Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_33262.287ON36636619220.0
CAGL0G02585g2.287ON37236615180.0
NCAS0B062502.287ON37337314860.0
KLLA0E08339g2.287ON36936814830.0
Kpol_1003.392.287ON37037014760.0
KLTH0G10384g2.287ON36736814750.0
SAKL0E07656g2.287ON36836814730.0
Kwal_27.115282.287ON36736814660.0
TDEL0G021802.287ON36936914660.0
KNAG0A054202.287ON37237114370.0
NDAI0B035502.287ON37237214340.0
Suva_9.1052.287ON37135014300.0
TPHA0C034102.287ON37134914260.0
ZYRO0A01914g2.287ON36835614190.0
Smik_9.852.287ON37137114180.0
YIL094C (LYS12)2.287ON37135014140.0
TBLA0B059402.287ON36936914030.0
Skud_9.792.287ON37135514020.0
KAFR0J013602.287ON37336113670.0
ADL214C2.287ON36735513660.0
Ecym_23135.473ON3703664621e-53
YNL037C (IDH1)2.278ON3603504612e-53
Smik_14.2902.278ON3603504612e-53
ADL223W2.278ON3623654593e-53
Skud_14.2932.278ON3613504594e-53
KLLA0E03125g5.473ON3683534586e-53
KAFR0B063705.473ON3783474543e-52
TPHA0D015602.278ON3603504481e-51
AFR137C5.473ON3673554482e-51
NDAI0C014105.473ON3693664482e-51
CAGL0I07227g5.473ON3683724472e-51
KLTH0F15048g5.473ON3683534455e-51
TBLA0B022405.473ON3733534412e-50
NCAS0H022505.473ON4223664442e-50
Skud_15.3005.473ON3693744385e-50
Kpol_1039.352.278ON3593504375e-50
SAKL0G03520g5.473ON3693744376e-50
NDAI0B035902.278ON3593504367e-50
KNAG0B040705.473ON3733664378e-50
Smik_15.3165.473ON3693684351e-49
Ecym_33162.278ON3623664342e-49
Suva_8.1885.473ON3693614342e-49
Kwal_55.212735.473ON3683554315e-49
TDEL0A033705.473ON3713594315e-49
YOR136W (IDH2)5.473ON3693744307e-49
TBLA0B069102.278ON3653504262e-48
Kwal_23.50122.278ON3613804221e-47
KLLA0F04103g2.278ON3613504211e-47
NCAS0B062902.278ON3593504192e-47
Kpol_543.85.473ON3683534193e-47
TDEL0C038402.278ON3613504166e-47
TPHA0E014805.473ON3773424176e-47
KLTH0G10186g2.278ON3603794151e-46
ZYRO0D11220g5.473ON3683664123e-46
TPHA0J027705.473ON3763574114e-46
Kpol_440.125.473ON3683754072e-45
SAKL0E07876g2.278ON3613504044e-45
ZYRO0D02838g2.278ON3613504019e-45
KNAG0A052802.278ON3613503992e-44
CAGL0G02673g2.278ON3583503974e-44
KAFR0J014102.278ON3503723912e-43
TBLA0C015001.402ON3653633661e-39
Suva_14.3022.278ON3002923585e-39
Ecym_12961.402ON3633633554e-38
AAL012C1.402ON3723663512e-37
KLLA0D04906g1.402ON3623663408e-36
Smik_3.661.402ON3643673363e-35
YCL018W (LEU2)1.402ON3643673345e-35
Skud_3.431.402ON3643673345e-35
Kwal_0.2251.402ON3643743339e-35
Kpol_1048.631.402ON3643593329e-35
NDAI0G042301.402ON3633653311e-34
TDEL0B060001.402ON3623663302e-34
KAFR0I022001.402ON3653643293e-34
KLTH0H12188g1.402ON3643653275e-34
CAGL0H03795g1.402ON3653653215e-33
KNAG0I012801.402ON4473743193e-32
Suva_3.31.402ON3643743127e-32
ZYRO0E04796g1.402ON3623683022e-30
NCAS0C048701.402ON3653713004e-30
SAKL0D08690g1.402ON3643692988e-30
TPHA0B037301.402ON3653682732e-26
KLTH0H12012g1.396ON4132711754e-13
Kwal_23.42104.254ON4222721692e-12
CAGL0D00770g4.254ON4232001648e-12
TDEL0E011604.254ON4232751612e-11
AAL022W1.396ON4152801603e-11
Ecym_13061.396ON4152801593e-11
Kwal_0.1911.396ON4112041577e-11
KLLA0F12342g1.396ON4152711569e-11
SAKL0H02860g4.254ON4212791504e-10
KLLA0B03355g4.254ON4292711497e-10
KNAG0D044104.254ON4282101497e-10
TDEL0B061001.396ON4142461489e-10
KAFR0H031601.396ON4213141489e-10
SAKL0D08426g1.396ON4112071481e-09
NCAS0A025104.254ON4262111471e-09
TBLA0C012901.396ON4181431452e-09
KAFR0I021301.396ON4082441452e-09
ZYRO0E05016g1.396ON4111791452e-09
TPHA0B022104.254ON4332731434e-09
KLTH0D14476g4.254ON4202711425e-09
AER061C4.254ON4252001417e-09
KAFR0G032604.254ON4212261409e-09
NDAI0D043604.254ON4242131382e-08
TPHA0B036601.396ON4221261372e-08
NCAS0A087201.396ON4131991362e-08
ZYRO0B12496g4.254ON4222711362e-08
CAGL0B04917g1.396ON4111811362e-08
CAGL0H03663g1.396ON4181411345e-08
KNAG0I013201.396ON4121331337e-08
KNAG0H016701.396ON4242261321e-07
Skud_12.2391.396ON4121261311e-07
Kpol_1055.784.254ON4272001292e-07
Suva_10.2711.396ON4121801292e-07
YDL066W (IDP1)4.254ON4281441283e-07
Ecym_32654.254ON4241331273e-07
YLR174W (IDP2)1.396ON4121261273e-07
Smik_4.1694.254ON4281441274e-07
Skud_4.1894.254ON4291441274e-07
Smik_12.2351.396ON4121261265e-07
Smik_14.3191.396ON4182601265e-07
Suva_4.1844.254ON4291441256e-07
Suva_14.3391.396ON4171461257e-07
YNL009W (IDP3)1.396ON4201301257e-07
TBLA0A080104.254ON4281331257e-07
Kpol_1048.701.396ON4191301231e-06
NDAI0G008501.396ON4192051221e-06
Skud_14.3181.396ON4201261212e-06
NCAS0G036201.396ON4181061185e-06
NDAI0G051601.396ON4202611141e-05
Suva_14.303singletonON5350968e-05
CAGL0E06314g5.264ON631118751.0
CAGL0D01034g4.231ON36134721.6
AFR599W4.231ON36134721.9
CAGL0G09757g6.75ON142356722.6
TPHA0A017108.276ON28497702.7
TBLA0A081304.231ON36134712.8
Ecym_27824.231ON36134685.7
TPHA0B008904.231ON36134685.7
ZYRO0E06666g2.582ON1030109686.3
KLLA0E05435g4.231ON36134678.2
TPHA0B023254.231ON36134678.2
KNAG0A037508.531ON83096678.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3326
         (366 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   744   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   589   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   577   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   575   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   573   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   572   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   572   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   569   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   569   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              558   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   556   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   555   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   553   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   551   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   550   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   549   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   545   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   544   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   531   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   530   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   182   1e-53
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   182   2e-53
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   182   2e-53
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   181   3e-53
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   181   4e-53
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   181   6e-53
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   179   3e-52
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   177   1e-51
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   177   2e-51
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   177   2e-51
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   176   2e-51
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   176   5e-51
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   174   2e-50
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    175   2e-50
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   173   5e-50
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   172   5e-50
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   172   6e-50
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   172   7e-50
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   172   8e-50
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   172   1e-49
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   171   2e-49
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   171   2e-49
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   170   5e-49
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   170   5e-49
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   170   7e-49
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            168   2e-48
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   167   1e-47
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   166   1e-47
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   166   2e-47
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   166   3e-47
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   164   6e-47
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   165   6e-47
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   164   1e-46
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   163   3e-46
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   162   4e-46
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   161   2e-45
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   160   4e-45
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   159   9e-45
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              158   2e-44
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   157   4e-44
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   155   2e-43
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   145   1e-39
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   142   5e-39
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   141   4e-38
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   139   2e-37
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   135   8e-36
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   134   3e-35
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   133   5e-35
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   133   5e-35
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   132   9e-35
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   132   9e-35
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   132   1e-34
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   131   2e-34
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   131   3e-34
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   130   5e-34
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             128   5e-33
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   127   3e-32
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      124   7e-32
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   120   2e-30
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   120   4e-30
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   119   8e-30
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   109   2e-26
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    72   4e-13
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    70   2e-12
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    68   8e-12
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    67   2e-11
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    66   3e-11
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    66   3e-11
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    65   7e-11
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    65   9e-11
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    62   4e-10
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    62   7e-10
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    62   7e-10
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    62   9e-10
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    62   9e-10
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    62   1e-09
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    61   1e-09
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    60   2e-09
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    60   2e-09
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    60   2e-09
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    60   4e-09
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    59   5e-09
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    59   7e-09
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    59   9e-09
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    58   2e-08
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    57   2e-08
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    57   2e-08
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    57   2e-08
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    57   2e-08
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    56   5e-08
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    56   7e-08
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    55   1e-07
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    55   1e-07
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    54   2e-07
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    54   2e-07
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    54   3e-07
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    54   3e-07
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    54   3e-07
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    54   4e-07
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    54   4e-07
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    53   5e-07
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    53   5e-07
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    53   6e-07
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    53   7e-07
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    53   7e-07
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    53   7e-07
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    52   1e-06
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     52   1e-06
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    51   2e-06
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    50   5e-06
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    49   1e-05
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    42   8e-05
CAGL0E06314g Chr5 complement(634890..636785) [1896 bp, 631 aa] {...    33   1.0  
CAGL0D01034g Chr4 complement(121908..122993) [1086 bp, 361 aa] {...    32   1.6  
AFR599W Chr6 (1516363..1517448) [1086 bp, 361 aa] {ON} Syntenic ...    32   1.9  
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    32   2.6  
TPHA0A01710 Chr1 (347874..348728) [855 bp, 284 aa] {ON} Anc_8.27...    32   2.7  
TBLA0A08130 Chr1 complement(2009133..2010218) [1086 bp, 361 aa] ...    32   2.8  
Ecym_2782 Chr2 (1519759..1520844) [1086 bp, 361 aa] {ON} similar...    31   5.7  
TPHA0B00890 Chr2 complement(207124..208209) [1086 bp, 361 aa] {O...    31   5.7  
ZYRO0E06666g Chr5 complement(501139..504231) [3093 bp, 1030 aa] ...    31   6.3  
KLLA0E05435g Chr5 complement(488881..489966) [1086 bp, 361 aa] {...    30   8.2  
TPHA0B02325 Chr2 complement(532389..533474) [1086 bp, 361 aa] {ON}     30   8.2  
KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.5...    30   8.6  

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/366 (100%), Positives = 366/366 (100%)

Query: 1   MLRVGRGQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQA 60
           MLRVGRGQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQA
Sbjct: 1   MLRVGRGQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQA 60

Query: 61  GWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIR 120
           GWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIR
Sbjct: 61  GWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIR 120

Query: 121 PVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANI 180
           PVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANI
Sbjct: 121 PVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANI 180

Query: 181 ALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSM 240
           ALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSM
Sbjct: 181 ALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSM 240

Query: 241 VYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDI 300
           VYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDI
Sbjct: 241 VYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDI 300

Query: 301 VGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVAN 360
           VGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVAN
Sbjct: 301 VGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVAN 360

Query: 361 DILSRI 366
           DILSRI
Sbjct: 361 DILSRI 366

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/366 (77%), Positives = 322/366 (87%), Gaps = 3/366 (0%)

Query: 2   LRVGRGQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAG 61
           L   RG  STR  +  K+ TIGLIPGDGIGKEVIP G+++LEK+GPK+ +DFK+IDL AG
Sbjct: 9   LTAMRGFSSTR--LAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAG 66

Query: 62  WQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRP 121
           W+TF +TGKALPD+TVE LR +CQGALFGAVQSPTTKV+GYSSPIVALRKA+GL+AN+RP
Sbjct: 67  WETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRP 126

Query: 122 VKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIA 181
           VK+V+GT DRPVD+VI RENTEDLYIK E+TY D  TG RVAEA KRISE ATR IA IA
Sbjct: 127 VKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIA 186

Query: 182 LEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVDSM 240
           L+IALQRL+ +GHATLTVTHKSNVLSQSDGLFREICK VY+SNK K+  +QYNEQIVDSM
Sbjct: 187 LDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSM 246

Query: 241 VYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDI 300
           VYR+F+EP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHGSAPDI
Sbjct: 247 VYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDI 306

Query: 301 VGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVAN 360
            G+GIANPIATIRS AL+LEFLG PEAA+ I K VD NIREN+IKTPDLGG ST +QV +
Sbjct: 307 AGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVD 366

Query: 361 DILSRI 366
           DILS+I
Sbjct: 367 DILSKI 372

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/373 (75%), Positives = 321/373 (86%), Gaps = 7/373 (1%)

