR-RESPDDESEVEAQHVCLKDCNRVLLCGIHMC 429

Query: 443 TNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCGHRA 502
             KCH GKCPPCLESDSNDL+CPCGK+++ APVRCGT  P C +PC N+L  + PCGH  
Sbjct: 430 NYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHSP 489

Query: 503 PFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHLCQKQ 562
           P H CHP  E CPPCT  V K C+CGK    RT C+ +D+SC R C   L+ C+H CQ  
Sbjct: 490 PSHNCHPLDEPCPPCTITVKKTCRCGK-NEIRTFCYNDDVSCSRPCKKPLSYCNHFCQVP 548

Query: 563 CHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLKVPC 622
           CH  G+C  TC + CGL R ACEH+C A CHG   CP+ PC E+  ++C CG +S    C
Sbjct: 549 CHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKIC 608

Query: 623 GAYKDKESAT-ATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGSSSVINKPTSYED 681
             Y  K+    A+Q L CD+DCAK Q+HQ L++     E     E  +  +  +  S++D
Sbjct: 609 SEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQRSQSFDD 668

Query: 682 LGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKAFG 741
           L LP++E ++ VF+KQ+ WC  I+  LI+L++D S K+LHFKPM+A QR+FVHELS +FG
Sbjct: 669 LHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSSFG 728

Query: 742 LYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRMKTFQKERRDLELQHNTTKILI 801
           LYSESQD EPKRSV+VK    S++PAIGLS+A  LY   K  ++E +    +   TK L+
Sbjct: 729 LYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFK-ANSESAVTKKLV 787

Query: 802 SIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFRLINSNAY 861
           S+ IDD  +S+  +A+ NAIL++G+    +   ++ CF +   QTLL  PQ+ +  +  Y
Sbjct: 788 SVHIDDSPESQH-DAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVVRGTEGY 846

Query: 862 IYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADFNK 909
           I+P+++L +SAN E D+ +L  YF  + + + +  ++S  KL ++ N+
Sbjct: 847 IFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNR 894

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/900 (50%), Positives = 592/900 (65%), Gaps = 6/900 (0%)

Query: 28  LPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSAD 87
           LPYYEK I +IQ G  Y C+ICT+E+D TC MYAC  CYRVYD+ECI EWA KSS++S D
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 88  STWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCHL 147
            TWKCPNCY+  +++  K R TCWCGK ++PE N   PNSCGQTC A IC HGC+  CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 148 GPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICHSGP 207
           GPHP+CM    +KC CGK T+ + CYQ++  K    C  PC L LPCGVH CQ+ CHSGP
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227

Query: 208 CGRCNTVMSGKFKCYCGSNHLDSIICKDVAVTKMSRSGKHKKWIGVFSCKNIREVRYRCK 267
           CG C   +SGK  CYCG    + IICKDV     S++   + WIGVFSC ++R V Y C 
Sbjct: 228 CGNCEETISGKIMCYCGMETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCG 287

Query: 268 EHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIPTCDQRCGK 327
            HSF ESC   P+    + CP+SP + KTC CG+T L  ++  R+KCTDPIPTC+ RC K
Sbjct: 288 HHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNK 347

Query: 328 PLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIKCENLMSCR 387
           PL CGKH+CP  CH G CMDPC+ +++  CSC  ++FL PCQF  +  CN KCE+LMSCR
Sbjct: 348 PLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCR 407

Query: 388 RHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGLHHCTNKCH 447
           RHRC +RCCSG+ LA+ R  TI    D+ DESL+EA+HIC K CN KLSCG+H+C  KCH
Sbjct: 408 RHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCH 467

Query: 448 PGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCGHRAPFHKC 507
           PGKC PCLESDSNDL CPCGK+V+ APVRCGT  P C +PCI TL+    CGH    H+C
Sbjct: 468 PGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHEC 527

Query: 508 HPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHLCQKQCHPPG 567
           H   + CP CTA +YK CKC K+   RT+CFQND+SCG+ C   L NC H C++ CH PG
Sbjct: 528 HSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPG 587

Query: 568 ECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLKVPCGAYKD 627
           +C   C ++CGL R  CEH C A CH  + CPD  C  +V V+C CGR+   +PC A+ D
Sbjct: 588 QCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHAD 647

Query: 628 KESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGSSSVINKPTSYEDLGLPYS 687
           + S+    +L CDD C + ++H+ML++     E           ++    S+++L LP++
Sbjct: 648 QPSSKLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAPVEELRDLVESAKSFDELHLPFT 707

Query: 688 EQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKAFGLYSESQ 747
           E  + V+SKQ  WC  I+  L +L+ D +R SLHFKPMK PQR+F+HEL+ A+ LYSESQ
Sbjct: 708 ESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSESQ 767

Query: 748 DREPKRSVFVKILKT-SKIPAIGLSEALLLYQRMKTFQKERRDLELQHNTTKILISIPID 806
           DREPKRSVFVK ++  S IP + L EAL LY   K  QKER+  EL+ +TT+ L +  +D
Sbjct: 768 DREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTVD 827

Query: 807 DGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFR-LINSNAYIYPS 865
           D +D     A  N  L+ GV   VT + +  C  E L+ TL+++P ++ L N +  IYP 
Sbjct: 828 DANDVPH-NAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENGDFLIYPE 886

Query: 866 NFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADFNKTSQALNNSFISTEDPD 925
           + + IS NVE DI+RL PY S +C+ KQI   V  +K+  +    +   +  ++  E P+
Sbjct: 887 DHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFT---SEEYLQEEQPE 943

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score =  925 bits (2390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/898 (50%), Positives = 586/898 (65%), Gaps = 18/898 (2%)

Query: 23  ADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSS 82
           A D+ + YYE+ I++I  G  Y C+ICTVE+D TC+MYAC  CYRV+DY+CI EWA KS+
Sbjct: 53  AADEDMKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVKST 112

Query: 83  KRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCA 142
           +++ D  WKCPNCYH   KV PK RSTCWCGK +NPE N   PNSCGQTC A IC HGC 
Sbjct: 113 EKTVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHGCT 172

Query: 143 STCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVK--PKLSCKLPCGLPLPCGVHTCQ 200
           + CHLGPHP+C   + + C+CGK T+ I CYQ+K  K   K  CK  CGLPL CG+H C+
Sbjct: 173 NICHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHKCK 232

Query: 201 KICHSGPCGRC------NTVMSGKFKCYCGSNHLDSIICKDVAV---TKMSRSGKHKKWI 251
           + CHSG CG C      N   +   KCYCGS    S+ CKD+ +    K S   +  KWI
Sbjct: 233 RKCHSGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNKWI 292

Query: 252 GVFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKR 311
           GVF+CK IR V+Y C +HSF E C   P+      CPYSP + KTC CG T L  + + R
Sbjct: 293 GVFACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAKPR 352

Query: 312 EKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFD 371
             CTDPIPTC+  C KPL CGKH CP  CH G CMDPCLQIE RKCSC++++FL PCQF 
Sbjct: 353 TLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQFT 412

Query: 372 GKPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNC 431
           G P CNIKCE+LMSCRRHRC++RCCSG+P A  R  T+    D  DE+L+EAEHIC K C
Sbjct: 413 GSPHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLKEC 472

Query: 432 NRKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINT 491
           N  LSCG+H C  KCHPGKCPPCLESDSNDLVCPCGK+++ APVRCGT  P C + CI  
Sbjct: 473 NLLLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCIKV 532

Query: 492 LRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAK 551
           +R   PCGH    H CHP  E CPPCTA V+KPCKCGK+   RT+CFQND+SCG+ C   
Sbjct: 533 VRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICGLP 592

Query: 552 LTNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSC 611
           L +C H C K+CH PG+C   C ++CG +R  C+H C+  CHG+  CPDVPC     V+C
Sbjct: 593 LKDCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKVTC 652

Query: 612 GCGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSE----STNKAEH 667
            CGRR   V CGA  +  SA  T  L CD++C  +++H+ L +     E    ST+    
Sbjct: 653 ECGRRETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAFGIKEIISSSTDLEFE 712

Query: 668 GSSSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKA 727
               ++    ++E+L LP++E  + +FS+Q  WC+ I++ + + ++DKSR SLHFKPM+ 
Sbjct: 713 RLKDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKPMRP 772

Query: 728 PQRQFVHELSKAFGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRMKTFQKER 787
           PQR F+HELSKA+ LY ESQD EPKRSVF+K   TS  P+  LS+ L LYQ  K  +KER
Sbjct: 773 PQRHFIHELSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELEKER 832

Query: 788 RDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTL 847
           +  E +  T+K L+++ + +G     + A  N  LI  +    TVE+++  F + LK TL
Sbjct: 833 KLQEFEARTSKRLVNVEVPEGPTDNYI-AEANGFLIKDLSPGTTVEDLERIFGQYLKSTL 891

Query: 848 LKDPQFRLINS--NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKL 903
           +K+PQ+ ++    +  IYP ++  I+ANVE D + LV +F  + +   I   V   K+
Sbjct: 892 IKNPQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKI 949

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/891 (50%), Positives = 586/891 (65%), Gaps = 16/891 (1%)

Query: 23  ADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSS 82
           +D+D + YYE+AI++I  G  Y C+ICTVE+D TC+MYAC  C R++DY+CI EWA KS+
Sbjct: 48  SDNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALKST 107

Query: 83  KRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCA 142
           +++ +  WKCPNCYH   KV  K R+TCWCGK +NPEKN   PNSCGQTC A +C HGC+
Sbjct: 108 EKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHGCS 167

Query: 143 STCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAV---KPKLSCKLPCGLPLPCGVHTC 199
             CHLGPHP+C+  + +KC CGK   QISC+Q+K+    + + SC+  CGLPL CG+HTC
Sbjct: 168 KICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIHTC 227

Query: 200 QKICHSGPCGRCNTVMS------GKFKCYCGSNHLDSIICKDV-AVTKMSRSGKHKKWIG 252
           +K CHSG CG C  ++          KCYCG     S  CKDV A T +SR  +  KW+G
Sbjct: 228 KKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDAEGNKWVG 287

Query: 253 VFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKRE 312
           VFSC  IR V Y C++HSF ESC   P+     QCP+SPN+ KTC CG T L  + + R 
Sbjct: 288 VFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALSKPRL 347

Query: 313 KCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDG 372
           KCTDP+PTC+  C KPL CGKH CP TCH G CMDPC+QI+++ CSC +  FLTPCQF+G
Sbjct: 348 KCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPCQFEG 407

Query: 373 KPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCN 432
           +P CNIKCE+LMSCRRHRC +RCCSG+PLA  R  T+    D NDE+L+EA+H+C K CN
Sbjct: 408 EPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCLKECN 467

Query: 433 RKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTL 492
             LSCG H C  KCHPGKCPPCLESDSNDLVCPCGK+V+ APVRCGT    C +PCI  +
Sbjct: 468 LMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPCIKVI 527

Query: 493 RGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKL 552
           R    CGH    H CHP  + CPPCTA V+KPCKCGK    RT+CFQ D+SCG+ C   L
Sbjct: 528 RNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKICGLPL 587

Query: 553 TNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCG 612
             CHH CQK CHP GEC   C +VC  KR  C H C  +CHG   C D PC     +SC 
Sbjct: 588 LTCHHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTKISCP 647

Query: 613 CGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQT---LRSSESTNKAEHGS 669
           CGRR   V C A    +SA     L C+++C  V++H+ L +    +   E  N      
Sbjct: 648 CGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVEKEEPENLGTERL 707

Query: 670 SSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQ 729
            S     T+Y+DL LPY+E  +  ++KQ  WC+ I++ LI+ ++D SR SLHFKPM+ PQ
Sbjct: 708 QSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFKPMRPPQ 767

Query: 730 RQFVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLLYQRMKTFQKER 787
           R F+HE++KAF LY+ESQDREPKRSVF+K     TS  PA+ LS+ L +YQ  K  +KER
Sbjct: 768 RYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFKKLEKER 827

Query: 788 RDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTL 847
           +  + +  TT  L++I +DD  + +  +   N ++I  +   +T+E +   F++  K TL
Sbjct: 828 KAKQFEARTTARLMNITLDDTLEERK-KFENNGLIIKNLSNGITLEFLSEFFNKFFKSTL 886

Query: 848 LKDPQFRLINSNAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNV 898
           +K+PQ+ +I +N  IYP +  EI+  V  D+  LV +F+ + + + IG +V
Sbjct: 887 IKNPQYLIIENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSV 937

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score =  903 bits (2333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/894 (51%), Positives = 590/894 (65%), Gaps = 20/894 (2%)

Query: 24  DDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSK 83
           DDD + YYE+AI++I  G  Y C+ICTVE+D TC+MYAC  CYRV+DYECI EWA KS++
Sbjct: 46  DDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTE 105

Query: 84  RSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCAS 143
           ++ D  WKCPNCYH   KV PK R TCWCGK +NPE N   PNSCGQTC A  C HGC+ 
Sbjct: 106 KTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSK 165

Query: 144 TCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAV--KPKLSCKLPCGLPLPCGVHTCQK 201
            CHLGPHP+C   + +KC+CGK T+ ISCYQ+  +  K K  C  PCGLPL CG+H CQK
Sbjct: 166 ICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQK 225

Query: 202 ICHSGPCGRCNTVMSGK------FKCYCGSNHLDSIICKDVAV---TKMSRSGKHKKWIG 252
            CHSG CG C  +++ K       +CYCGS   D+I C+DV V     +S++ K +KW+G
Sbjct: 226 KCHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVG 285

Query: 253 VFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKRE 312
           VF C NIR V Y+C EHSF E C   P+ D    CP+SP + KTC CG T L ++ + R+
Sbjct: 286 VFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRK 345

Query: 313 KCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDG 372
           KCTDPIPTCD RCGKPL CG+HTCP  CH G CMDPCLQI+++KCSC +++FL PCQF  
Sbjct: 346 KCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQ 405

Query: 373 KPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCN 432
            P C  KCE+LMSCRRHRC +RCC+G+P A AR   +    D  DESL+E +HIC K CN
Sbjct: 406 DPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECN 465

Query: 433 RKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTL 492
             LSCG H C  KCHPGKCPPCLESDSNDLVCPCG+++I APVRCGT  P C YPCI  +
Sbjct: 466 LMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVV 525

Query: 493 RGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKL 552
           RG  PCGH    H CHP  E CPPCTA V+KPCKCGK+   RT+CFQND+SCG+ C   L
Sbjct: 526 RGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPL 585

Query: 553 TNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCG 612
            NC+H CQK+CH  GEC  TC ++C  KR  CEH C   CHG   CPD+PC   + ++C 
Sbjct: 586 ENCNHTCQKRCHLLGECQKTCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCE 645

Query: 613 CGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQML---LQTLRSSESTNKAEHGS 669
           CGR+   V CGA     SA     + CD++C  +++H+ L      + S+ ST+      
Sbjct: 646 CGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKL 705

Query: 670 SSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQ 729
             +    T++E+L LPY+E  + +++KQ  WC  I++ L +L++DK+R SLHFKPM+ PQ
Sbjct: 706 KDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQ 765

Query: 730 RQFVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLLYQRMKTFQKER 787
           R F+ E +K+F LY+E+QDREPKRSVFVK  +  +S  P I L +AL LYQ  K  +KER
Sbjct: 766 RHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKER 825

Query: 788 RDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTL 847
           +  E +  TT  LI+  ++   +     A  +  LI  +    TVE+++  F + L  TL
Sbjct: 826 KLKEFEARTTTRLIN--VEAPQEDNVYHAKYSGFLIKKISPGTTVEDLQRIFGQFLTSTL 883

Query: 848 LKDPQFRLINS--NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVS 899
           + +PQ+ +I    +A IYP N+ E+SA VE D++ LV +F  + +   I   V 
Sbjct: 884 IVNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVE 937

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/910 (49%), Positives = 577/910 (63%), Gaps = 9/910 (0%)

Query: 23  ADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSS 82
            D    PYYEK IK+I  G  Y C+ICTVE+D TC MYAC  CYRV+DYECI EWA KS+
Sbjct: 56  GDTYDQPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKST 115

Query: 83  KRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCA 142
           ++S   TWKCPNCY     V  K R TCWCGK I+PE N   PNSCGQTC A IC HGC+
Sbjct: 116 QKSVTKTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCS 175

Query: 143 STCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKI 202
           STCHLGPHP CM  V  KC+CGK ++ + C + +  +    C  PCGL LPCGVH CQ+ 
Sbjct: 176 STCHLGPHPTCMRMVQTKCRCGKKSKDVFCSEARKHQELFRCGNPCGLTLPCGVHKCQRE 235

Query: 203 CHSGPCGRCNTVMSGKFKCYCGSNHLDSIICKDVAVTKMSRSGKHKKWIGVFSCKNIREV 262
           CH+G CG C   ++ +  CYCG   L SI C+DV +   S+ G  KKWIG F+C  IR V
Sbjct: 236 CHNGVCGECPETIAKEINCYCGLESLPSIKCQDVKIQSKSQDGSGKKWIGAFACSRIRTV 295