Query: 1   MLRVGRGQLST---RTYVTS---KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFK 54
           MLR    + +T   RTY T+   K+ TIGLIPGDGIGKEVIP G++VLE +  K+G+ F 
Sbjct: 1   MLRTAASRFATSTCRTYATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFD 60

Query: 55  YIDLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALG 114
           +IDLQAG+QTFLDTGKALPD+TV+ L++ CQGALFGAVQSPTTKV+GYSSPIVALRK +G
Sbjct: 61  FIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMG 120

Query: 115 LYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHAT 174
           L+AN+RPVKSV GT DRPVD+VI RENTEDLYIK E+TYIDK TG RVAEA KRISE AT
Sbjct: 121 LFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIAT 180

Query: 175 RNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYN 233
           R IA IAL+IALQRLK  G ATLTVTHKSNVLSQSDGLFREICK VY+SNK K+ ++ YN
Sbjct: 181 RRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYN 240

Query: 234 EQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPC 293
           EQIVDSMVYR+F+EPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPC
Sbjct: 241 EQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPC 300

Query: 294 HGSAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNS 353
           HGSAPDI G+GIANPIATIRS AL+LEFLG  +AA+ I + V+ N+RENKIKTPDLGGNS
Sbjct: 301 HGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNS 360

Query: 354 TGEQVANDILSRI 366
           T +QV  D+L+R+
Sbjct: 361 TTQQVTEDVLARL 373

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/368 (74%), Positives = 320/368 (86%), Gaps = 2/368 (0%)

Query: 1   MLRVGRGQLSTRTYVT-SKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQ 59
           M+R    QLS R Y + +K+ TIGLIPGDGIGKEVIP G+K+LE + PKYG+ FK+IDLQ
Sbjct: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60

Query: 60  AGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANI 119
           AGW+TF +TGKALPD+T++ L+N C+GALFGAVQSPTTKV+GYSSPIVALRK LGL+AN+
Sbjct: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120

Query: 120 RPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIAN 179
           RPVKSVDGT DR VDLVI RENTEDLYIK E++YID+ TG RVA+A KRI+E AT+NIA 
Sbjct: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180

Query: 180 IALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVD 238
           IAL+IA QRL++ GHATLTVTHKSNVLSQSDGLFRE+C+  Y++NK K+  VQYNEQIVD
Sbjct: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240

Query: 239 SMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAP 298
           SMVYR+F+EP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPS NVGPNIVIGEPCHGSAP
Sbjct: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300

Query: 299 DIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQV 358
           DI G+GI+NPIATIRS AL+LEFLG PE A+ I K VD NIRE K  TPDLGGNST +QV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360

Query: 359 ANDILSRI 366
             D+LS++
Sbjct: 361 LEDVLSKL 368

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/370 (75%), Positives = 315/370 (85%), Gaps = 4/370 (1%)

Query: 1   MLRVGRGQLSTRTYVTS---KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYID 57
           MLR G  +   R  V +    + TIGLIPGDGIGKEVIP G+KVLE IG KY +DFK+ID
Sbjct: 1   MLRNGVYRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFID 60

Query: 58  LQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYA 117
           L AGWQTFLDTGKALPD+TV  L+  CQGALFGAVQSPTTKV+GYSSPIVALRK LGLYA
Sbjct: 61  LHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYA 120

Query: 118 NIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNI 177
           NIRPVKSV GT DRPVD+VI RENTEDLYIK ERTYID+ TG +VAEA KRISE ATR I
Sbjct: 121 NIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKI 180

Query: 178 ANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK-FANVQYNEQI 236
           A IAL+IALQRLK  G ATLTVTHKSNVLSQSDGLFRE+C+ VY+ NK  + NV YNEQI
Sbjct: 181 AKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQI 240

Query: 237 VDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGS 296
           VDSMVYR+F+EP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPS NVGP+I+IGEPCHGS
Sbjct: 241 VDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGS 300

Query: 297 APDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGE 356
           APDI GQGI+NP+ATIRSAAL+L+FLG  EAA+ I+  VDENIR  KIKTPDLGG+S+  
Sbjct: 301 APDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTT 360

Query: 357 QVANDILSRI 366
           +V +DILS++
Sbjct: 361 EVTDDILSKL 370

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/368 (75%), Positives = 320/368 (86%), Gaps = 3/368 (0%)

Query: 1   MLRVGRGQLSTRTYVT-SKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQ 59
           MLR    QL+ R+Y + SKS TIGLIPGDGIGKEVIP GR+VLE +  K+G+ F +IDLQ
Sbjct: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60

Query: 60  AGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANI 119
           AGWQTF +TGKALPD+T++ LRN CQGALFGAVQSPT KV+GYSSPIVALRK LGLYAN+
Sbjct: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 120 RPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIAN 179
           RPVKSV    +RPVD++I RENTEDLYIK+E+TYID++TG RVAEAIKRISE AT+NIAN
Sbjct: 121 RPVKSV-LPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIAN 179

Query: 180 IALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVD 238
           IALEIALQR K  G ATLTVTHKSNVLSQSDGLFRE+C+ VY+SNK KF +++YNEQIVD
Sbjct: 180 IALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVD 239

Query: 239 SMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAP 298
           SMVYR+F+EP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPS NVG + V+GEPCHGSAP
Sbjct: 240 SMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299

Query: 299 DIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQV 358
           DI G+GI+NP+ATIRS AL+LEF+G PEAA+ I K VD N+R+N IKTPDLGG ST +QV
Sbjct: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQV 359

Query: 359 ANDILSRI 366
             D+LSR+
Sbjct: 360 VEDVLSRM 367

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/368 (74%), Positives = 319/368 (86%), Gaps = 2/368 (0%)

Query: 1   MLRVGRGQLSTRTYVTS-KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQ 59
           MLR    Q + R+Y ++ K  TIGLIPGDGIGKEVIP G+ VLE +  K+ + F +IDLQ
Sbjct: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60

Query: 60  AGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANI 119
           AGWQTFLDTGKALPD+T+E L+++CQGALFGAVQSPT KV+GYSSPIVALRK LGLYAN+
Sbjct: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 120 RPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIAN 179
           RPVKSV GT DRPVD++I RENTEDLYIK+E+TYID++TG RVAEAIKRISE AT +IA 
Sbjct: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180

Query: 180 IALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVD 238
           IALEI+LQRLK  G ATLTVTHKSNVLSQSDGLFRE+CK+VY+SNK ++  + YNEQIVD
Sbjct: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240

Query: 239 SMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAP 298
           SMVYRLF+EP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPS NVG + ++GEPCHGSAP
Sbjct: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300

Query: 299 DIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQV 358
           DI G+GI+NPIATIRS AL+LEF+G  EAA+ I K VD NIREN+IKTPDLGG ST +QV
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360

Query: 359 ANDILSRI 366
            +DILS++
Sbjct: 361 VDDILSKM 368

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/368 (74%), Positives = 321/368 (87%), Gaps = 3/368 (0%)

Query: 1   MLRVGRGQLSTRTYVT-SKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQ 59
           MLR    QL+ R+Y + +KS TIGLIPGDGIG+EVIP G+ VLE +  K+G+ F +IDL+
Sbjct: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60

Query: 60  AGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANI 119
           AGWQTFLDTGKALPD+T++ L+N CQGALFGAVQSPT KV+GYSSPIVALRK LGLYAN+
Sbjct: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 120 RPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIAN 179
           RPVKSV  + ++P+D+VI RENTEDLYIK+E+TYID++TG RVAEAIKRISE ATRNIAN
Sbjct: 121 RPVKSV-LSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIAN 179

Query: 180 IALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVD 238
           IALEIALQR K  G ATLTVTHKSNVLSQSDGLFREIC+ VY+SN+ KF ++ YNEQIVD
Sbjct: 180 IALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVD 239

Query: 239 SMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAP 298
           SMVYRLF+EP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPS NVG + V+GEPCHGSAP
Sbjct: 240 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAP 299

Query: 299 DIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQV 358
           DI G+GI+NP+ATIRS AL+LEF+G PEAA+ I K VD N+R+N +KTPDLGG ST +QV
Sbjct: 300 DIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQV 359

Query: 359 ANDILSRI 366
            +D+LSR+
Sbjct: 360 VDDVLSRM 367

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/369 (75%), Positives = 316/369 (85%), Gaps = 3/369 (0%)

Query: 1   MLRVGRGQLSTRTYVTS--KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDL 58
           MLR   G+L+TR    S  KS  IGLIPGDGIGKEVIP G++VLE +  K+G++F +IDL
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60

Query: 59  QAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYAN 118
           QAGW TF +TGKALP+ TV+ L+N CQGALFGAVQSPTTKV+GYSSPIVALRK LGLYAN
Sbjct: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120

Query: 119 IRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIA 178
           +RPVKSV+GT DRPVD+VI RENTEDLYIK E+TY+DK TG RVAEA KRISE ATR IA
Sbjct: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180

Query: 179 NIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIV 237
            IAL+IALQRLK  GHATLTVTHKSNVLSQSDGLFREICK VY+SNK K+  V YNEQIV
Sbjct: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240

Query: 238 DSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSA 297
           DSMVYR+F+EP+CFDV+VAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHGSA
Sbjct: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300

Query: 298 PDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQ 357
           PDI G+GI+NPIATIRS  L+LEFLG  + A+ I + VD N+RE+K+KTPDLGGNST +Q
Sbjct: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360

Query: 358 VANDILSRI 366
           V  DILS++
Sbjct: 361 VVEDILSKL 369

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/371 (72%), Positives = 316/371 (85%), Gaps = 5/371 (1%)

Query: 1   MLRVGRGQLS----TRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYI 56
           MLR    +L+      T    KS TIGLIPGDGIGKEVIP G++VL+ + PK+G++F +I
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 57  DLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLY 116
           DLQAG+QTF DTGKALPD+TV+ L+  CQGALFGAVQSPTTKV+GYSSPIVALRKA+GLY
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 117 ANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRN 176
           ANIRPVKSV+G+ +RPVD++I RENTEDLYIK E+TYIDK TG RVAEA KRISE AT+ 
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQR 181

Query: 177 IANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQ 235
           IA IAL+IALQRL+  G ATLTVTHKSNVLSQSDGLFRE+C+ +Y++NK K+A + YNEQ
Sbjct: 182 IATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQ 241

Query: 236 IVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHG 295
           IVDSMVYR+F+EP+CFDVIVAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHG
Sbjct: 242 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 301

Query: 296 SAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTG 355
           SAPDI G+GIANPIATIRS AL+LEFLG  EAA+ I K VD N+R+  +KT DLGGN+T 
Sbjct: 302 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATT 361

Query: 356 EQVANDILSRI 366
           + V +DIL+R+
Sbjct: 362 QNVVDDILARL 372

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/372 (73%), Positives = 317/372 (85%), Gaps = 6/372 (1%)

Query: 1   MLRVGRGQLST-RTYVTS---KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYI 56
           MLR    +L+T R Y T+   K+ TIGLIPGDGIGKEVIP G++VL+ +  K+G++F +I
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 57  DLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLY 116
           DLQAG+QTFLDTGKALPD+T++ L+N CQGALFGAVQSPTTKV+GYSSPIVALRK +GLY
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 117 ANIRPVKSVDGTGDRPVDLVIARENTEDLY-IKSERTYIDKETGGRVAEAIKRISEHATR 175
           AN+RPVKSV+GT D+PVD+VI RENT     IK ERTYID+ TG RVAEA KRISE ATR
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 176 NIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNE 234
            IA IAL+IALQRLK  G ATLTVTHKSNVLSQSDGLFREICK VY+SNK K+  + YNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 235 QIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCH 294
           QIVDSMVYR+F+EPQCFDV+VAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 295 GSAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNST 354
           GSAPDI G+GI+NPIATIRS AL+LEFLG  EAA+ I + V+ N++ENK+KTPDLGG ST
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 355 GEQVANDILSRI 366
            ++V  D+L+R+
Sbjct: 361 TQEVTEDVLARL 372

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/350 (75%), Positives = 309/350 (88%), Gaps = 1/350 (0%)

Query: 18  KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTV 77
           KS TIGLIPGDGIGKEVIP G+++LE +  K+G+ F +IDL AG+QTF +TGKALPD+T+
Sbjct: 22  KSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETI 81

Query: 78  EQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVI 137
           + L++ CQGALFGAVQSPTTKV+GYSSPIVALR+ +GLYAN+RPVKSV+GT D+P+D+VI
Sbjct: 82  KVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTKDKPIDMVI 141

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTEDLYIK E+TYIDK TG RVA+AIKRISE ATR IA IAL+IALQRL+ +G ATL
Sbjct: 142 VRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATL 201

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVDSMVYRLFKEPQCFDVIVA 256
           TVTHKSNVLSQSDGLFREICK VY+SNK K+  ++YNEQIVDSMVYRLF+EPQCFDVIVA
Sbjct: 202 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261

Query: 257 PNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRSAA 316
           PNLYGDILSDGAAALVGSLGVVPS NVGP+IVIGEPCHGSAPDI G+GIANPIATIRS A
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTA 321

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+LEFLG  +AA+ I K VD N+RE  I TPDLGG ++ +QV +D+LSR+
Sbjct: 322 LMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/349 (76%), Positives = 306/349 (87%), Gaps = 1/349 (0%)

Query: 19  SFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVE 78
           + TIGLIPGDGIGKEVIP GR+VLE IGPK+G+ F +IDLQAGWQTFLDTGKALP +TV+
Sbjct: 23  NLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVK 82

Query: 79  QLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIA 138
            LR NC GALFGAVQSPTTKV+GYSSPIVALRK LGLYANIRPVKSVD  G++ VD+VI 
Sbjct: 83  TLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVDMVIV 142

Query: 139 RENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLT 198
           RENTEDLYIK E+TYID++TG RVA+A KRISE ATR IA IAL+IALQRLK  G+  LT
Sbjct: 143 RENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLT 202

Query: 199 VTHKSNVLSQSDGLFREICKSVYQSNKK-FANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
           VTHKSNVLSQSDGLFRE+CK V++SNK  ++++QYNEQI+DSMVYRLF+EP+CFDVIVAP
Sbjct: 203 VTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAP 262

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRSAAL 317
           NLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHGSAPDI G+GI+NPIATIRS AL
Sbjct: 263 NLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTAL 322

Query: 318 LLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           +LEFLG  +AA+ I+  VD N+RE+KIKTPDLGG ++   V ND++ R+
Sbjct: 323 MLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/356 (74%), Positives = 303/356 (85%), Gaps = 1/356 (0%)

Query: 12  RTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKA 71
           R Y   KS  IGLIPGDGIGKEVIP G++VLE +G K+G+ F +IDL+AGW+ F   GKA
Sbjct: 13  RAYSAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKA 72

Query: 72  LPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR 131
           LPDDTV+ L+  CQGALFGAVQSPTTKV GYSSPIVALRK LGLYAN+RPVKSV+   DR
Sbjct: 73  LPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVEKGNDR 132

Query: 132 PVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKE 191
            VD++I RENTEDLYIK+E+TY+D+ TG RVAEAIKRISE ATR IA IAL+I+LQRLK 
Sbjct: 133 NVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKS 192

Query: 192 KGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVDSMVYRLFKEPQC 250
           +GHATLTVTHKSNVLSQSDGLFREICK VY+ NK K+  V+YNEQIVDSMVYR+F+EP+C
Sbjct: 193 RGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPEC 252

Query: 251 FDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIA 310
           FDV+VAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHGSAPDI G+GI+NPIA
Sbjct: 253 FDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIA 312

Query: 311 TIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           TIRS AL+LEFLG PE A+ I K VD N+ +  + TPDLGG +T +QV +DILS+I
Sbjct: 313 TIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI 368

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/371 (72%), Positives = 312/371 (84%), Gaps = 5/371 (1%)

Query: 1   MLRVGRGQLST----RTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYI 56
           MLR    +LST     T    KS TIGLIPGDGIGKEVIP G++VLE +  K+G+ F +I
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 57  DLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLY 116
           DL AG+QTF +TGKALPD+TV+ L+  CQGALFGAVQSPTTKV+GYSSPIVALR+ +GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 117 ANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRN 176
           AN+RPVKSV+G  D+P+D+VI RENTEDLYIK E+TYIDK TG RVA+A KRISE ATR 
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 177 IANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQ 235
           IA IA++IAL+RL+ +G ATLTVTHKSNVLSQSDGLFREICK VY+SNK K+  ++YNEQ
Sbjct: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 236 IVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHG 295
           IVDSMVYRLF+EPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 296 SAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTG 355
           SAPDI G+GIANPIATIRS AL+LEFLG   AA+ I K VD N+RE  IKTPDLGG ++ 
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360

Query: 356 EQVANDILSRI 366
           +QV  D+LSR+
Sbjct: 361 QQVVEDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/350 (75%), Positives = 305/350 (87%), Gaps = 1/350 (0%)

Query: 18  KSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTV 77
           KS TIGLIPGDGIGKEVIP G++VLE +  K+G+ F +IDL AG+QTF +TGKALPD+TV
Sbjct: 22  KSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKALPDETV 81

Query: 78  EQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVI 137
           + L+  CQGALFGAVQSPTTKV+GYSSPIVALR+ +GL+AN+RPVKSV+G   +P+D+VI
Sbjct: 82  KVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKGKPIDMVI 141

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTEDLYIK E+TYIDK TG RVA+A KRISE ATR IA IAL+IAL+RL+ +G ATL
Sbjct: 142 VRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGQATL 201

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVDSMVYRLFKEPQCFDVIVA 256
           TVTHKSNVLSQSDGLFREICK VY+SNK K+  ++YNEQIVDSMVYRLF+EPQCFDVIVA
Sbjct: 202 TVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFDVIVA 261

Query: 257 PNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRSAA 316
           PNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHGSAPDI G+GIANPIATIRS A
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTA 321

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+LEFLG  EAA+ I K VD N+RE  IKTPDLGG ++ +QV +D+LSR+
Sbjct: 322 LMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKASTQQVVDDVLSRL 371

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/369 (72%), Positives = 309/369 (83%), Gaps = 3/369 (0%)

Query: 1   MLRVGRGQLS--TRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDL 58
           MLR    Q S   R   + K+ TIGLIPGDGIGKEVIP G++VL+ +  K+G+ F++IDL
Sbjct: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60

Query: 59  QAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYAN 118
           QAG+QTFLDTG ALP DTV+ L+N CQGALFGAVQSPTTKV+GYSSPIV LRK LGL+AN
Sbjct: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120

Query: 119 IRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIA 178
           +RPVK+V+GT  +P+DLVI RENTEDLYIK E+TY D + G R+AEA KRI+E AT+ IA
Sbjct: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180

Query: 179 NIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK-FANVQYNEQIV 237
             AL+IALQRLK KG ATLTVTHKSNVLSQSDGLFRE+CK VY+SNK  ++ V YNEQIV
Sbjct: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240

Query: 238 DSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSA 297
           DSMVYRLF+EP+CFDVIVAPNLYGDILSDGAAALVGSLG+VPS NVGPNIVIGEPCHGSA
Sbjct: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300

Query: 298 PDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQ 357
           PDI G+GIANPIATIRS A +LE+LG    A+ I K VD NIR+NKIKT DLGG+ST +Q
Sbjct: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360

Query: 358 VANDILSRI 366
           V +DIL ++
Sbjct: 361 VIDDILGKL 369

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/355 (73%), Positives = 305/355 (85%), Gaps = 1/355 (0%)

Query: 13  TYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKAL 72
           T    KS TIGLIPGDGIGKEVIP G++VLE +  K+G+ F +IDL AG+QTF +TGKAL
Sbjct: 17  TNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFIDLYAGFQTFQETGKAL 76

Query: 73  PDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDRP 132
           PD+TV  L+  CQGALFGAVQSPTTKV+GYSSPIVALR+ +GL+AN+RPVKSV+G+ ++P
Sbjct: 77  PDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRNKP 136

Query: 133 VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEK 192
           +D+VI RENTEDLYIK E+TYIDK TG RVA+A KRISE ATR IA IAL+IAL+RL+ +
Sbjct: 137 IDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALKRLQTR 196

Query: 193 GHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVDSMVYRLFKEPQCF 251
           G ATLTVTHKSNVLSQ+DGLFREICK VY+SNK K+  ++YNEQIVDSMVYRLF+EPQCF
Sbjct: 197 GEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCF 256

Query: 252 DVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIAT 311
           DVIVAPNLYGDILSDGAAALVGSLGVVPS NVGP IVIGEPCHGSAPDI G+GIANPIAT
Sbjct: 257 DVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIAT 316

Query: 312 IRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           IRS AL+LEFLG   AA+ I K VD N+RE  I TPDLGG ++ +QV +D+LSR+
Sbjct: 317 IRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKASTQQVVDDVLSRL 371

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/361 (72%), Positives = 306/361 (84%), Gaps = 5/361 (1%)

Query: 8   QLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLD 67
            LST+    +KS TIGLIPGDGIGKEVIP G++VL+ +  ++G++F +IDL+AG+QTFLD
Sbjct: 14  HLSTKG--INKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLD 71

Query: 68  TGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG 127
           TGKALPD+TV+ L+  CQG LFGAVQSPTT+V  YSSPIVALRK L LYANIRPVKSV G
Sbjct: 72  TGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAG 131

Query: 128 TGD-RPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIAL 186
               +PVD+VI RENTEDLYIK E++Y D + G RVAEA KRI+E ATR IA IAL++AL
Sbjct: 132 AHSGKPVDMVIVRENTEDLYIKIEKSYKD-QNGMRVAEATKRITEVATRKIAKIALDVAL 190

Query: 187 QRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNK-KFANVQYNEQIVDSMVYRLF 245
           QRLK  G ATLTVTHKSNVLSQSDGLFREICK VYQ+NK K+A + YNEQI+DSMVYR+F
Sbjct: 191 QRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMF 250

Query: 246 KEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGI 305
           +EP+ FDVIVAPNLYGDILSDGAAALVGSLGVVPS NVGP+IV+GEPCHGSAPDI G+GI
Sbjct: 251 REPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCHGSAPDIAGKGI 310

Query: 306 ANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSR 365
           ANPIATIRS AL+LEFLG  EAA+ I K V+ N+RENKIKTPDLGGNS+ + V +D+L +
Sbjct: 311 ANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSSTQNVVDDVLEK 370

Query: 366 I 366
           +
Sbjct: 371 L 371

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/355 (71%), Positives = 301/355 (84%), Gaps = 2/355 (0%)

Query: 13  TYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKAL 72
           TY TSK+ TIGLIPGDGIGKEVIP G++VLE IG K+ + F Y  L AGWQTFL+TG AL
Sbjct: 14  TYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNAL 73

Query: 73  PDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDRP 132
           P  TVE LR  CQGALFGAVQSPTTKV+GYSSPIVALR+ LGLYANIRPVKSV GTG +P
Sbjct: 74  PGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG-QP 132

Query: 133 VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEK 192
           VDLVI RENTEDLY++ ERTY+D  TG RVAEAIKRISE AT  IA I+L +ALQR +  
Sbjct: 133 VDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMG 192

Query: 193 GHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK-FANVQYNEQIVDSMVYRLFKEPQCF 251
           G   LTVTHKSNVLSQ+DGLF+E+C+ VY++NKK + +++YNEQIVDSMVYRLFKEP CF
Sbjct: 193 GRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCF 252

Query: 252 DVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIAT 311
           DV+VAPNLYGD+LSDGAAALVGSLG+VPSVNVG NI+IGEPCHGSAPDI G+GIANPIAT
Sbjct: 253 DVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIAT 312

Query: 312 IRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           IRS +L+L+FLGL EAA  I++ V  N+++ ++ +PDLGG +T ++V +DIL+RI
Sbjct: 313 IRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  182 bits (462), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 123/366 (33%), Positives = 192/366 (52%), Gaps = 26/366 (7%)

Query: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFL 66
           G+ + +    +  +T+  I GDGIG E+    + +      K  V+++Y D+      F+
Sbjct: 25  GRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDIFS--AAKVPVEWEYCDVTP---IFI 79

Query: 67  DTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVD 126
           +    +PD  V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS++
Sbjct: 80  NGLTTIPDPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIE 136

Query: 127 G--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184
           G  T    VDLV+ RENTE  Y     + I+      V ++IK I+  A+  +   A E 
Sbjct: 137 GFKTTYENVDLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERVIRYAFEY 191

Query: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244
           A    +  G   + V HKS +   +DGLF  + + V    K++ +++   +++D+ V  +
Sbjct: 192 A----RAVGRPKVVVVHKSTIQRLADGLFVNVAQEV---GKEYPDIELQPELIDNTVLNV 244

Query: 245 FKEPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIV 301
             +P+ +   V V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI 
Sbjct: 245 VSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIA 304

Query: 302 GQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENI-RENKIKTPDLGGNSTGEQVAN 360
           GQ  ANP A + S+ ++L  +GL E A  IE  V   +  + K +T DL G +T      
Sbjct: 305 GQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTK 364

Query: 361 DILSRI 366
            ++ R+
Sbjct: 365 AVIERL 370

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  182 bits (461), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/350 (35%), Positives = 189/350 (54%), Gaps = 24/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           FT+ LIPGDG+GKE+    R + E       +D++ I+++   QT    G     + VE 
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFE--AENIPIDWETINIK---QTDHKEGVY---EAVES 80

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G L G   +P  +  G+ S  VALRK L +YAN+   KS+ G   R   +DL++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + ++ E+   V E++K ++   T  IA  A + A    K+    ++
Sbjct: 139 IRENTE-----GEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFA----KKYNRKSV 189

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
           T  HK+N++   DGLFR I   + Q  K++ ++  +  IVD+   +   +P  FDV+V P
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEIGQ--KEYPDIDVSSIIVDNASMQAVAKPHQFDVLVTP 247

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG IL +  AAL+G  G+V   N G +  + EP       DI GQ +ANP A I S+ 
Sbjct: 248 SMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSST 307

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+L  LGL E A  I K V E I E K  T D+GG+S+     N+I++++
Sbjct: 308 LMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 357