Query: 263 RYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIPTCD 322
            Y C+EHSF E CK  PS   RI CPYSP   KTC CG T L +M+  R KCTDPIPTCD
Sbjct: 296 EYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDPIPTCD 355

Query: 323 QRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIKCEN 382
             CGK LSCG+H CP  CH G CM+ C   ++ KCSC  R F+ PC+F G P CN KCE+
Sbjct: 356 ATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNTKCES 415

Query: 383 LMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGLHHC 442
           LMSCRRHRC +RCC G+ LA  R   +    DK DESL+EA+HIC K CN KLSCG H C
Sbjct: 416 LMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSCGRHFC 475

Query: 443 TNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCGHRA 502
             KCHPG CPPCLESDSNDLVCPCGK+V  APVRCGTV P C  PCI TL+G + CGH  
Sbjct: 476 QRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDCGHPP 535

Query: 503 PFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHLCQKQ 562
             H CH   E CP CTA V+K CKCGK    RT+CFQN++SCGR C  +L +CHH C K 
Sbjct: 536 MPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHHSCTKT 595

Query: 563 CHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLKVPC 622
           CH  GEC + C +VCG+ RS C H+C   CH    CPDVPC   V V CGCG RS    C
Sbjct: 596 CHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSSFATC 655

Query: 623 GAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGS---SSVINKPTSY 679
            A++ ++ A   + L C +DCA  ++   L++    +  T +   G    +++  K T++
Sbjct: 656 AAHEGQDPADQ-RPLECTEDCAAARRRLELMEAFGMNTETVQPTEGIVDLAALAEKVTTF 714

Query: 680 EDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKA 739
           ++L LP++E  + +F+KQ+ WC  I++ L RL+ D S+ SLHFKPMK PQR F+HEL++A
Sbjct: 715 QELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIHELAQA 774

Query: 740 FGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRMKTFQKERRDLELQHNTTKI 799
           + LY ESQD+EPKRSV+VK    S+ P++ L EAL LYQ  K  QKER+  EL+ +TT  
Sbjct: 775 YKLYCESQDKEPKRSVYVKKTVDSRKPSLSLKEALPLYQSFKNAQKERKLKELERSTTTR 834

Query: 800 LISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQF-RLINS 858
           +++       +S    A  N +LI  V      + I+ACF + LK TL+KDP + +L + 
Sbjct: 835 ILN--YTSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLKLDSG 892

Query: 859 NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADFNKTSQALNNSF 918
           +  ++  N+   S NVE DI R+V +   + +   +   V+  ++     + +   + S 
Sbjct: 893 DVMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMAEETNRSDESS 952

Query: 919 IST--EDPDF 926
           ++   EDP F
Sbjct: 953 VAEAPEDPLF 962

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/902 (49%), Positives = 581/902 (64%), Gaps = 18/902 (1%)

Query: 25  DDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKR 84
           DD + YYE+AI++I  G  Y C+ICTVE+D TC+M+AC  CYRV+DY CI EWA KS+++
Sbjct: 51  DDDMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEK 110

Query: 85  SADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCAST 144
           + D  WKCPNCYH   KV  + R TCWCGK +NP+ N   PNSCGQTC A  C HGC+  
Sbjct: 111 TVDKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKI 170

Query: 145 CHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICH 204
           CHLGPHP+C   V +KC+CGK ++ I CYQ+KA+K    C+  CGLPL CG+H C+K CH
Sbjct: 171 CHLGPHPECTRTVEIKCRCGKHSKSIFCYQSKAMKKHFDCQEECGLPLSCGIHKCKKKCH 230

Query: 205 SGPCGRCNTVMSGK------FKCYCGSNHLDSIICKDVAVTKMSRSGKHK---KWIGVFS 255
           SG CG C  ++  +       KCYCG +  DSI C +V   K  RS K +   +WIGVF+
Sbjct: 231 SGLCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFA 290

Query: 256 CKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCT 315
           CK+IR V Y C +HSF E C   P+ + +  CP+ P++ KTC CG T L ++ + R+ CT
Sbjct: 291 CKDIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCT 350

Query: 316 DPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPS 375
           DPIPTC  RC KPL CGKH+CP  CH G CMDPCLQ +  KC+C++ TFL PC F  KP 
Sbjct: 351 DPIPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPH 410

Query: 376 CNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKL 435
           CNIKCE+LMSCRRHRCI RCCSG+P AL R   I    D  DESL+EA+HIC K CN  L
Sbjct: 411 CNIKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTL 470

Query: 436 SCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGS 495
           SCG+H C  KCHPGKCPPCLESDSNDLVCPCGK+VI APVRCGT  P CNY CI  +RG 
Sbjct: 471 SCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGE 530

Query: 496 MPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNC 555
             CGH+   H CHP    CPPCT  V+KPCKCGK    RT+CFQ D+SCG  C   L+ C
Sbjct: 531 SECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGC 590

Query: 556 HHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGR 615
           HH CQK CH P  C   C ++C  KR  C+H C   CHG   CPD+PC   V ++C CGR
Sbjct: 591 HHTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGR 650

Query: 616 RSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTL----RSSESTNKAEHGSSS 671
              KV CGA  +  S T    L C+++C  +++ + L +       S+ESTN        
Sbjct: 651 IEKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEESNESTNNELDTLKK 710

Query: 672 VINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQ 731
           +++  T++E+L LP++E ++ V++KQ  WC  I++ + +L+ DK+R SLHFKPM+ PQR 
Sbjct: 711 LVSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRH 770

Query: 732 FVHELSKAFGLYSESQDREPKRSVFVKILKTSKI--PAIGLSEALLLYQRMKTFQKERRD 789
           F+ EL+KA+ LYSESQDREP RSVF+K    SK   P + L+EA  LY+  K  QKER+ 
Sbjct: 771 FIRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKI 830

Query: 790 LELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLK 849
            E Q  TT  LI+  + D ++ K   A  N  L+  +     V++++  F+  LK TL+ 
Sbjct: 831 QEFQARTTAKLINFEVRD-AEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVV 889

Query: 850 DPQFRLINSN--AYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADF 907
            PQ+ +I+    A +YP N+ E+S N E D+  LV +F  + +   +  ++S   +  + 
Sbjct: 890 KPQYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEEL 949

Query: 908 NK 909
            +
Sbjct: 950 GR 951

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/888 (50%), Positives = 586/888 (65%), Gaps = 19/888 (2%)

Query: 25  DDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKR 84
           ++ L YYE+A+++I  G  YQC+ICTVE+D TC+MYAC +CYRV+DY+CI EWA KS+++
Sbjct: 66  EEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQK 125

Query: 85  SADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCAST 144
           + D TWKCPNCYHS  KV  K R TCWCGK +NP+ N   PNSCGQTC A+IC H C   
Sbjct: 126 TVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQ 185

Query: 145 CHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICH 204
           CHLG HP+C   + + C+CG+ T+ I C++++  K    C   CGL LPCG+H C++ CH
Sbjct: 186 CHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRKCH 245

Query: 205 SGPCGRCNTVM-----SGKFKCYCGSNHLDSIICKDVAV---TKMSRSGKHKKWIGVFSC 256
           SG CG C  ++     SGK KCYCG + L  + CKDVA     K+SR+ + K+W+G+F C
Sbjct: 246 SGLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDC 305

Query: 257 KNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTD 316
           K +R V Y C EH F E C   P+  + + CP+SPN+ KTC CG T L DM  +R KCTD
Sbjct: 306 KEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTD 365

Query: 317 PIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSC 376
           PIPTCD  C K L CGKH CP TCH GKCMDPC+QI++  C+C+ RTFL PCQF GKP C
Sbjct: 366 PIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVC 425

Query: 377 NIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLS 436
             KCE+LMSCRRHRC++ CCSG+P A  R  TI    D+NDE+L+EAEH+C K+CN KLS
Sbjct: 426 KFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLS 485

Query: 437 CGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSM 496
           CG+H C  KCHPG CPPCLESDSNDLVCPCGK+VI APVRCGT  P C YPCI  +RG  
Sbjct: 486 CGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGES 545

Query: 497 PCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCH 556
            CGH+   H CH   + CP CTA V+KPCKCGK    RT+CFQ D+SCG  C   L +C+
Sbjct: 546 DCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDCY 605

Query: 557 HLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRR 616
           H CQK+CH PGEC NTC ++C  KRS C H CT  CH +  CPD+PC   V V C CGRR
Sbjct: 606 HKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCGRR 665

Query: 617 SLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTL-----RSSESTNKAEHGSSS 671
            L  PC +    +S T T  L CD++C  + +   L            + T+ A     +
Sbjct: 666 KLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAIERIQN 725