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  182 bits (461), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/350 (35%), Positives = 189/350 (54%), Gaps = 24/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           FT+ LIPGDG+GKE+    + + E    K  VD++ ++++   QT    G     + VE 
Sbjct: 29  FTVTLIPGDGVGKEITDSVKTIFE--AEKIPVDWETVNIK---QTDHKEGVY---EAVES 80

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G L G   +P  +  G+ S  VALRK L +YAN+   KS+ G   R   +DL++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + ++ E+   V E++K ++   T  IA  A + A    K+     +
Sbjct: 139 IRENTE-----GEFSGLEHESVPGVVESLKIMTRPKTERIARFAFDFA----KKYNRKAV 189

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
           T  HK+N++   DGLFR I   + Q  K++ ++  +  IVD+   +   +P  FDV+V P
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEIGQ--KEYPDIDVSSIIVDNASMQAVAKPHQFDVLVTP 247

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG IL +  AAL+G  G+V   N G +  + EP       DI GQ +ANP A I S+ 
Sbjct: 248 SMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSV 307

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+L  LGL E A  I K V E I E K  T D+GG+S+     N+I++++
Sbjct: 308 LMLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGSSSTTDFTNEIINKL 357

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  181 bits (459), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 130/365 (35%), Positives = 189/365 (51%), Gaps = 25/365 (6%)

Query: 5   GRGQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT 64
           GR QL  + Y     +T+ LIPGDGIGKEV     ++ E       VD++ ++L A  + 
Sbjct: 17  GREQLLPKKY--GGRYTVTLIPGDGIGKEVTDSVVQIFE--AENVPVDWESVELSALEEN 72

Query: 65  FLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKS 124
                KA     VE L+ N  G L G   +P  +  G+ S  VA RK L ++AN+   KS
Sbjct: 73  HEGVQKA-----VESLKRNKVG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKS 125

Query: 125 VDG--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIAL 182
             G  T  + VDLVI RENTE  Y     + ++ E+   V E++K +++  +  IA  A 
Sbjct: 126 FPGVKTKLQDVDLVIIRENTEGEY-----SGLEHESVPGVVESLKIMTKAKSERIARFAF 180

Query: 183 EIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVY 242
           + AL+  ++     +   HK+N++   DGLFR     +    K++  V  +  IVD+   
Sbjct: 181 DFALKNNRK----AVCAVHKANIMKLGDGLFRNTVSEI--GAKEYPEVNVSSIIVDNASM 234

Query: 243 RLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIV 301
           +   +P  FDV+V PNLYG IL +  AAL+G  G+VP  N G    + EP C     DI 
Sbjct: 235 QAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIK 294

Query: 302 GQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVAND 361
           GQ +ANP A I S+ L+L  LGL E A  I +   E I E K  T D+GG +T  +  N 
Sbjct: 295 GQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGKRTTKDIGGTATTTEFTNA 354

Query: 362 ILSRI 366
           ++ ++
Sbjct: 355 VIDKL 359

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  181 bits (459), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 190/350 (54%), Gaps = 24/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           FT+ LIPGDG+GKE+    R + E    +  VD++ I+++   QT    G     + VE 
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFE--AERIPVDWETINIK---QTDHKEGVY---EAVES 80

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G L G   +P  +  G+ S  VALRK L +YAN+   KS+ G   R   +DL++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + ++ E+   V E++K +++  T  IA  A + A    K+     +
Sbjct: 139 IRENTE-----GEFSGLEHESVPGVVESLKVMTKPKTERIARFAFDFA----KKYNRKAV 189

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
           T  HK+N++   DGLFR I   + Q+  ++ ++  +  IVD+   +   +P  FDV+V P
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEIGQT--EYPDIDVSSIIVDNASMQAVAKPHQFDVLVTP 247

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG IL +  AAL+G  G+V   N G +  + EP       DI GQ +ANP A I S+ 
Sbjct: 248 SMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSV 307

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+L  LGL E A  I K V E I E K  T D+GG+S+     N++++++
Sbjct: 308 LMLNHLGLNENATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEVINKL 357

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  181 bits (458), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 120/353 (33%), Positives = 193/353 (54%), Gaps = 26/353 (7%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+  I GDG+G E+    + +      K  ++++  D+      F++    +PD  V  
Sbjct: 36  YTVSFIEGDGVGPEISKSVKAIFS--AAKVPIEWESCDVSP---IFVNGLTTIPDPAVAS 90

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPVDLVI 137
           +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS++G  T    V+LV+
Sbjct: 91  INKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVL 147

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + I+      V ++IK I++ A+  +   A E A    + K    +
Sbjct: 148 IRENTE-----GEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVDRSK----V 198

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFD--VIV 255
            V HKS +   +DGLF ++ K +   + ++ +++   +++D+ V +  + P+ +D  V+V
Sbjct: 199 LVVHKSTIQRLADGLFVDVAKKL---SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255

Query: 256 APNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRS 314
            PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI GQ  ANP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 315 AALLLEFLGLPEAARHIEKVVDENIREN-KIKTPDLGGNSTGEQVANDILSRI 366
           + ++L  +GL E A  IEK V   I  + K +T DLGG+++     + ++ R+
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  179 bits (454), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 131/347 (37%), Positives = 180/347 (51%), Gaps = 36/347 (10%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT------FLDTGKALP 73
           +T+  I GDGIG E+    R V +         F+   +   W+T       +D    +P
Sbjct: 44  YTVSFIEGDGIGPEI---SRSVKDI--------FQAASVPITWETCDVSPILVDGLTTIP 92

Query: 74  DDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDR 131
           D+ V+ +  N  G L G + +P  K  G+ S  + LRK   L+AN+RP KSV G  T   
Sbjct: 93  DEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYD 149

Query: 132 PVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKE 191
            VDLV+ RENTE  Y   E       T G V ++IK I+  A+  +   A E A    K 
Sbjct: 150 NVDLVLIRENTEGEYSGIEHVV----TPG-VVQSIKLITRDASERVIRYAFEYA----KA 200

Query: 192 KGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCF 251
            G   + V HKS +   SDGLF  + K + Q  K F N++ + +++D+ V  +   P  +
Sbjct: 201 IGRPKVIVVHKSTIQRLSDGLFVNVAKEL-QKEKNFQNIELDTELIDNTVLNVVMNPSKY 259

Query: 252 D--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANP 308
              V V PNLYGDILSD  + L  GSLG+ PS N+G  I I E  HGSAPDI GQ  ANP
Sbjct: 260 SDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANP 319

Query: 309 IATIRSAALLLEFLGLPEAARHIEKVVDENI-RENKIKTPDLGGNST 354
            A + S+ ++L  +GL E    IE  V + I   +K +T DLGG +T
Sbjct: 320 TALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTAT 366

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  177 bits (448), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 185/350 (52%), Gaps = 24/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+ LIPGDGIGKEV     K+    G    +D++ ID+  G     +  KA     VE 
Sbjct: 29  YTVTLIPGDGIGKEVTDSVVKIFASQG--LPIDWERIDV-PGMSNENEVKKA-----VES 80

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G     +   +    GY S  VALRK L ++AN+   KS+ G   +   VDLV+
Sbjct: 81  LKRNKIG--LKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVV 138

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE  Y     + ++ E+   V E++K I++  T  IA  A + AL    E   +T+
Sbjct: 139 IRENTEGEY-----SGLEHESVPGVVESLKIITKPKTERIARFAFDFAL----ENNRSTV 189

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
           T  HK+N++  SDGLF+     V +  K++ +++ N  IVD+   +   +P  FDV+V P
Sbjct: 190 TAVHKANIMKLSDGLFKNTVAEVGE--KEYPDIKVNTIIVDNASMQAVAKPHQFDVMVTP 247

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG IL +  AAL+G  G++P  N G    + EP       DI  Q IANP A I SA 
Sbjct: 248 SMYGTILGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMILSAT 307

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+L  LGL E ++ I   V   I E K  T D+GGN++  +  + ++ ++
Sbjct: 308 LMLNQLGLREESKRISNAVYAVIEEGKTTTKDIGGNASTTEFTDAVIDKL 357

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/355 (34%), Positives = 188/355 (52%), Gaps = 30/355 (8%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+  I GDG+G E+    + +         V+++Y D+       L T   +P+  V  
Sbjct: 35  YTVSFIEGDGVGPEISQSVKDIFS--AASVPVEWEYCDVTPLLVNGLTT---IPEPAVAS 89

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPVDLVI 137
           +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS++G  T    VDLV+
Sbjct: 90  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVL 146

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE  Y     + I+      V ++IK I+  A+  +   A E A    +  G   +
Sbjct: 147 IRENTEGEY-----SGIEHVVSPGVVQSIKLITREASERVIRYAFEYA----RTVGRPKV 197

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVA- 256
            V HKS +   +DGLF  + + +    +++ +++   +++D+ V  +  +P+ +  +VA 
Sbjct: 198 VVVHKSTIQRLADGLFVNVAQEL---GREYPDIELQTELLDNTVLNVVTKPEAYKDVVAV 254

Query: 257 -PNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRS 314
            PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI GQ  ANP A + S
Sbjct: 255 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLS 314

Query: 315 AALLLEFLGLPEAARHIEKVVDENI---RENKIKTPDLGGNSTGEQVANDILSRI 366
           + ++L  +GL E A  IEK V   I   REN  +T DL G ++     N ++ R+
Sbjct: 315 SVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTNAVIERL 367

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  177 bits (448), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 126/366 (34%), Positives = 193/366 (52%), Gaps = 26/366 (7%)

Query: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFL 66
           G+ + +   ++  FT+  I GDGIG E+    +++ +    K  +D++  D+      F+
Sbjct: 24  GKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD--AAKVPIDWEPCDVSP---LFI 78

Query: 67  DTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVD 126
           +    +P+  V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS++
Sbjct: 79  NGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIE 135

Query: 127 G--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184
           G  T    VDLVI RENTE  Y   E       T G V ++IK I+  A+  +   A E 
Sbjct: 136 GFKTIYDNVDLVIIRENTEGEYSGIEHVV----TPG-VVQSIKLITRDASERVIRYAYEY 190

Query: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244
           A    +  G   + V HKS +   +DGLF ++ K + Q   ++ ++Q   +++D+ V  +
Sbjct: 191 A----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQ---EYPDIQLETELIDNTVLNV 243

Query: 245 FKEPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIV 301
              P  +   V V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI 
Sbjct: 244 VSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIA 303

Query: 302 GQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIREN-KIKTPDLGGNSTGEQVAN 360
           GQ  ANP A + S+ ++L  +GL   A  IEK V   I    + +T DL G +T     +
Sbjct: 304 GQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTD 363

Query: 361 DILSRI 366
            ++ R+
Sbjct: 364 AVIGRL 369

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  176 bits (447), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 123/372 (33%), Positives = 192/372 (51%), Gaps = 38/372 (10%)

Query: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT-- 64
           G+ + +   ++  FT+  I GDGIG E+    +++           F+  D+   W+T  
Sbjct: 23  GRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRI-----------FQAADVPVEWETCD 71

Query: 65  ----FLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIR 120
               F++    +PD  V+ +  N   AL G + +P  K  G+ S  + LRK   L+AN+R
Sbjct: 72  VTPIFVNGLTTIPDPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVR 128

Query: 121 PVKSVDG--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIA 178
           P KS++G  T    VDLV+ RENTE  Y     + I+      V ++IK I+  A+  + 
Sbjct: 129 PAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHLVSPGVVQSIKLITRDASERVI 183

Query: 179 NIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVD 238
             A E A    +  G   L V HKS +   +DGLF  + K +     ++ ++Q   +++D
Sbjct: 184 RYAYEYA----RAIGRPRLIVVHKSTIQRLADGLFVNVAKELAA---EYPDIQLETELID 236

Query: 239 SMVYRLFKEPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHG 295
           +    +   P  +   V V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HG
Sbjct: 237 NTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHG 296

Query: 296 SAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIR-ENKIKTPDLGGNST 354
           SAPDI GQ  ANP A + S+ ++L  +G+ E A  IEK V   I   ++ +T DLGG+++
Sbjct: 297 SAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSAS 356

Query: 355 GEQVANDILSRI 366
                + I+ ++
Sbjct: 357 TTSFTDAIIKKL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  176 bits (445), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 188/353 (53%), Gaps = 26/353 (7%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+  I GDG+G E+    + +      K  + ++  D+      F++    +P    + 
Sbjct: 36  YTVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWESCDVSP---LFINGLTTIPQPAQDS 90

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPVDLVI 137
           +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV G  T    VDLV+
Sbjct: 91  INKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVL 147

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE  Y     + I+      V ++IK I++ A+  +   A E A    + K    +
Sbjct: 148 IRENTEGEY-----SGIEHVVSPGVVQSIKLITQDASERVIRYAFEYARAVERPK----V 198

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFD--VIV 255
            V HKS +   +DGLF  + +   Q +K++ +++   +++D+ V    ++P  +   V+V
Sbjct: 199 VVVHKSTIQRLADGLFVSVAE---QLSKEYPDIELQTELIDNTVLHTVRDPTKYSDVVVV 255

Query: 256 APNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRS 314
            PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI GQ  ANP A + S
Sbjct: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 315 AALLLEFLGLPEAARHIEKVVDENIREN-KIKTPDLGGNSTGEQVANDILSRI 366
           + ++L  +GL E A  IEK V   I    + +T DLGG+++    A  ++SR+
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  174 bits (441), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 120/353 (33%), Positives = 187/353 (52%), Gaps = 26/353 (7%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           FT+  I GDG+G E+    + + +    +  VD++Y D+       L T   +P+  V+Q
Sbjct: 41  FTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQ 95

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPVDLVI 137
           + N  + AL G + +P  K  G+ S  + LRK  GL+AN+RP +S+ G  T  + VDLV+
Sbjct: 96  I-NKHKIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE  Y     + I+      V ++IK I+  A+  +   A E A    +  G   L
Sbjct: 153 IRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 203

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFD--VIV 255
            V HKS +   +DGLF  I K +     +F +++   +++D+ V  + ++P  +   V V
Sbjct: 204 VVVHKSTIQKLADGLFVNIAKELA---PEFPDIKLETELIDNTVLNVVRDPPSYTDAVTV 260

Query: 256 APNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRS 314
            PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI GQ  ANP A + S
Sbjct: 261 CPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLS 320

Query: 315 AALLLEFLGLPEAARHIEKVVDENIRE-NKIKTPDLGGNSTGEQVANDILSRI 366
           + ++L ++GL   +  IE  +   I   ++ +T DL G +T       ++  +
Sbjct: 321 SCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  175 bits (444), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 193/366 (52%), Gaps = 26/366 (7%)

Query: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFL 66
           G+ + +   ++  +T+  I GDGIG E+    +++      K  ++++  D+      F+
Sbjct: 77  GKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS--AAKVPIEWETCDVTP---LFI 131

Query: 67  DTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVD 126
           D    +P+  V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP +SV 
Sbjct: 132 DGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVK 188

Query: 127 G--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184
           G  T    VDLV+ RENTE      E + I+      V ++IK I+  A+  +   A E 
Sbjct: 189 GFKTTYPNVDLVLIRENTE-----GEYSGIEHVVTPGVVQSIKLITREASERVIRYAFEY 243

Query: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244
                +  G   L V HKS +   SDGLF  + K +   +K++ ++Q+  +++D+ V ++
Sbjct: 244 C----RAIGRPRLVVVHKSTIQRLSDGLFVNVAKEL---SKEYPDIQFETELIDNTVLKV 296

Query: 245 FKEPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIV 301
              P  +   V V PNLYGDILSD  + L  GSLG+ PS N+G  I I E  HGSAPDI 
Sbjct: 297 VSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAPDIA 356

Query: 302 GQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIREN-KIKTPDLGGNSTGEQVAN 360
           G+ +ANP A + S+ ++L  +GL + A  IE  V   I    + +T DL G +T     +
Sbjct: 357 GKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTD 416

Query: 361 DILSRI 366
            ++ ++
Sbjct: 417 AVIKKL 422

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  173 bits (438), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 127/374 (33%), Positives = 193/374 (51%), Gaps = 42/374 (11%)

Query: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT-- 64
           G+ + +   ++  +T+  I GDGIG E+     K ++KI       F   ++   W++  
Sbjct: 24  GRFTGKPNPSTGRYTVSFIEGDGIGPEI----SKSVKKI-------FNAANVPIEWESCD 72

Query: 65  ----FLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIR 120
               F++    +PD  V+ + NN   AL G + +P  K  G+ S  + LRK  GL+AN+R
Sbjct: 73  VNPIFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVR 129

Query: 121 PVKSVDG--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIA 178
           P KSV+G  T    VDLV+ RENTE  Y     + I+      V ++IK I+  A+  + 
Sbjct: 130 PAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVI 184

Query: 179 NIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVD 238
             A E A    +  G   + V HKS +   +DGLF  + K +   +K++ ++    +++D
Sbjct: 185 RYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL---SKEYPDIILETELID 237

Query: 239 SMVYRLFKEPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHG 295
           + V ++   P  +   V V PNLYGDILSD  + L  GSLG+ PS N+G  I I E  HG
Sbjct: 238 NSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHG 297

Query: 296 SAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIR---ENKIKTPDLGGN 352
           SAPDI GQ  ANP A + S+ ++L  +GL   A  I+  V   I    EN  +T DL G 
Sbjct: 298 SAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGT 355

Query: 353 STGEQVANDILSRI 366
           +T       ++ R+
Sbjct: 356 ATTSSFTEAVIKRL 369

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  172 bits (437), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 118/350 (33%), Positives = 182/350 (52%), Gaps = 25/350 (7%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+ L+PGDG+G+E+      + E       +D++ ++L    Q  + T        VE 
Sbjct: 29  YTVTLLPGDGVGREITDSVVSIFE--AENLPIDWERVELSGLEQEDVHTA-------VES 79

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G     +   +    G++S  VALRK L +YAN+   KS  G   R   VDLVI
Sbjct: 80  LKRNKIG--LKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLVI 137

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + ++ E+   V E++K ++   T  IA  A + A++  ++    ++
Sbjct: 138 IRENTE-----GEYSGLEHESVPGVVESLKIMTAQKTERIARFAFDYAMKYNRK----SV 188

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
           T  HK+N++   DGLFR +   +    K++  V  +  IVD+   +   +P  FDV+VAP
Sbjct: 189 TAVHKANIMKLGDGLFRNLVTEI--GAKEYPEVGVSSIIVDNASMQAVAKPHQFDVMVAP 246

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG IL +  AAL+G  G+VP  N G +  + EP       DI  Q IANP A I SA 
Sbjct: 247 SMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILSAT 306

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+L  LG    A  I K V E I E K  T D+GG++T  +  N +++++
Sbjct: 307 LMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGSATTTEFTNAVIAKL 356

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  172 bits (437), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 193/374 (51%), Gaps = 42/374 (11%)

Query: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT-- 64
           G+ + +   ++  +T+  I GDG+G E+     K ++ I       F   ++   W++  
Sbjct: 24  GRFTGKPNPSTGKYTVSFIEGDGVGPEI----SKSVKDI-------FAAAEVPVEWESCD 72

Query: 65  ----FLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIR 120
               F++    +P   V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+R
Sbjct: 73  VTPLFINGLTTIPQPAVDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVR 129

Query: 121 PVKSVDG--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIA 178
           P KSV+G  T    VDLV+ RENTE  Y     + I+      V ++IK I+  A+  + 
Sbjct: 130 PAKSVEGFKTTYENVDLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERVI 184

Query: 179 NIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVD 238
             A E A    +  G   + V HKS +   +DGLF ++ K +   + ++ ++Q   Q++D
Sbjct: 185 RYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL---SSEYPDIQLQLQLLD 237

Query: 239 SMVYRLFKEPQCF--DVIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHG 295
           + V  +   P  +   V V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HG
Sbjct: 238 NTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHG 297

Query: 296 SAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIR---ENKIKTPDLGGN 352
           SAPDI GQ  ANP A + S+ ++L  +GL E A  IEK V   I    EN  +T DL G+
Sbjct: 298 SAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPEN--RTADLAGS 355

Query: 353 STGEQVANDILSRI 366
           ++       ++ R+
Sbjct: 356 ASTSSFTEAVIKRL 369

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  172 bits (436), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 191/350 (54%), Gaps = 24/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           FT+ L+PGDG+GKE+      + +       +D++ +D+       LD  + +    V+ 
Sbjct: 28  FTVTLLPGDGVGKEITDSVVSIFKS--ENVPIDWETVDISG-----LDHTEGV-KAAVDS 79

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G L G   +P  +V G+ S  VA RK L +YAN+   KS++G   +   VDLV+
Sbjct: 80  LKRNKIG-LKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE  Y     + ++ E+   V E++K I++  +  IA  A + A    K     ++
Sbjct: 138 IRENTEGEY-----SGLEHESVPGVVESLKIITKSKSERIARFAFDFA----KRNNRKSV 188

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
           T  HK+N++  SDGLFR     + +  +++  +Q +  IVD+   +   +P  FDV+V P
Sbjct: 189 TAVHKANIMKLSDGLFRNTVSKIGE--EEYPEIQTSSIIVDNASMQAVAKPHQFDVMVTP 246

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG I+ +  AAL+G  G+VP VN G +  + EP       DI GQ +ANP A + SA 
Sbjct: 247 SMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSAT 306

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           LLL+ LGL ++A  I+  V + I E K  T D+GG+++  +    +++++
Sbjct: 307 LLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  172 bits (437), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 191/366 (52%), Gaps = 26/366 (7%)

Query: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFL 66
           G+ + +    +  F +  I GDGIG E+    + + +    +  +++++ D+      F+
Sbjct: 28  GRFTGKPNPATGKFDVSFIEGDGIGPEISQSVKDIFK--AAEVPINWEFCDVT---PIFV 82

Query: 67  DTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVD 126
           +    +PD  V  +  N   AL G + +P  K  G+ S  + LRK   L+AN+RP KS++
Sbjct: 83  NGLTTIPDPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIE 139

Query: 127 G--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184
           G  T    VDLV+ RENTE  Y     + I+      V ++IK I+  A+  +   A E 
Sbjct: 140 GFKTTYSDVDLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAFEY 194

Query: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244
           A    K  G   + V HKS +   +DGLF  + K +   +K++  ++   +++D+ V  +
Sbjct: 195 A----KAIGRPRVVVVHKSTIQRLADGLFVNVAKEL---SKEYPEIKLETELIDNTVLNV 247

Query: 245 FKEPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIV 301
              P  +   V V PNLYGDILSD  + L  GSLG+ PS N+G  I I E  HGSAPDI 
Sbjct: 248 VSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIA 307

Query: 302 GQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENI-RENKIKTPDLGGNSTGEQVAN 360
           GQ  ANP A + S+ ++L  +GL + A  IE+ V   I   +K +T DLGG++T     +
Sbjct: 308 GQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSATTSSFTD 367

Query: 361 DILSRI 366
            ++  +
Sbjct: 368 AVIKNL 373

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 123/368 (33%), Positives = 191/368 (51%), Gaps = 30/368 (8%)

Query: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFL 66
           G+ + +   ++  +T+  I GDGIG E+    +K+         +++++ D+      F+
Sbjct: 24  GKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS--AANVPIEWEFCDVNP---IFV 78

Query: 67  DTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVD 126
           +    +PD  V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV+
Sbjct: 79  NGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVE 135

Query: 127 G--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184
           G  T    VDLV+ RENTE      E + I+      V ++IK I+  A+  +   A E 
Sbjct: 136 GFKTTYENVDLVLIRENTE-----GEYSGIEHIVCPGVVQSIKLITRDASERVIRYAFEY 190

Query: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244
           A    +  G   + V HKS +   +DGLF  + K +   +K++ ++    +++D+ V ++
Sbjct: 191 A----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL---SKEYPDITLETELIDNSVLKV 243

Query: 245 FKEPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIV 301
              P  +   V V PNLYGDILSD  + L  GSLG+ PS N+G  I I E  HGSAPDI 
Sbjct: 244 VTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIA 303

Query: 302 GQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIR---ENKIKTPDLGGNSTGEQV 358
           GQ  ANP A + S+ ++L  +GL   A  I+  V   I    EN  +T DL G +T    
Sbjct: 304 GQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPEN--RTGDLAGAATTSSF 361

Query: 359 ANDILSRI 366
              ++ R+
Sbjct: 362 TEAVIKRL 369

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 187/366 (51%), Gaps = 25/366 (6%)

Query: 4   VGRGQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQ 63
           +  GQL  + Y     +T+ LIPGDG+GKEV      + E       +D++ ++L    +
Sbjct: 16  LASGQLLPKKY--GGRYTVTLIPGDGVGKEVTDSVVNIFE--AENVPIDWESVELSGLEE 71

Query: 64  TFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVK 123
                 KA     VE L+ N  G L G   +P  +  G+ S  VA RK L ++AN+   K
Sbjct: 72  NMEGVQKA-----VESLKRNKVG-LKGIWSTPADQT-GHGSLNVAFRKQLDIFANVALFK 124

Query: 124 SVDG--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIA 181
           S  G  T  + VDLVI RENTE  Y     + ++ E+   V E++K +++  +  IA  A
Sbjct: 125 SFPGVKTKLKDVDLVIIRENTEGEY-----SGLEHESVPGVVESLKIMTKAKSERIARFA 179

Query: 182 LEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMV 241
            + AL+  +     ++   HK+N++   DGLFR     +    K++  ++    IVD+  
Sbjct: 180 FDFALKNNRR----SVCAVHKANIMKLGDGLFRNTVNEI--GAKEYPELEVKSIIVDNAS 233

Query: 242 YRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDI 300
            +   +P  FDV+V PNLYG IL +  AAL+GS G+VP  N G    + EP       DI
Sbjct: 234 MQAVAKPHQFDVLVTPNLYGSILGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDI 293

Query: 301 VGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVAN 360
            GQ +ANP A I S+ L+L  LGL + A  I K   E I E K  T D+GG+++  Q   
Sbjct: 294 KGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEGKHTTKDIGGHASTTQFTK 353