Query: 672 VINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQ 731
            I+   +YE+L LP+ E ++ V++KQ  WC  I+  L + +++K + SLHFK MKAPQR 
Sbjct: 726 RISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRS 785

Query: 732 FVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLLYQRMKTFQKERRD 789
           FVH L+ A+ +YSESQD EP RSVFVK L   TS  P + L EAL LY+  K  QKE++ 
Sbjct: 786 FVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKEKKK 845

Query: 790 LELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLK 849
            E +  T K LI++  +  + ++      N  LI  + +  T E+++  F E LK TL+K
Sbjct: 846 QEYEARTHKTLINVEAE--TQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVK 903

Query: 850 DPQFRLINS--NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIG 895
           DPQ+ +++   + +I P+++ EIS NVE D+++L+ +F  +C+   IG
Sbjct: 904 DPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIG 951

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/892 (48%), Positives = 579/892 (64%), Gaps = 6/892 (0%)

Query: 27  GLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSA 86
            +PYYE+ +K+I++G  Y C+ICTVE+DSTCRMYAC +CYRV+DYEC+ EWA KS+ ++ 
Sbjct: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90

Query: 87  DSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCH 146
           D +WKCPNCY   +K+  +KRSTCWCGK +NP+ N   PNSCGQTC A  C HGC+  CH
Sbjct: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150

Query: 147 LGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICHSG 206
           LGPHP+C++PV +KCKCGK  +QI C ++K +    +C   CGL LPCG HTCQK CH+G
Sbjct: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210

Query: 207 PCGRCNTVMSGKFKCYCGSNHLDSIICKDVAVTKMSRSGKHKKWIGVFSCKNIREVRYRC 266
            CG C +++  +  CYCGS+    I C D+ V   S+    KKWIGV+SC  +R + Y C
Sbjct: 211 FCGPCESIIKTELPCYCGSDVKSGIQCSDLRVLDYSKDVSGKKWIGVYSCGEVRTLHYSC 270

Query: 267 KEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIPTCDQRCG 326
             H++ E C      D    CP+SP   KTC CG T L ++ + R KCTD IPTC   CG
Sbjct: 271 DHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCG 330

Query: 327 KPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIKCENLMSC 386
           K LSCGKHTCP +CH G CMDPCL I +  C+C  +TFLTPCQ    P CNIKCE+ MSC
Sbjct: 331 KQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSC 390

Query: 387 RRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGLHHCTNKC 446
           RRH+C++ CCSGKP A  R  T+    D N+E+L+E EH+C K CN KLSCG+H CT KC
Sbjct: 391 RRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKC 450

Query: 447 HPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCGHRAPFHK 506
           HPGKCPPCLESD NDLVCPCGK+V+ APVRCGT  P C  PCI    G  PCGHR   HK
Sbjct: 451 HPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGPHK 510

Query: 507 CHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQND--ISCGRKCAAKLTNCHHLCQKQCH 564
           CHP+  DCPPCTA V K C+C K    RT+C   D  ++CG +C   L  CHH CQK+CH
Sbjct: 511 CHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQKKCH 570

Query: 565 PPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLKVPCGA 624
             GEC   C + CGLKRS C HLC   CHG+  CP+  C E+VV++C C RR+ +V CGA
Sbjct: 571 VEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVECGA 630

Query: 625 YKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGSSSVINKPTSYEDLGL 684
             D +S + T+ L CD++CAK+Q+H  L++    +E     +    S++     ++DL +
Sbjct: 631 THDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVAKKFDDLNM 690

Query: 685 PYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKAFGLYS 744
           PYSE ++ V+ KQ  WC  I     + +ED  + SLH KPM+ PQRQF+ EL+ A+ LYS
Sbjct: 691 PYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASAYALYS 750

Query: 745 ESQDREPKRSVFVKILKT-SKIPAIGLSEALLLYQRMKTFQKERRDLELQHNTTKILISI 803
           ESQDREP RSV++K +++ SK P + L +A  LYQ  KT +KER         TK LI+I
Sbjct: 751 ESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVTKTLINI 810

Query: 804 PIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFRLIN--SNAY 861
           P  +       E   NAI+I+GV  +  ++NI+    + LK TL+K PQ+R +   ++  
Sbjct: 811 PASETPLPAPYEGP-NAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKDLNSVL 869

Query: 862 IYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADFNKTSQA 913
           I+P N+  I+ N  +D+++++P+     + + +   V   ++  + +  SQA
Sbjct: 870 IFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLSLVSQA 921

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/917 (47%), Positives = 580/917 (63%), Gaps = 21/917 (2%)

Query: 25  DDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKR 84
           DD + YYE+AI++I +G  Y C+ICTVE+D TC+M+AC  CYRV+DY CI EWA KS+++
Sbjct: 47  DDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEK 106

Query: 85  SADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCAST 144
           + D  WKCPNCY+   +V  K R TCWCGK +NP+ N   PNSCGQTC AS C HGC+  
Sbjct: 107 TVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKI 166

Query: 145 CHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICH 204
           CHLGPHP+C   V + C CGK ++ I CYQ+K +K   +C+  CGLPL C +HTC+K CH
Sbjct: 167 CHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCH 226

Query: 205 SGPCGRCNTVMSGK------FKCYCGSNHLDSIICKDVAVTKMSRSGKHK---KWIGVFS 255
            G CG C  ++  K       KCYCG++   +I C +    K  +S K +   +WIGVF+
Sbjct: 227 PGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFA 286

Query: 256 CKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCT 315
           C + R V Y C++HSF ESC   P+ +    CP+ P+  KTC CG T L ++ + R+ C 
Sbjct: 287 CADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCD 346

Query: 316 DPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPS 375
           DPIPTCD RCGKPL CGKH+CP TCH   CM+PCLQI+  KC+C++ TF  PC F G+P 
Sbjct: 347 DPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPR 406

Query: 376 CNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKL 435
           CNIKCE+LMSCRRHRC  RCCSG+P A+ R   +    D  DESL+EA+HIC K CN  L
Sbjct: 407 CNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTL 466

Query: 436 SCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGS 495
           SCG+H C  KCHPGKCPPCLESDSNDLVCPCG +V+ APVRCGT  P CN+PCI  +RG 
Sbjct: 467 SCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGE 526

Query: 496 MPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNC 555
             CGH+   H CH     CPPCT  V+KPCKCGK T  RT+CFQ D+SCG KC   L+ C
Sbjct: 527 STCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYC 586

Query: 556 HHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGR 615
           +H CQK CH PG C   C + CG KR  C H C   CHG   CPD+PC   V + C CGR
Sbjct: 587 YHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGR 646

Query: 616 RSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGSSSVINK 675
               V CGA  D+ S T +  L C+++C  +++ + L +     E TN         + K
Sbjct: 647 IKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDALKK 706

Query: 676 ----PTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQ 731
                T++E+L LP++E  + V+SKQ  WC  I+  L +L++DK+R SLHFKPM+ PQR 
Sbjct: 707 LVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQRH 766

Query: 732 FVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLLYQRMKTFQKERRD 789
           F+ EL+KA+GLYSESQDREP RSVF+K      S  P + L+EA  LY+  K  QKER+ 
Sbjct: 767 FIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKERKA 826

Query: 790 LELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLK 849
            E Q  TT  LI+  + D ++ K   A  N  L+  +    T E+++  F+  LK TL+ 
Sbjct: 827 QEFQARTTAKLINFEVQD-TEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLVV 885

Query: 850 DPQFRLINSN--AYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADF 907
           +PQ+ +++    A +YP N+   S N E D++ LV +F  + +   +  ++S   L +  
Sbjct: 886 NPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIS---LCSTE 942

Query: 908 NKTSQALNNSFISTEDP 924
            +  + L+   I  + P
Sbjct: 943 EELERRLDTPVIQEDSP 959

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/891 (49%), Positives = 567/891 (63%), Gaps = 18/891 (2%)

Query: 25  DDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKR 84
           DD + YYE++I++I  G  Y C+ICTVE+D TC+M+AC  CYRV+DY CI EWA KS+++
Sbjct: 47  DDDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEK 106

Query: 85  SADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCAST 144
           + D  WKCPNCYH   KV    R TCWCGK +NP+ N   PNSCGQTC A IC HGC+ T
Sbjct: 107 TVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKT 166

Query: 145 CHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICH 204
           CHLGPHP+C   V + C CGK ++ I CYQ+KA+K    C+  CGLPL C VH C++ CH
Sbjct: 167 CHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCH 226