Query: 361 DILSRI 366
            I+ ++
Sbjct: 354 AIVDKL 359

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  171 bits (434), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 123/361 (34%), Positives = 185/361 (51%), Gaps = 42/361 (11%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQ------TFLDTGKALP 73
           +T+  I GDGIG E+     K ++KI       F   D+   W+       F++    +P
Sbjct: 37  YTVSFIEGDGIGPEI----SKSVKKI-------FSAADVPINWEFCDVNPIFVNGLTTIP 85

Query: 74  DDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDR 131
           D  V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS++G  T   
Sbjct: 86  DPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYE 142

Query: 132 PVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKE 191
            VDLV+ RENTE  Y     + I+      V ++IK I+  A+  +   A E A    + 
Sbjct: 143 NVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITREASERVIRYAFEYA----RA 193

Query: 192 KGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCF 251
            G   + V HKS +   +DGLF  + K +   +K++ ++ +  +++D+ V  +   P  +
Sbjct: 194 IGRPRIIVVHKSTIQRLADGLFVNVAKEL---SKEYPDITFETELIDNKVLNVVTNPSAY 250

Query: 252 D--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANP 308
              V V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI G+  ANP
Sbjct: 251 TNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGKDKANP 310

Query: 309 IATIRSAALLLEFLGLPEAARHIEKVVDENIR---ENKIKTPDLGGNSTGEQVANDILSR 365
            A + S+ ++L  +GL   A  I+  V   I    EN  +T DL G +T       ++ R
Sbjct: 311 TALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPEN--RTGDLAGTATTSSFTEAVIKR 368

Query: 366 I 366
           +
Sbjct: 369 L 369

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  170 bits (431), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 120/355 (33%), Positives = 187/355 (52%), Gaps = 30/355 (8%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+  I GDG+G E+    + +      K  + ++  D+      F++    +P    + 
Sbjct: 36  YTVSFIEGDGVGPEISKAVKDIFA--AAKAPIQWETCDVTP---LFINGLTTIPQPAQDS 90

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPVDLVI 137
           +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+ G  T    VDLV+
Sbjct: 91  INKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVL 147

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + I+      V ++IK I++ A+  +   A E A    + K    +
Sbjct: 148 IRENTE-----GEYSGIEHVVAPGVVQSIKLITQDASERVIRYAFEYARAVERPK----V 198

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFD--VIV 255
            V HKS +   +DGLF  + + +    K++ +++   +++D+ V    ++P  +   V+V
Sbjct: 199 LVVHKSTIQRLADGLFVSVAEKL---AKEYPDIELQTELIDNTVLHTVRDPLKYSDVVVV 255

Query: 256 APNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRS 314
            PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI GQ  ANP A + S
Sbjct: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 315 AALLLEFLGLPEAARHIEKVVDENIR---ENKIKTPDLGGNSTGEQVANDILSRI 366
           + ++L  +GL E A  IEK V   I    EN  +T DL G+++    A  ++SR+
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVFSTIASGPEN--RTGDLAGSASTSSFAEAVISRL 368

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  170 bits (431), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 123/359 (34%), Positives = 182/359 (50%), Gaps = 38/359 (10%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT------FLDTGKALP 73
           +T+  I GDG+G E+     K ++ I       F    +   W++       ++    +P
Sbjct: 39  YTVSFIEGDGVGPEI----SKSVKDI-------FAAAKVPIVWESCPVTPLLVNGVTTIP 87

Query: 74  DDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDR 131
           +   E +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV+G  T   
Sbjct: 88  EQAQESINRNLV-ALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYE 144

Query: 132 PVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKE 191
            VDLV+ RENTE  Y   E   +       V ++IK I+  A+  +   A E A    + 
Sbjct: 145 DVDLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERVIRYAYEYA----RA 195

Query: 192 KGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCF 251
            G   L V HKS +   +DGLF  + K +     +F ++Q   +++D+ V  +   P  +
Sbjct: 196 VGRPKLVVVHKSTIQRLADGLFVTVAKELAH---EFPDIQLQTELIDNTVLNVVSNPSKY 252

Query: 252 D--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANP 308
              V V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI GQ  ANP
Sbjct: 253 SDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANP 312

Query: 309 IATIRSAALLLEFLGLPEAARHIEKVVDENIREN-KIKTPDLGGNSTGEQVANDILSRI 366
            A + S+ ++L  +GL E A  IEK V   I    + +T DL G+++       ++SR+
Sbjct: 313 TALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  170 bits (430), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 125/374 (33%), Positives = 192/374 (51%), Gaps = 42/374 (11%)

Query: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQT-- 64
           G+ + +   ++  +T+  I GDGIG E+     K ++KI       F   ++   W++  
Sbjct: 24  GRYTGKPNPSTGKYTVSFIEGDGIGPEI----SKSVKKI-------FSAANVPIEWESCD 72

Query: 65  ----FLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIR 120
               F++    +PD  V+ +  N   AL G + +P  K  G+ S  + LRK  GL+AN+R
Sbjct: 73  VSPIFVNGLTTIPDPAVQSITKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVR 129

Query: 121 PVKSVDG--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIA 178
           P KS++G  T    VDLV+ RENTE  Y     + I+      V ++IK I+  A+  + 
Sbjct: 130 PAKSIEGFKTTYENVDLVLIRENTEGEY-----SGIEHIVCPGVVQSIKLITRDASERVI 184

Query: 179 NIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVD 238
             A E A    +  G   + V HKS +   +DGLF  + K +   +K++ ++    +++D
Sbjct: 185 RYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKEL---SKEYPDLTLETELID 237

Query: 239 SMVYRLFKEPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHG 295
           + V ++   P  +   V V PNLYGDILSD  + L  GSLG+ PS N+G  I I E  HG
Sbjct: 238 NSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHG 297

Query: 296 SAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIR---ENKIKTPDLGGN 352
           SAPDI GQ  ANP A + S+ ++L  +GL   A  I+  V   I    EN  +T DL G 
Sbjct: 298 SAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPEN--RTGDLAGT 355

Query: 353 STGEQVANDILSRI 366
           +T       ++ R+
Sbjct: 356 ATTSSFTEAVIKRL 369

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  168 bits (426), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 186/350 (53%), Gaps = 24/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+ LIPGDG+GKEV      +         +D++ +D+       LD  + + +  V  
Sbjct: 34  YTVTLIPGDGVGKEVTDSVVSIFN--AENLPIDWERVDISG-----LDHEEGV-EAAVNS 85

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G     +   +     + S  VALRK L +YAN+   K++ G   R   VDLVI
Sbjct: 86  LKRNKIG--LKGIWHTSAGQSDHGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLVI 143

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + ++ E+   V E++K I++  +  IA  A + A +R   K    +
Sbjct: 144 IRENTE-----GEYSGLEHESVPGVVESLKIITKEKSERIARFAFDFA-KRFDRK---LV 194

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
           T  HK+N++   DGLFR    S+ ++  ++ +++ +  IVD+   +   +P  FDV+V P
Sbjct: 195 TAVHKANIMKLGDGLFRNSVTSIGET--EYPDIKVSSIIVDNASMQSVAKPHQFDVLVTP 252

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG IL +  AAL+G  G+VP  N G    + EP       DI GQ +ANP A I S+ 
Sbjct: 253 SMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILSST 312

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           LLL+ LGL   A+ IE  V + I E K+ T D+GG+++  +  N+I+ ++
Sbjct: 313 LLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  167 bits (422), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/380 (32%), Positives = 194/380 (51%), Gaps = 36/380 (9%)

Query: 1   MLRVGRGQLSTRTYVTSKS-----------FTIGLIPGDGIGKEVIPVGRKVLEKIGPKY 49
           MLR G G +S R+  T  +           +T+ LIPGDG+GKEV      + E      
Sbjct: 1   MLRSGLG-VSKRSLATMAAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFES--ENI 57

Query: 50  GVDFKYIDLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVAL 109
            +D++ +++       LD  + +    VE L+ N  G L G   +P+ +  G+ S  VAL
Sbjct: 58  PIDWETVEISG-----LDNQEGV-QKAVESLKRNKVG-LKGIWHTPSDQT-GHGSLNVAL 109

Query: 110 RKALGLYANIRPVKSVDGTGDRP--VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIK 167
           RK L ++AN+   KSV G   R   VD+V+ RENTE  Y     + ++ E+   V E++K
Sbjct: 110 RKQLDIFANVALFKSVPGVPSRHSNVDMVVIRENTEGEY-----SGLEHESVPGVVESLK 164

Query: 168 RISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKF 227
            +++  +  I   A + A++  ++    ++   HK+N++   DGLFR     V    K++
Sbjct: 165 IMTKAKSERIGRFAFDFAVKNNRK----SVCAVHKANIMKLGDGLFRNCINEV--GAKEY 218

Query: 228 ANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNI 287
             +     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP  N G   
Sbjct: 219 PEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREY 278

Query: 288 VIGEP-CHGSAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKT 346
            + EP       DI GQ +ANP A I S++L+L  LGL   A  I K   + I E K  T
Sbjct: 279 AVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHLGLNAYADRISKATYDVIAEAKTTT 338

Query: 347 PDLGGNSTGEQVANDILSRI 366
            D+GG+++  +    I+S++
Sbjct: 339 QDIGGSASTTEFTEAIISKL 358

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  166 bits (421), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 183/350 (52%), Gaps = 24/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+ LIPGDG+GKEV     K+ E       +D++ ID+ +G +   +  +A     VE 
Sbjct: 30  YTVTLIPGDGVGKEVTDSVVKIFEN--ENIPIDWETIDI-SGLENTENVQRA-----VES 81

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G L G   +P  +  G+ S  VALRK L ++AN+   KS+ G   R   +D+VI
Sbjct: 82  LKRNKVG-LKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVI 139

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE  Y     + ++ E+   V E++K ++   +  IA  A + AL+  ++    ++
Sbjct: 140 IRENTEGEY-----SGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRK----SV 190

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
              HK+N++   DGLFR     +     ++  +     IVD+   +   +P  FDV+V P
Sbjct: 191 CAVHKANIMKLGDGLFRNTVNEI--GANEYPELDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           NLYG IL +  +AL+G  G+VP  N G    + EP       DI GQ +ANP A I S+ 
Sbjct: 249 NLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSST 308

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+L  LGL   A  I K   + I E K  T D+GG+++  +  N ++ ++
Sbjct: 309 LMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  166 bits (419), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 187/350 (53%), Gaps = 25/350 (7%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
            T+ L+PGDG+GKE+      + +       +D++ +D+       LD    + +  VE 
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQ--AENVPIDWETVDISQ-----LDHEDGV-NAAVES 80

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G L G   +   +V G+ S  VA RK L +YAN+   KS+ G   +   VDLVI
Sbjct: 81  LKRNKIG-LKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLVI 138

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + ++ E+   V E++K +++  +  IA  A + A++  ++     +
Sbjct: 139 IRENTE-----GEYSGLEHESVPGVVESLKIVTKVNSERIAKFAFDFAMRHDRK----MV 189

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
           T  HK+N++  SDGLFR    +V +  + +  ++ +  IVD+   +   +P  FDV+V P
Sbjct: 190 TAVHKANIMKLSDGLFRN---TVARVGEAYPQIKNDSIIVDNASMQAVAKPHQFDVMVTP 246

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG IL +  AAL+G  G+VP VN G    + EP       DI GQ +ANP A I S+ 
Sbjct: 247 SMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSST 306

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           LLL+ LGL + A  I K V + I+E    T D+GGN++  +    ++ ++
Sbjct: 307 LLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  166 bits (419), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 119/353 (33%), Positives = 184/353 (52%), Gaps = 26/353 (7%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           FT+  I GDG+G E+     + ++KI     V  +++    G   F++    +P+  VE 
Sbjct: 36  FTVPFIEGDGVGPEI----SESVKKIFSAAKVPIEWVPCDVG-PIFVNGQTTIPEPAVE- 89

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPVDLVI 137
           L N    AL G + +P  K  G+ S  + LRK   L+AN+RP +S+    +    VDLV+
Sbjct: 90  LINKHLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYENVDLVL 147

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE  Y   E       T G V ++IK I+  AT  +   A E      +  G   L
Sbjct: 148 IRENTEGEYSGIEHVI----TPG-VIQSIKLITREATERVVRYAFEYT----QAIGRPRL 198

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFD--VIV 255
            V HKS +   +DGLF ++ + +     ++ +++   +I+D  +  +  +P+ +   V V
Sbjct: 199 LVIHKSTIQRMADGLFVKVAEELAS---EYPDIKLETEIIDKSILNVVSKPELYSDAVSV 255

Query: 256 APNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRS 314
            PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI GQ  ANP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 315 AALLLEFLGLPEAARHIEKVVDENIRE-NKIKTPDLGGNSTGEQVANDILSRI 366
           + ++L+ +GL E A  IE  V   I   ++ +T DL G ++      +++ R+
Sbjct: 316 SVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  164 bits (416), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 118/350 (33%), Positives = 180/350 (51%), Gaps = 23/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           F + LIPGDG+GKEV      + E       +D+  +D+       LD  + +    V+ 
Sbjct: 29  FVVTLIPGDGVGKEVTDSVVSIFE--AENLPIDWDRVDISG-----LDHEEGV-QAAVDS 80

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G L G   +      G  S  VALRK L +YAN+   KSV G   +   VDLV+
Sbjct: 81  LKRNKIG-LKGIWHTSAADQAGKGSLNVALRKELDIYANVALFKSVPGVKTKIPNVDLVV 139