Query: 205 SGPCGRCNTVMSGK------FKCYCGSNHLDSIICKDVAVTKMSRS---GKHKKWIGVFS 255
           +G CG C  +++ K       KCYCG++   SI C +    K  RS   G   +WIGVF+
Sbjct: 227 TGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFA 286

Query: 256 CKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCT 315
           C +IR V + C++HSF E C   PS + R  CP+ P++ KTC CG T L ++ + R+ C 
Sbjct: 287 CTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCD 346

Query: 316 DPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPS 375
           DPIPTC+ RC KPL CGKH+CP  CH   CMDPCLQI+  KC+C++ TF  PC F G+P 
Sbjct: 347 DPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPR 406

Query: 376 CNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKL 435
           CNIKCE+LMSCRRHRC  RCCSG+P A+ R        D  DESL+EA+HIC K CN  L
Sbjct: 407 CNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTL 466

Query: 436 SCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGS 495
           SCG+H C  KCHPGKCPPCLESDSNDL+CPCGK+V+ APVRCGT  P CN+PCI  +RG 
Sbjct: 467 SCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGE 526

Query: 496 MPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNC 555
             CGH+   H CHP    CPPCT  V+KPCKCGK    RT+CFQ D+SCG KC   L  C
Sbjct: 527 SSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFC 586

Query: 556 HHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGR 615
            H CQK CH PG C   C ++CG +R +C H C   CHG   CPD+PC   V ++C CGR
Sbjct: 587 RHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGR 646

Query: 616 RSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGSSSVINK 675
               V C A      A  +  L CD++C  +++ + L +     E +N         + K
Sbjct: 647 NEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKK 706

Query: 676 ----PTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQ 731
                T++E+L LP++E  + V+SKQ  WC  I+  L +L++DK+R SLHFKPM+ PQR 
Sbjct: 707 LVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRH 766

Query: 732 FVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLLYQRMKTFQKERRD 789
           F+ EL+KA+GLYSESQDREP RSVF+K     TS  P + L EAL LY+  K  QKER+ 
Sbjct: 767 FIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKV 826

Query: 790 LELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLK 849
            E Q  TT  LI+  + D +  K   A  N  L+  +    TVE++K  F+  LK TL+ 
Sbjct: 827 QEFQSRTTAKLINFEVQD-AQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVV 885

Query: 850 DPQFRLINSN--AYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNV 898
           +PQ+ +++    A +YP N+   S N E D++ LV +F  + +   +  ++
Sbjct: 886 NPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSI 936

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/902 (50%), Positives = 577/902 (63%), Gaps = 18/902 (1%)

Query: 25  DDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKR 84
           ++ L +YE+AIKDI  G  Y C+ICT+E+DST +MYACS+CYRV+DY+CI EWA KSS++
Sbjct: 63  NEDLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQK 122

Query: 85  SADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCAST 144
           S D  WKCPNC H+ NK+  + R TCWCGK +NP+ N  YPNSCGQTC A  C H C+  
Sbjct: 123 SLDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHF 182

Query: 145 CHLGPHPKCMVPVGLKCKCGKITEQISCY---QTKAVKPKLSCKLPCGLPLPCGVHTCQK 201
           CHLGPHP+C     + C+CGK T+ + CY     K    K +C   C + L CG+H C +
Sbjct: 183 CHLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSR 242

Query: 202 ICHSGPCGRCNTVMSGKFKCYCGSNHLDSIICKDVAV---TKMSRSGKHKKWIGVFSCKN 258
           +CHSG CG C  +++ K  CYCGS  +D I C +V +    K S+  +   WIGVF C  
Sbjct: 243 VCHSGSCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNK 302

Query: 259 IREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPI 318
           IR V Y CK HSF E+C   P+      CPYSP + KTC CG T L D + KR+KCTDPI
Sbjct: 303 IRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPI 362

Query: 319 PTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNI 378
            TC+ RC KPL CGKH CP TCH G CMDPC QIE RKCSC  + F  PCQF  KP CN+
Sbjct: 363 STCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNM 422

Query: 379 KCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCG 438
           KCE+LMSCRRHRC +RCCSGKP+A  R   +    D  DESL+EAEHIC K+CN KLSCG
Sbjct: 423 KCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLSCG 482

Query: 439 LHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPC 498
           +H+CT KCH GKCPPCLESDS+DLVCPCGK+V+ APVRCGT  P C +PCI  + GS PC
Sbjct: 483 IHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPC 542

Query: 499 GHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHL 558
           GH+   H CHP+   CPPCT  V+KPCKCGK   A+ +CFQ   SCG+ C  KL  CHH 
Sbjct: 543 GHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCHHY 602

Query: 559 CQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSL 618
           CQ +CH PGEC   CT++C  +R  C H C   CHGD  CPD+PC  +  V CGCGRR  
Sbjct: 603 CQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKE 662

Query: 619 KVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTL---RSSESTNKAEHGSSSVINK 675
            + CGA    +S   T+ L CDD C K Q+ + L        SSE           ++ K
Sbjct: 663 LLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESELERLKKIVEK 722

Query: 676 PTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHE 735
            TSYE+L LP+SE ++ V+SKQ  WC  I++ + + + DK++ SLHFKPM APQR F+H 
Sbjct: 723 VTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFIHA 782

Query: 736 LSKAFGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRMKTFQKERR--DLELQ 793
           L +A+ +YSESQDREPKRSV++K  K ++IP I L EAL LYQ  K  +KER+    E +
Sbjct: 783 LVEAYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKVQSFESK 842

Query: 794 HNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQF 853
            N T +    P      S T +   N  LI G+    T +++   F   LK TL+KD Q+
Sbjct: 843 KNVTYLNYQPP----ERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQY 898

Query: 854 RLI--NSNAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADFNKTS 911
            ++    +A +YP ++L IS NVE DI+ L  +F ++ +   +G +V    +T D  +T 
Sbjct: 899 SILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNIT-DILQTE 957

Query: 912 QA 913
            A
Sbjct: 958 SA 959

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/892 (48%), Positives = 577/892 (64%), Gaps = 20/892 (2%)

Query: 24  DDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSK 83
           D+  + YYE+A+++I  G  Y C+ICTVE+D TC+MYAC  CYRV+DYECI EWA KS++
Sbjct: 34  DEHDMAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTE 93

Query: 84  RSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCAS 143
           ++ D  WKCPNCY    +V  K R TCWCGK +NP+ N   PNSCGQTC A IC HGC+ 
Sbjct: 94  KTLDRVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSK 153

Query: 144 TCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPK--LSCKLPCGLPLPCGVHTCQK 201
            CHLGPHP C+  +  KC+CGK T +  CYQT ++K K    C   CGLPL CG+H C++
Sbjct: 154 QCHLGPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCER 213

Query: 202 ICHSGPCGRCNTVMSGK-----FKCYCGSNHLDSIICKDVAV-TKMSRSGKHKKWIGVFS 255
           +CHSG CG C  V++ K      +CYCG  H DS  CKDV V + +S+ GK   WIG F 
Sbjct: 214 LCHSGICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFG 273

Query: 256 CKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCT 315
           C  IR++ Y C+EHSF E C+PSPS   +I CP+SP + KTC CG T+L  + + R+ CT
Sbjct: 274 CSGIRKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCT 333

Query: 316 DPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPS 375
            PIP CD  CGK L+CG+HTCP TCH G CMDPC+QIE  +CSC +  +  PCQF  +P 
Sbjct: 334 SPIPNCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPR 393

Query: 376 CNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKL 435
           C+ KCE+LMSCRRHRC +RCC G+P A  R  T     +  DES +E+EHIC K+CN  L
Sbjct: 394 CDTKCESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTL 453

Query: 436 SCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGS 495
           SCG H C  KCHPGKCPPCLESDSNDLVCPCGK+V+ APVRCGT  P C+YPCI  ++ +
Sbjct: 454 SCGCHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNA 513

Query: 496 MPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNC 555
             CGH+   H CHP  E CP CTA V+KPCKCGK    RT+CFQND+SCG  C   L NC
Sbjct: 514 YKCGHKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNC 573

Query: 556 HHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGR 615
            H+CQK CH PGEC   C ++C  KR  C+H C   CHG++ CPD+PC   V + C C  
Sbjct: 574 PHMCQKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEV 633

Query: 616 RSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLR-SSESTNKAEHGSSSVIN 674
           +   + CGA  +  S   T  L CD++C + ++H  L +    S+ S N +   ++S+ N
Sbjct: 634 KESFITCGANSETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLEN 693

Query: 675 ---KPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQ 731
                 S+E+L LP+SE  +  F+KQ  WC  I++ L   ++++ + SLHFKPM+  QR 
Sbjct: 694 LAAVANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRH 753