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + ++ E+   V E++K ++E  T  IA  A + A    K+     +
Sbjct: 140 IRENTE-----GEYSGLEHESVPGVVESLKIMTEDKTERIARFAFDFA----KKYNRHAV 190

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
           T  HK+N++   DGLFR +   V +  +++ +V+    IVD+   +   +P  FDV+V P
Sbjct: 191 TAVHKANIMKLGDGLFRNVVTRVGE--QEYPDVKVGSIIVDNASMQTVAKPHQFDVLVTP 248

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG IL +  AAL+G  G+V   N G    + EP       DI  + IANP A I SA+
Sbjct: 249 SMYGTILGNIGAALIGGPGLVAGANYGREYAVFEPGSRHVGLDIKDKNIANPTAMILSAS 308

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+L+ LGL  +A  I   V + I E K  TPD+GG+++  +    ++ ++
Sbjct: 309 LMLDHLGLSTSATKISNAVHQVIAEGKSTTPDIGGSASTTEFTQAVIEKL 358

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  165 bits (417), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 117/342 (34%), Positives = 180/342 (52%), Gaps = 27/342 (7%)

Query: 19  SFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVE 78
           ++T+  I GDG+G E+    R + +    K  +D+   D+       ++    +P   V+
Sbjct: 44  NYTVPFIEGDGVGPEISKSVRTIFK--AAKVPIDWVNCDIGP---LLINGETTIPQTAVD 98

Query: 79  QLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGD--RPVDLV 136
           Q+ NN   AL G + +P    QG+ S  + LRK  GL+AN+RP KS+         VDL+
Sbjct: 99  QI-NNSLIALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLI 155

Query: 137 IARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHAT 196
           + RENTE      E + I+ E    V ++IK I+  A+  +    ++ A +  +  G + 
Sbjct: 156 VIRENTE-----GEYSGIEHEIVPGVVQSIKLITRKASEKV----IKYAFEYTRSIGRSN 206

Query: 197 LTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCF--DVI 254
           L V HK+ +  + DGLF +  + +     K+ +V    +++D+ V      P+ +   V 
Sbjct: 207 LIVVHKATIQRRGDGLFVQTAQEMAD---KYPDVNLKLELIDNTVLNCIMNPEKYADSVS 263

Query: 255 VAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIATIR 313
           V PNLYGDILSD  + L  GSLG+ PS N+G   V+ E  HGSAPDI GQ  ANP A + 
Sbjct: 264 VCPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTALLL 322

Query: 314 SAALLLEFLGLPEAARHIEKVVDENIRENK-IKTPDLGGNST 354
           S+ ++L  +GL + A  IE  V   I   K  +T DLGG++T
Sbjct: 323 SSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSAT 364

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 124/379 (32%), Positives = 192/379 (50%), Gaps = 35/379 (9%)

Query: 1   MLRVGRGQLSTRTYVTSKS----------FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYG 50
           MLR G G +S R+  T             +T+ LIPGDG+GKEV      + E       
Sbjct: 1   MLRNGFG-ISKRSLATVAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFES--ENVP 57

Query: 51  VDFKYIDLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALR 110
           +D++ +++       LD  + +    V+ L+ N  G L G   +P+ +  G+ S  VALR
Sbjct: 58  IDWETVEISG-----LDNEEGV-QKAVDSLKRNKVG-LKGIWHTPSDQT-GHGSLNVALR 109

Query: 111 KALGLYANIRPVKSVDGTGDRP--VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKR 168
           K L ++AN+   K+V G   R   VDLV+ RENTE  Y     + ++ E+   V E++K 
Sbjct: 110 KQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEY-----SGLEHESVPGVVESLKI 164

Query: 169 ISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFA 228
           +++  +  I   A + AL+  ++    ++   HK+N++   DGLFR     +    K++ 
Sbjct: 165 MTKAKSDRIGRFAFDFALKNNRK----SVCAVHKANIMKLGDGLFRNCINEI--GAKEYP 218

Query: 229 NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIV 288
            ++    IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  G+VP  N G    
Sbjct: 219 EIEVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREFA 278

Query: 289 IGEP-CHGSAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTP 347
           + EP       DI GQ +ANP A I S+AL+L  LGL   A  I K   + I E K  T 
Sbjct: 279 VFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAEAKNTTK 338

Query: 348 DLGGNSTGEQVANDILSRI 366
           D+GG+++       I+ ++
Sbjct: 339 DIGGSASTTDFTQAIIEKL 357

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  163 bits (412), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 120/366 (32%), Positives = 191/366 (52%), Gaps = 26/366 (7%)

Query: 7   GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFL 66
           G+ + +    + ++ +  I GDGIG E+    + +      K  VDF+ + ++      +
Sbjct: 23  GKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFA--AAKVPVDFESVVVKP---ILV 77

Query: 67  DTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVD 126
           +   ++P++  + +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KSV+
Sbjct: 78  NGVTSIPEEAQKSINTNLV-ALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVE 134

Query: 127 G--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184
           G  T    V+LV+ RENTE  Y   E   +       V ++IK I+  A+  +   A E 
Sbjct: 135 GFKTIYDNVNLVLIRENTEGEYAGIEHAIVPG-----VVQSIKLITREASERVIRFAYEY 189

Query: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244
           A  R  E+    L V HKS +   SDGLF ++ K +     +F +++   +++D+ V   
Sbjct: 190 A--RAAER--PRLIVVHKSTIQRLSDGLFVDVAKEL---QSEFPDIKLETELIDNAVLNT 242

Query: 245 FKEPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIV 301
             +P  +   V V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI 
Sbjct: 243 VTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIA 302

Query: 302 GQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIREN-KIKTPDLGGNSTGEQVAN 360
           G+  ANP A + S+ ++L  +GL E A  IEK V   I    + +T DL G+++      
Sbjct: 303 GKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTE 362

Query: 361 DILSRI 366
            ++ ++
Sbjct: 363 AVIKKL 368

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  162 bits (411), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 120/357 (33%), Positives = 183/357 (51%), Gaps = 26/357 (7%)

Query: 16  TSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDD 75
           +S ++T+  I GDG+G E+     K ++ I     V  ++     G   F++    +P+ 
Sbjct: 40  SSGTYTVPFIEGDGVGPEI----SKSVKDIFSAANVPIQWQPCDVG-PIFVNGLTTIPEP 94

Query: 76  TVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPV 133
            V+ ++ +   AL G + +P  K  G+ S  + LRK   L+AN+RP KSV    +    V
Sbjct: 95  AVKAIKESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRPAKSVPNYKSTYENV 151

Query: 134 DLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKG 193
           DLV+ RENTE  Y     + I+      V ++IK I+  A+  +   A E A+      G
Sbjct: 152 DLVLIRENTEGEY-----SGIEHIVTPGVVQSIKLITREASEKVIRYAYEYAIA----VG 202

Query: 194 HATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFD- 252
              L V HKS +    DGLF +I   +     ++ +++   QI+D+ V  +   P  +  
Sbjct: 203 RPRLIVVHKSTIQRLGDGLFVQIANEL---QSEYPSIKLETQILDNTVLNVVSNPTLYKD 259

Query: 253 -VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIA 310
            V V PNLYGDILSD  + L  GSLG+ PS N+G  + I E  HGSAPDI GQ  ANP A
Sbjct: 260 AVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTA 319

Query: 311 TIRSAALLLEFLGLPEAARHIEKVVDENIREN-KIKTPDLGGNSTGEQVANDILSRI 366
            + S+ ++L  +GL E A  IE  V   I    + +T DLGG++T       ++ ++
Sbjct: 320 LLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  161 bits (407), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/375 (31%), Positives = 191/375 (50%), Gaps = 29/375 (7%)

Query: 1   MLRVGR---GQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYID 57
           M+  G+   G+ + +    +  +T+  I GDG+G E+     K ++ I     V  ++  
Sbjct: 14  MMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEI----SKSVKDIFAAAKVPIEWEP 69

Query: 58  LQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYA 117
              G   F++    +PD  V+ + N    AL G + +P  K  G+ S  + LRK   L+A
Sbjct: 70  CDVG-PIFVNGLTTIPDAAVQSI-NKHLVALKGPLATPIGK--GHRSLNLTLRKTFNLFA 125

Query: 118 NIRPVKSVDG--TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATR 175
           N+RP +SV    T  + VDLV+ RENTE      E + I+      V ++IK I++ A+ 
Sbjct: 126 NVRPARSVPNYKTTYQNVDLVLIRENTE-----GEYSGIEHVISPGVIQSIKLITKDASE 180

Query: 176 NIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQ 235
            +   A E      +  G   L V HKS +   +DGLF  + K +     ++ +++   +
Sbjct: 181 RVIRYAFEYT----RAIGRPRLVVVHKSTIQRMADGLFVNVAKELAS---EYPDIELQTE 233

Query: 236 IVDSMVYRLFKEPQCFD--VIVAPNLYGDILSDGAAAL-VGSLGVVPSVNVGPNIVIGEP 292
           ++D+ +  +   P+ +   V V PNLYGDILSD  + L  GSLG+ PS N+G  + I E 
Sbjct: 234 LIDNTILNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEA 293

Query: 293 CHGSAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRE-NKIKTPDLGG 351
            HGSAPDI GQ  ANP A + S+ ++L  +GL E A  IE  +   I   ++ +T DL G
Sbjct: 294 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAG 353

Query: 352 NSTGEQVANDILSRI 366
            +T       +++++
Sbjct: 354 TATTSSFTEAVINKL 368

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  160 bits (404), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 182/350 (52%), Gaps = 24/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+ LIPGDG+GKEV      + E       +D++ I++     T +D+ + +    VE 
Sbjct: 30  YTVTLIPGDGVGKEVTDSVVSIFE--AENVPIDWETINI-----TGVDSEEGV-QKAVES 81

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G L G   +P  +  G+ S  VA RK L ++AN+   K+V G   +   +DLV+
Sbjct: 82  LKRNKIG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDLVV 139

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + ++ E+   V E++K I++  +  IA  A + AL+  ++    ++
Sbjct: 140 IRENTE-----GEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFALKNNRK----SV 190

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
              HK+N++   DGLFR     V  S  ++  +     IVD+   +   +P  FDV+V P
Sbjct: 191 CAVHKANIMKLGDGLFRNTVNEVGAS--EYPEIDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           NLYG IL +  AAL+G  G+VP  N G    + EP       DI G+ +ANP A I S+ 
Sbjct: 249 NLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMILSST 308

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+L  LGL   A  I K   + I E K  T D+GG+S+  +    ++ ++
Sbjct: 309 LMLRHLGLNGYADRISKATYDVIAEGKHTTKDIGGSSSTTEFTKSVIDKL 358

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  159 bits (401), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 179/350 (51%), Gaps = 23/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+ LIPGDG+GKEV      + +       VD+  +D+ +G     D   A     VE 
Sbjct: 29  YTVTLIPGDGVGKEVTDSVVSIFK--AENVPVDWDRVDI-SGVDRAEDVKSA-----VES 80

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G L G   +      G+ S  VALRK L +YAN+   KS+ G   +   VDLV+
Sbjct: 81  LKRNRIG-LKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLVV 139

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + ++ E+   V E++K +++     IA  A + A    K+     +
Sbjct: 140 IRENTE-----GEFSGLEHESVPGVVESLKIMTQDNIERIARFAFDYA----KKNDRKQV 190

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
              HK+N++   DGLF+ + + V +  K++  +Q    IVD+   +    P  FDV+V P
Sbjct: 191 VAVHKANIMKMGDGLFKNLVQEVGE--KEYPELQVGNIIVDNASMQTVANPHQFDVLVTP 248

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG IL +  AAL+G  G+V   N G ++ + EP       DI GQ +ANP A I S+ 
Sbjct: 249 SMYGTILGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMILSSV 308

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           LLL  LGL  +A  I K V   I E K  T D+GG ++  +    +++++
Sbjct: 309 LLLNHLGLNTSADRISKAVHAVIAEGKSVTRDIGGTASTTEFTEAVINKL 358

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  158 bits (399), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 179/350 (51%), Gaps = 23/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+ L+PGDG+GKE       V         +D++ +++       LD  + +    V+ 
Sbjct: 27  YTVTLLPGDGVGKECTDSVVSVFN--AENIPIDWEIVNISG-----LDHKEGVAA-AVQS 78

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPVDLVI 137
           LR N  G L G   +      G+ S  VA RK L +YAN+   KS+ G  T    VDLV+
Sbjct: 79  LRRNKIG-LKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDLVV 137

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + ++ E+   V E++K  +   T  IA  A   A    ++ G   +
Sbjct: 138 IRENTE-----GEFSGLEHESVEGVVESLKVTTLPKTERIARFAFNYA----QKNGRKAV 188

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
              HK+N++   DGLFR    S+ +  K++ +++ +  IVD+   +   +P  FDV+V P
Sbjct: 189 CAVHKANIMKLGDGLFRNTVTSIGE--KEYPDIETSSIIVDNASMQAVAKPHQFDVLVTP 246

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG I+ +  AAL+G  G+V   N G    + EP       DI GQ IANP A + S+A
Sbjct: 247 SMYGTIIGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLLSSA 306