Query: 732 FVHELSKAFGLYSESQDREPKRSVFVKILKTSKI--PAIGLSEALLLYQRMKTFQKERRD 789
           F+HEL+K++ LY ESQDREPKRSVFVK         P I L ++L +YQ  K  +KE++ 
Sbjct: 754 FIHELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKA 813

Query: 790 LELQHNTTKILIS-IPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLL 848
              +  TT   ++ IP ++    +   A  NA  +  V    T E+++  F + LK TL+
Sbjct: 814 QRFEAQTTTEFVNFIPKEEPQLER---AKNNAFKLKNVSTGTTKEDLERIFADHLKPTLV 870

Query: 849 KDPQFRLINS--NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNV 898
           K+PQF++ +S  N  IYP ++ EIS NVE D++ LV +F ++C+   IG  +
Sbjct: 871 KNPQFKIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGI 922

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/902 (48%), Positives = 571/902 (63%), Gaps = 6/902 (0%)

Query: 29  PYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSADS 88
           PYYEK +K+I+ G  Y C+ICTVE+D TC MYAC +CYRV+D+ECI EWA KS+++S   
Sbjct: 44  PYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWALKSTQKSVSK 103

Query: 89  TWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCHLG 148
           TWKCPNCY    +V  K R TCWCGK + PE N   PNSCGQTC A IC+HGC+S CHLG
Sbjct: 104 TWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEHGCSSICHLG 163

Query: 149 PHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICHSGPC 208
           PHP CM  V +KC CGK  + + C++         C  PCGL LPCG+H CQ+ CHSG C
Sbjct: 164 PHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKCQRKCHSGIC 223

Query: 209 GRCNTVMSGKFKCYCGSNHLDSIICKDVAVTKMSRSGKHKKWIGVFSCKNIREVRYRCKE 268
           G C   + G   CYC      S+ C +V +   SR     KW+G FSC+NIR V + CK+
Sbjct: 224 GECPESIYGTINCYCKLESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENIRTVEHSCKK 283

Query: 269 HSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIPTCDQRCGKP 328
           HSF E CK  PS   ++ CP+SP   KTC CG + L +M   R +CTDPIPTCD  CGK 
Sbjct: 284 HSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIPTCDSVCGKM 343

Query: 329 LSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIKCENLMSCRR 388
           L CGKH CP  CH G CM+ CL  ++ KCSC  R F+ PC+F  K  CN KCE LMSCRR
Sbjct: 344 LRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTKCEALMSCRR 403

Query: 389 HRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGLHHCTNKCHP 448
           HRCI+RCC G+ LA +R   +    DK DESL+EA+HIC K CN KLSCG H C  KCHP
Sbjct: 404 HRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGKHFCKRKCHP 463

Query: 449 GKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCGHRAPFHKCH 508
           G C PCLESDSNDLVCPCGK+V+ APVRCGTV P C +PCI TL+G  PCGH    H CH
Sbjct: 464 GNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPCGHPPMPHPCH 523

Query: 509 PSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHLCQKQCHPPGE 568
           P  E CP CTA V+K CKC K    RT+CFQND+SCGR C  +L  C H+CQK CH  GE
Sbjct: 524 PLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHICQKACHKEGE 583

Query: 569 CPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLKVPCGAYKDK 628
           C  +C + CG  R  CEH C A CH    CPD PCL  V + C CG RS  V CGA +++
Sbjct: 584 CQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTTVTCGANENR 643

Query: 629 ESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTN---KAEHGSSSVINKPTSYEDLGLP 685
             A  T +L C++DC   ++H  L++        N   K+     ++  K +++++L LP
Sbjct: 644 APAEET-ALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEKVSTFQELLLP 702

Query: 686 YSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKAFGLYSE 745
           +SE  + +FSKQ TWC  I++ L RL+ DK++ SLHFKPM+ PQR F+HEL +A+ LY E
Sbjct: 703 FSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHELGQAYHLYCE 762

Query: 746 SQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRMKTFQKERRDLELQHNTTKILISIPI 805
           SQD+EPKRSVFVK    S+ P+I L  AL LY   K+ Q+E++  E + +TT  +I+  +
Sbjct: 763 SQDQEPKRSVFVKKTADSQRPSISLKVALPLYYSFKSAQREKKLKETERHTTTRIINYAV 822

Query: 806 DDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFRLINS-NAYIYP 864
            D + +    A  N +L+  V   +  + I+  F E LK TLLKDP + L+ S +  +Y 
Sbjct: 823 TDQAQTPPA-ARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLLASGDVLVYC 881

Query: 865 SNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADFNKTSQALNNSFISTEDP 924
            ++   S NVE DI+R+V +  H+ + + +   V A ++ +  +    + +++  S  + 
Sbjct: 882 DDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFLDDLESSTSDAATSISNS 941

Query: 925 DF 926
           + 
Sbjct: 942 EL 943

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/886 (48%), Positives = 575/886 (64%), Gaps = 21/886 (2%)

Query: 24  DDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSK 83
           +D  LPYYE+A+++I  G LY C+ICTVE+D TC+M+AC  CYRV+DY+C+ EWA KS+ 
Sbjct: 47  EDQDLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKSTD 106

Query: 84  RSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCAS 143
           ++ D  WKCPNCY    KV  K R TCWCGK +NPE N   PNSCGQTC A IC HGC+ 
Sbjct: 107 KTVDRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGCSK 166

Query: 144 TCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPK--LSCKLPCGLPLPCGVHTCQK 201
            CHLGPHP+C+    +KC+CGK T++I C++TK  + +    C  PC   LPCG+H CQK
Sbjct: 167 ICHLGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRCQK 226

Query: 202 ICHSGPCGRCN---TVMSG---KFKCYCGSNHLDSIICKDVAVT-KMSRSGKHKKWIGVF 254
           ICHSG CG C    TV  G      CYCG +  +SI CKDV VT + S++    +WIGV+
Sbjct: 227 ICHSGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIGVY 286

Query: 255 SCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKC 314
           +CK+IR V Y C++HSF E C   P+     +CP+SP   KTC CG T L  + + R +C
Sbjct: 287 ACKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARRRC 346

Query: 315 TDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKP 374
            DPIP C+ RC K L CGKHTCP  CH G CMDPC+QI++ KC+C+  TFL PC F G P
Sbjct: 347 IDPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQGAP 406

Query: 375 SCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRK 434
            C +KCE+L+SCRRH+C +RCCSG+P A  R    + + D NDE+L+EAEH+C K CN  
Sbjct: 407 HCQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACNLT 466

Query: 435 LSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRG 494
           LSCG H C  KCHPGKCPPCLESDSNDLVCPCGK+++ APVRCGT  P+C +PCI  + G
Sbjct: 467 LSCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVVEG 526

Query: 495 SMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTN 554
              CGH+   H CHP  + CPPCTA V+KPCKCGK +  RTICFQ D+SCG+ C   L N
Sbjct: 527 ISECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPLPN 586

Query: 555 CHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCG 614
           CHH CQK CH PG+C  TC +VC      C H C  +CHG   CPD+ C+  V + C CG
Sbjct: 587 CHHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCPCG 646

Query: 615 RRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSE-----STNKAEHGS 669
           R+ ++V CGA     S+  T+ L CD++C    +H+ L +    ++     S  K + G+
Sbjct: 647 RKEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEKEGT 706

Query: 670 --SSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKA 727
               + +K T++E+L  P++E  +  + +Q  WC  I+++L   ++++ + SLHFKPMK 
Sbjct: 707 RLEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKP 766

Query: 728 PQRQFVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLLYQRMKTFQK 785
           PQR F+ EL+KA+ LYSE+QD EPKRSVFVK     +S  P   LSE   LYQ  K  +K
Sbjct: 767 PQRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKLLEK 826

Query: 786 ERRDLELQHNTTKILISIPI-DDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLK 844
           ER+  +    TT  LI++ + DD +         NA LI  +    T++++K  F + ++
Sbjct: 827 ERKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGKYME 886

Query: 845 QTLLKDPQFRLI--NSNAYIYPSNFLEISANVETDIQRLVPYFSHV 888
           +TL+++PQ++ +   ++A +YP ++  ISAN   D++ LV + + +
Sbjct: 887 KTLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFI 932

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/891 (48%), Positives = 569/891 (63%), Gaps = 18/891 (2%)

Query: 25  DDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKR 84
           DD L YYE+AI++I  G  Y C+ICTVE+D TC+M+AC  CYRV+DY CI EWA KS+++
Sbjct: 52  DDDLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEK 111

Query: 85  SADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCAST 144
           + D  WKCPNCYH   KV  + R TCWCG  +NP+ N   PNSCGQTC A  C HGC   
Sbjct: 112 TVDKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKI 171

Query: 145 CHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKICH 204
           CHLGPHP+C   V +KC CG+ ++ I CYQ+KA++ + +C+  CGL L CGVH C+K CH
Sbjct: 172 CHLGPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCH 231

Query: 205 SGPCGRCNTVM------SGKFKCYCGSNHLDSIICKDVAVTKMSRSGKHK---KWIGVFS 255
           SG CG C   +        + KCYCG++  +SI C +    K  R+ K +   +W GVF+
Sbjct: 232 SGLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFA 291

Query: 256 CKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCT 315
           C +IR V Y C +HSF E C   P+   +  CP+ P++ KTC CG T L ++ + R+ C 
Sbjct: 292 CADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCH 351

Query: 316 DPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPS 375
           DPIPTC+ RC KPL CGKH CP TCH G CMDPCLQI+   CSC++ TF  PC F   P 
Sbjct: 352 DPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPR 411

Query: 376 CNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKL 435
           CNIKCE+LMSCRRHRCI RCCSG+P A+ R  +     D  DESL+EA+HIC K CN  L
Sbjct: 412 CNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTL 471

Query: 436 SCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGS 495
           SCGLH C  KCHPGKCPPCLESDSNDL+C CGK+V+ APVRCGT  P CN+PCI  +RG 
Sbjct: 472 SCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGE 531

Query: 496 MPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNC 555
             CGH+   H CHPS   CPPCT  V+KPC+CGK    RT+CFQ D+SCG  C   L+ C
Sbjct: 532 SWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGC 591

Query: 556 HHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGR 615
           +H CQK CH  G+C   C ++CG KR  C H C   CHG   CPD+PC   V ++C CGR
Sbjct: 592 YHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGR 651

Query: 616 RSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGS----SS 671
               + C A +D  S   +  L C+++C  +++ + L +    SE  N          S 
Sbjct: 652 IKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALSE 711

Query: 672 VINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQ 731
           +++   ++E+L LP++E  + V+SKQ  WC  I+  L +L++ + R SLHFKPM+ PQR 
Sbjct: 712 LVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQRH 771

Query: 732 FVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLLYQRMKTFQKERRD 789
           F+HE++KA+ LY+ESQDREP RSVF+K     TSK P + L+EA  LY+  K  QKER+ 
Sbjct: 772 FIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERKL 831

Query: 790 LELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLK 849
            E Q  TT  LI+  + D ++SK   A  N  L+  +    TVE++K  F+  LK TL+ 
Sbjct: 832 QEFQARTTAKLINFEVQD-AESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVA 890

Query: 850 DPQFRLINS--NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNV 898
           +PQ+ +++   +A IYP N+   S N E D++ LV +F  + +   +  ++
Sbjct: 891 NPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSI 941

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/886 (49%), Positives = 572/886 (64%), Gaps = 21/886 (2%)

Query: 28  LPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSKRSAD 87
           + YYE+A+K+I  G  Y C+ICTVE+D TC+M+ACS CYRV+DY+CI EWA KS+ R+ D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 88  STWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCASTCHL 147
            TWKCPNC    NKV  K R TCWCGK +NP+ N   PNSCGQTC A IC+HGC+  CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 148 GPHPKCMVPVGLKCKCGKITEQISCYQTKAVK-PKLSCKLPCGLPLPCGVHTCQKICHSG 206
           GPHP+C   + +KCKCG+ T  + C +  + +  + +C+  CGL LPCGVH C K CHSG
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSG 235

Query: 207 PCGRCNTVMSGK------FKCYCGSNHLDSIICKDVAVT-KMSRSGKHKKWIGVFSCKNI 259
            CG CN  +  K       KCYCG +   SI C DV V  + S   +   WIGVF CK++
Sbjct: 236 LCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDDQGNGWIGVFRCKDV 295

Query: 260 REVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIP 319
           R V Y C +HSF ESCKP+PS   +I CP+SPN+ ++C CG T L  + Q R KCTD IP
Sbjct: 296 RVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIP 355

Query: 320 TCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIK 379
           TC+ +CGK L+CGKHTCP  CH G CMDPC+Q E+  C C+ R+FL PCQF   P CN K
Sbjct: 356 TCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTK 415

Query: 380 CENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGL 439
           CE+LMSCRRHRC ++CCSGKP A  R  T     +  DESL+EAEH+C K+CN  L+CG 
Sbjct: 416 CESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGR 475

Query: 440 HHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCG 499
           H C  KCHPG+CPPCLESD NDLVCPCGK+V+ APVRCGT  P C Y CI+ +R   PCG
Sbjct: 476 HKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCG 535

Query: 500 HRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHLC 559
           H    H CHP  E CPPCTA V KPCKCGK +  RT+CFQ D+SCG+ C   L +C H C
Sbjct: 536 HTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHTC 595

Query: 560 QKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLK 619
           QK+CH  G C   C ++CG KR  C+H C   CHG E CPD PC   VV+ C CGR+   
Sbjct: 596 QKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKEST 654

Query: 620 VPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGSSSVINKPTSY 679
            PCG      SA+ T+ L CD++C +V++   L   L   E+ + +   + S     +++
Sbjct: 655 EPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVASNF 714

Query: 680 EDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKA 739
           E+LGLP+ E ++ ++S+Q  +C NI+  L   ++D+ + SLHFKPMK  QR FVHEL+KA
Sbjct: 715 EELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKA 774

Query: 740 FGLYSESQDREPKRSVFVK--ILKTSKIPAIGLSEALLLYQRMKTFQKER--RDLELQHN 795
           + LYSESQD EPKRSV+VK  +   S  P+I L EAL +YQ  K  +KE   R  E+Q N
Sbjct: 775 YKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQ-N 833

Query: 796 TTKILISIPIDDGSDSKTLE-ASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFR 854
            T ++  +P        T+E A  N  LI  +      E+++  + E LK TL+++P ++
Sbjct: 834 VTNLVNFVP----KFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYK 889

Query: 855 LINSN--AYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNV 898
            +     A I+P ++ +++ N E D++RLV +F  +C+   IG  V
Sbjct: 890 ALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGV 935

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score =  853 bits (2203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/913 (47%), Positives = 569/913 (62%), Gaps = 33/913 (3%)

Query: 24  DDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSSK 83
           +DDGL YYE+ I+DI  G  Y C+ICT+E+D TC+MYAC +CYRV+DYECI EWA+KS+ 
Sbjct: 41  EDDGLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSAS 100

Query: 84  RSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCAS 143
           ++ D  WKCPNC HS  ++  + R TCWCGK INP+ N   PNSCGQTC    C HGC +
Sbjct: 101 KTIDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKN 160

Query: 144 TCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPK--LSCKLPCGLPLPCGVHTCQK 201
            CHLGPH +C V   LKCKCG+  + I C+Q K         C   C LPL CGVH C++
Sbjct: 161 FCHLGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKR 220

Query: 202 ICHSGPCGRCNTVMSG------------KFKCYCGSNHLDSIICKDVAVT-KMSRSGKHK 248
           +CHSG CG C  ++S             KFKCYCG N  + I+CK +A+T   S++ +  
Sbjct: 221 VCHSGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGD 280

Query: 249 KWIGVFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQ 308
           KWIG F+CK  R V Y C EHSF E C+   S   +  CPY+P +  +C CG T+L  + 
Sbjct: 281 KWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLA 340

Query: 309 QKREKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPC 368
           QKR+KCTDPIPTC+ RCGK L CGKHTCP  CH G CMDPC+Q+E   CSC ++ FL PC
Sbjct: 341 QKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPC 400

Query: 369 QFDGKPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICF 428
            F+  P C  KCE+LMSCRRHRC K+CC+GKP A  R   +    + NDESL+EA HIC 
Sbjct: 401 NFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICL 460

Query: 429 KNCNRKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPC 488
           K CN KLSCG+H CT KCHPG+CP CL SDSNDLVCPCGK+VI APVRCG+  P C + C
Sbjct: 461 KECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFEC 520

Query: 489 INTLRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKC 548
           I  +  S PCGH+ P H+CHPSTE CPPCTA V +PCKCGK  A + +CFQ   SCG  C
Sbjct: 521 IKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEIC 580

Query: 549 AAKLTNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVV 608
             +L NCHH CQ +CH  G+C  +C +VC   R+ C H C + CHG   CPDVPC E   
Sbjct: 581 NKELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTK 640

Query: 609 VSCGCGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTL---RSSESTNKA 665
           VSC CGR+     C A  D  SA + + L CD+DC    +H  L        S +++NK 
Sbjct: 641 VSCKCGRKQEYRKCYATLDNSSA-SIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKN 699

Query: 666 EHGSSSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPM 725
                S++ K ++YE+L LPY + ++  +SKQ  WC  I+D L + + DK++ +LHFKPM
Sbjct: 700 IQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPM 759

Query: 726 KAPQRQFVHELSKAFGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRMKTFQK 785
           K  QR FV ELS +F LYSESQD EPKRSVFVK    ++IP I L E L L+   K  +K
Sbjct: 760 KPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLEK 819

Query: 786 ERRDLELQHNTTKILIS-----IPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFD 840
           ER+    +  + +  I+     + +   +D+       N   I  +   +T E++   F 
Sbjct: 820 ERKIQHFESTSQRKYINYEPKEVIVKSSNDT-------NGFFIKKISPGITEEDLSEVFG 872

Query: 841 ECLKQTLLKDPQFRLI--NSNAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNV 898
           + LK TL+K+  ++++  +S+A IYP  +  I+ +V  D++ LV +F  + +   I  ++
Sbjct: 873 KALKSTLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSI 932

Query: 899 SAHKLTADFNKTS 911
               +    N+ S
Sbjct: 933 MLCNVEGYINQIS 945

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score =  842 bits (2176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/894 (47%), Positives = 563/894 (62%), Gaps = 18/894 (2%)

Query: 23  ADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKKSS 82
            D+  + YYEKA+++I  G  Y CLICTVE+D TC++YAC  CYRVYDYECI EWA+KS+
Sbjct: 54  GDEKDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKST 113

Query: 83  KRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHGCA 142
            +  D  W CPNC+++   +  K R TCWCG+Q+NPE N   PNSCGQTC A IC HGC+
Sbjct: 114 SKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCS 173

Query: 143 STCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQKI 202
             CHLGPH +C   + +KC CGK+T+ I C+Q +      +C+  C   LPCG+H C + 
Sbjct: 174 QICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRK 233

Query: 203 CHSGPCGRC-NTVMSG----KFKCYCGSNHLDSIICKDV---AVTKMSRSGKHKKWIGVF 254
           CH+G CG C  T++S     K +CYCG    D I CKDV   A    S+  K ++WIGVF
Sbjct: 234 CHTGLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVF 293

Query: 255 SCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKC 314
            C  IR+V Y C EHSF E CK  PS   R+ C +SP   KTC CG   L D+ + R KC
Sbjct: 294 MCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKC 353

Query: 315 TDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKP 374
           TD IPTC Q CGK L CGKH CP  CH G CMDPC QIE+ +C+C+++ F  PC F+   
Sbjct: 354 TDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHA 413

Query: 375 SCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWL-DKNDESLIEAEHICFKNCNR 433
            CN+KCE+LMSCRRHRC +RCC+G+PLA  R  T+   + D  DES IE  HIC K+CN 
Sbjct: 414 RCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNL 473

Query: 434 KLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLR 493
            LSCG+H C  KCH GKCPPCLESDSNDLVCPCGK+++ APVRCGT  PNC YPCI  +R
Sbjct: 474 TLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVR 533

Query: 494 GSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLT 553
           G   CGH    H+CHP    CP CTA V+KPCKCGK    RT+CF  D+SCG+ C  +L 
Sbjct: 534 GETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQ 593

Query: 554 NCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGC 613
            C+H CQK+CH PG C   C + C + R  C H C   CH  E CPD+PC   V ++C C
Sbjct: 594 TCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPC 653

Query: 614 GRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLLQTL----RSSESTNKAEHGS 669
           GR   +V CG Y   + A  +  ++CD++CA +Q+H  L +      +   + N+     
Sbjct: 654 GRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARL 713

Query: 670 SSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQ 729
             VI+  +++ DL LP++E ++  + +   WC +I+++L +L++D +R SLHFKPM+ PQ
Sbjct: 714 EQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQ 773

Query: 730 RQFVHELSKAFGLYSESQDREPKRSVFVK--ILKTSKIPAIGLSEALLLYQRMKTFQKER 787
           R F+ EL+KA+ LYSESQD EP RSVFVK  +  +S  P + +SEA  LYQ  K  +KE+
Sbjct: 774 RYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEK 833

Query: 788 RDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTL 847
           +    +  TT  LI+   +   + ++  A  N  L+T V    + ++++  F   LK TL
Sbjct: 834 KQANFESMTTTRLINFTPEMSPELESA-ARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTL 892

Query: 848 LKDPQFRLI--NSNAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVS 899
           + +PQF+++     A IYP+ + EIS NVE D++ LV +F  + +   +   V 
Sbjct: 893 VVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVE 946

>Kwal_8.565 s8 (9259..9570) [312 bp, 103 aa] {OFF} [contig 311] FULL
          Length = 103

 Score = 31.6 bits (70), Expect = 2.3,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 46  CLICTVEIDST-CRMYACSNCYRVYDYECIMEW------AKKSSKRSADSTWKCPNCYHS 98
           C +C +  DS  C M   ++C   + YE I +W      A ++SK     T+   NC   
Sbjct: 40  CAVCVLTFDSANCIM---TDCMMTHQYEVICDWSMSGKEANETSKNVLPRTYFAQNCLSE 96

Query: 99  YNKVL 103
           YN +L
Sbjct: 97  YNSIL 101

>Smik_11.274 Chr11 complement(459047..460702) [1656 bp, 551 aa] {ON}
           YKR017C (REAL)
          Length = 551

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 51/120 (42%), Gaps = 22/120 (18%)

Query: 435 LSCGLHHCTNKCHPGK------CPPCLESDSNDLVC--PCGKSVILAPVRCGTVRPNCNY 486
           +SC  H+  +K H G       CP  L++D  D V   P    ++ + ++    + N NY
Sbjct: 201 ISCYRHYIKDKLHEGNIISCMDCPLALKNDDIDKVMGHPSSSKLMDSSIKSFVQKHNRNY 260

Query: 487 PC--------INTLR--GSMPCG---HRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAA 533
                     I  LR   S+P     H +PF KC+     C  C   V+ P  C K+T+A
Sbjct: 261 KWCPFADCKSIVHLRDTSSLPEYTRLHYSPFVKCNSFHRFCFNCGFEVHAPADC-KITSA 319

>ZYRO0A05566g Chr1 (453204..454574) [1371 bp, 456 aa] {ON} similar
           to uniprot|P53687 Saccharomyces cerevisiae YOR025W HST3
           Member of the Sir2 family of NAD( )-dependent protein
           deacetylases involved along with Hst4p in telomeric
           silencing cell cycle progression radiation resistance
           genomic stability and short-chain fatty acid metabolism
          Length = 456

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 41/109 (37%), Gaps = 17/109 (15%)

Query: 436 SCGLHHCTNKCHPGKCPPCLES--DSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLR 493
           + GL   TN+  PG       +   + D+V   G    LA  RC  V P   Y C +  R
Sbjct: 174 NLGLEMSTNEQDPGVIGTSFNARWKNYDVVQLHGDLKTLACTRCFHVFPWNRYWCRSFRR 233

Query: 494 GSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDI 542
           G +P                CP C    +K C+ GK     T C + +I
Sbjct: 234 GELPT---------------CPQCEEKNFKRCQEGKRQIDNTGCLRPNI 267

>TBLA0I02620 Chr9 complement(605456..614956) [9501 bp, 3166 aa] {ON} 
          Length = 3166

 Score = 33.5 bits (75), Expect = 3.8,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 10/100 (10%)

Query: 594  GDEICPDVPCLEEVVVSCGCGRRSLKVPCGAYKDKESATATQSLLCDDDCAKVQKHQMLL 653
            G ++ PD P  +E  V     + +L+   G+Y+D  +AT       ++D  +    Q  L
Sbjct: 2140 GSQVIPDEPVSDEEFVDTIDNQNNLRTDEGSYEDFLNATN------ENDARQPSNSQGKL 2193

Query: 654  QTLRSSESTNKAEHG----SSSVINKPTSYEDLGLPYSEQ 689
            +TL    + ++   G    S+ V+N     ED  LP +EQ
Sbjct: 2194 RTLLVGNNQDQPIEGVNEYSNKVVNGDVENEDAYLPENEQ 2233

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,228,506
Number of extensions: 4115511
Number of successful extensions: 10167
Number of sequences better than 10.0: 49
Number of HSP's gapped: 9311
Number of HSP's successfully gapped: 55
Length of query: 926
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 807
Effective length of database: 39,836,145
Effective search space: 32147769015
Effective search space used: 32147769015
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)