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+L  LGL ++ + I   V E I E  ++T D+GG++T  +    ++ ++
Sbjct: 307 LMLNHLGLTKSGKRISDAVREVIAEGDVRTKDIGGDATTTEFTQAVIEKL 356

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  157 bits (397), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 108/350 (30%), Positives = 180/350 (51%), Gaps = 24/350 (6%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           +T+ LIPGDG+GKE+      + E       VD++ +D+        D  +A     VE 
Sbjct: 27  YTVTLIPGDGVGKEITDSVVSIFE--AENIPVDWERVDISTS-DNIQDVSQA-----VES 78

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           L+ N  G     +   +  +  + S  VALRK L ++A++   KSV G   +   VDLV+
Sbjct: 79  LKRNKIG--LKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDLVV 136

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE  Y     + ++ E+   V E++K I++  +  IA  A + A    K+    ++
Sbjct: 137 IRENTEGEY-----SGLEHESVPGVVESLKIITKAKSERIARFAFDFA----KKYNRKSV 187

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
              HK+N++   DGLFR     +     ++ ++Q +  IVD+   +   +P  FDV+V P
Sbjct: 188 CAVHKANIMKMGDGLFRNTVTEI--GANEYPDIQTSSIIVDNASMQAVAKPHQFDVMVTP 245

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANPIATIRSAA 316
           ++YG I+ +  AAL+G  G+V   + G    + EP       DI G+ +ANP A I S+ 
Sbjct: 246 SMYGTIIGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSST 305

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+L+ LGL E+A+ I K   + I   ++ T D+GG+++  +    I+ R+
Sbjct: 306 LMLQHLGLTESAKRIAKATHDVISLGQVTTKDIGGSASTTEFTEAIIKRL 355

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  155 bits (391), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 119/372 (31%), Positives = 187/372 (50%), Gaps = 37/372 (9%)

Query: 1   MLRVGRGQLSTRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQA 60
           +LR     +S + Y     F I LIPG+GIGKEV    R + +       +D++ +++++
Sbjct: 6   LLRRSISTISPKKY--GGRFQITLIPGNGIGKEVTDSVRSIFQ--AENLPIDWEIVNIES 61

Query: 61  ---GWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYA 117
              G +T +D+ K          RN    AL G   S    + G  S  VALRK L ++A
Sbjct: 62  HRDGIKTAVDSIK----------RNKI--ALKGIWSS--DPIDG--SLNVALRKQLDIFA 105

Query: 118 NIRPVKSVDGTGDR--PVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATR 175
           N+   KS D    R   VDLV+ RENTE      E + ++ E+   V E++K +++  T 
Sbjct: 106 NVAIFKSFDNVNTRIPNVDLVVIRENTE-----GEFSGLEHESVDGVVESLKIVTKPKTE 160

Query: 176 NIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQ 235
            IA  A + A    K+     +T  HK+N++   DGLF+ I   +   N ++  ++ +  
Sbjct: 161 RIARFAFDFA----KKHNRNHVTAVHKANIMKLGDGLFKNIVAHI--GNNEYPEIKNSSI 214

Query: 236 IVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CH 294
           IVD+   +   +P  FDV+V+P++YG IL +  AAL+G  G+VP  N G +  + EP   
Sbjct: 215 IVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRDYAVFEPGSR 274

Query: 295 GSAPDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNST 354
               DI GQ +ANP A I SA  +L  LGL   A  I   V   I +    T D+GG ++
Sbjct: 275 HVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTVTKDIGGTAS 334

Query: 355 GEQVANDILSRI 366
             +  + +++ +
Sbjct: 335 TTEFTDAVINEL 346

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  145 bits (366), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 191/363 (52%), Gaps = 37/363 (10%)

Query: 22  IGLIPGDGIGKEVIPVGRKVLEKIGPK-YGVDFKYIDLQAGWQTFLDTGKALPDDTVEQL 80
           I ++PGD +G+E++    KVL+ +  K +GV F +     G      TG  LPD+T+E  
Sbjct: 7   IVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEAA 66

Query: 81  RNNCQGALFGAVQSP---TTKVQGYSSPIVALRKALGLYANIRPVKSVDGT--GDRPV-- 133
           + +    L GAV  P   T KV+     ++ +RK LGLY N+RP K +     G  P+  
Sbjct: 67  KQS-DAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFISDKLIGLSPLKE 124

Query: 134 ------DLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQ 187
                 D V+ RE    +Y   ER    ++ G  VA   ++ S    + I  +A  ++LQ
Sbjct: 125 EVCKGTDFVVVRELVGGIYF-GERQ---EDDGSGVAWDSEKYSIEEVKRITKMAAFLSLQ 180

Query: 188 RLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKE 247
                    +    K+NVL+ S  L+R    +V ++  +F N++   Q++DS    L K 
Sbjct: 181 N---DPPLPIWSLDKANVLASSR-LWR---AAVDETIAEFPNLKVQHQLIDSAAMMLVKN 233

Query: 248 P-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSAPDI 300
           P Q   +I+  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSAPD+
Sbjct: 234 PTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPDL 293

Query: 301 VGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVA 359
             +G  NP+ATI SAA++L+  L + +    IE+ V   + +  I+T DLGGNST  ++ 
Sbjct: 294 -ARGKVNPVATILSAAMMLKLSLDMVQEGEAIERAV-SVVLDRGIRTADLGGNSTTSELG 351

Query: 360 NDI 362
           + +
Sbjct: 352 DAV 354

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  142 bits (358), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 102/292 (34%), Positives = 156/292 (53%), Gaps = 24/292 (8%)

Query: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           FT+ LIPGDG+GKEV    + + E       +D++ I+++   QT    G    ++ VE 
Sbjct: 29  FTVTLIPGDGVGKEVTDSVKTIFE--AENIPIDWETINIK---QTDHKEG---VNEAVES 80

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDR--PVDLVI 137
           LR N  G L G   +P  +  G+ S  VALRK L +YAN+   KS+ G   R   +DL++
Sbjct: 81  LRRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197
            RENTE      E + ++ E+   V E++K +++  T  IA  A + A    K+     +
Sbjct: 139 IRENTE-----GEFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFA----KKYNRKAV 189

Query: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAP 257
           T  HK+N++   DGLFR I   + Q  K++ ++  +  IVD+   +   +P  FDV+V P
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEIGQ--KEYPDIDVSSIIVDNASMQAVAKPHQFDVLVTP 247

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEP-CHGSAPDIVGQGIANP 308
           ++YG IL +  AAL+G  G+V   N G +  + EP       DI GQ +ANP
Sbjct: 248 SMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANP 299

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  141 bits (355), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 119/363 (32%), Positives = 184/363 (50%), Gaps = 40/363 (11%)

Query: 24  LIPGDGIGKEVIPVGRKVLEKIG---PKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQL 80
           ++PGD IG+EVI    KVL  I    P    +F+Y  +  G      TG  L D T+E  
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLI--GGAAINATGAPLSDKTIEAA 66

Query: 81  RNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVKSVDGT--GDRPV-- 133
           +      L GAV  P     G   P   ++A+RK LGLYAN+RP   +  +  G  P+  
Sbjct: 67  KA-ADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKP 124

Query: 134 ------DLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQ 187
                 D VI RE    +Y    +    ++ G  VA   ++ +      I  +   +ALQ
Sbjct: 125 EIAQGTDFVILRELVGGIYFGERK----EDDGDGVAWDSEKYTVSEVERITRMGAFLALQ 180

Query: 188 RLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKE 247
                    L    K+NVL+ S    R + +++    ++F  +    Q++DS    + K 
Sbjct: 181 H---DPPLPLWSFDKANVLASSRLWRRTVNETI---KREFPQLSVQHQLIDSAAMIMIKN 234

Query: 248 PQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSAPDI 300
           P+ F+ +++  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSAPD+
Sbjct: 235 PRKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDL 294

Query: 301 VGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVA 359
             +G ANPIA I SAA++L+  L + +  + IE  V + I E+ I+T DLGGN+T  +V 
Sbjct: 295 -EKGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQVI-ESGIRTGDLGGNNTTTEVG 352

Query: 360 NDI 362
           + +
Sbjct: 353 DAV 355

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  139 bits (351), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 124/366 (33%), Positives = 191/366 (52%), Gaps = 42/366 (11%)

Query: 22  IGLIPGDGIGKEVIPVGRKVL---EKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVE 78
           I ++PGD IG+EV+    KVL   E+       DF+Y     G      TG ALPD+ + 
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQY--HLVGGAAIDATGSALPDEALG 64

Query: 79  QLRNNCQGALFGAVQSPTTKVQGYS----SPIVALRKALGLYANIRPVK-SVDGTGD--- 130
             +      L GAV  P  K QG +      ++ LR+ LG+YAN+RP   + D   +   
Sbjct: 65  AAKE-ADAVLLGAVGGP--KWQGGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSP 121

Query: 131 ------RPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184
                 R  D+++ RE     Y   ER    ++ G  VA    + +    + IA +A  +
Sbjct: 122 LRPEIARDTDIMVVRELLGGSYF-GER---HEDEGDGVAWDTDKYTVKEVQRIARMAGFL 177

Query: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244
           ALQ        +L    K+NVL+ S  L+R+  +  +QS  +F NVQ   Q++DS    L
Sbjct: 178 ALQHDPPLPVWSLD---KANVLASSR-LWRKTVEETFQS--EFPNVQLQHQLIDSAAMIL 231

Query: 245 FKEPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSVNVG--PN----IVIGEPCHGSA 297
            K P+ F+ V+V  N++GDI+SD A+ + GSLG++PS ++   P+      + EPCHGSA
Sbjct: 232 VKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSA 291

Query: 298 PDIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGE 356
           PD+   G ANPI  I SAA++L+  L +  A   +E+ V E + ++ ++T DL G+S+  
Sbjct: 292 PDLPA-GKANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQE-VLDSGVRTGDLLGSSSTS 349

Query: 357 QVANDI 362
           +V + I
Sbjct: 350 EVGDAI 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  135 bits (340), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 117/366 (31%), Positives = 184/366 (50%), Gaps = 36/366 (9%)

Query: 19  SFTIGLIPGDGIGKEVIPVGRKVLEKIGP-KYGVDFKYIDLQAGWQTFLDTGKALPDDTV 77
           S  I ++PGD +GKEV     KVL  I   +  + F +     G      TG  LPD+ +
Sbjct: 2   SKNIVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEAL 61

Query: 78  EQLRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVKS-----VDGTG 129
           E  +      L GAV  P     G   P   ++ +RK LGLYAN+RP        +D + 
Sbjct: 62  EASKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSP 119

Query: 130 DRP-----VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184
            +P      D V+ RE    +Y    +    ++ G  VA   ++ S    + I  +A  +
Sbjct: 120 LKPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFL 175

Query: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244
           ALQ   +     +    K+NVL+ S  L+R+  +   ++  +F  +    Q++DS    L
Sbjct: 176 ALQ---QNPPLPIWSLDKANVLASSR-LWRKTVEETIKT--EFPQLTVQHQLIDSAAMIL 229

Query: 245 FKEPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSA 297
            K P   + V++  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSA
Sbjct: 230 VKSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSA 289

Query: 298 PDIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGE 356
           PD+    + NPIATI SAA++L+  L L E  R +E+ V  N+ +  ++T DLGG+++  
Sbjct: 290 PDLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAV-RNVLDAGVRTGDLGGSNSTT 347

Query: 357 QVANDI 362
           +V + I
Sbjct: 348 EVGDAI 353

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  134 bits (336), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 187/367 (50%), Gaps = 36/367 (9%)

Query: 22  IGLIPGDGIGKEVIPVGRKVLEKIGP-KYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQL 80
           I ++PGD +G+E+     KVL+ I   +  V+F + +   G      TG  LPD+ +E  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 81  RNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVKS-----VDGTGDRP 132
           +      L GAV  P     G   P   ++ +RK L LYAN+RP        +D +  +P
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 133 -----VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQ 187
                 D V+ RE    +Y    +    ++ G  VA   ++ +    + I  +A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 188 RLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKE 247
               +    +    K+NVL+ S  L+R+  +   ++  +F  ++   Q++DS    L K 
Sbjct: 181 H---EPPLPIWSLDKANVLASSR-LWRKTVEETIKN--EFPTLKVQHQLIDSAAMILVKN 234

Query: 248 PQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSAPDI 300
           P   + +I+  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSAPD+
Sbjct: 235 PTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDL 294

Query: 301 VGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVA 359
               + NPIATI SAA++L+  L LPE  + IE  V + + +  I+T DLGG+++  +V 
Sbjct: 295 PKNKV-NPIATILSAAMMLKLSLNLPEEGKAIEDAV-KKVLDAGIRTGDLGGSNSTTEVG 352

Query: 360 NDILSRI 366
           + +   +
Sbjct: 353 DAVAKEV 359

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  133 bits (334), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 186/367 (50%), Gaps = 36/367 (9%)

Query: 22  IGLIPGDGIGKEVIPVGRKVLEKIGP-KYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQL 80
           I ++PGD +G+E+     KVL+ I   +  V F + +   G      TG  LPD+ +E  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 81  RNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVKS-----VDGTGDRP 132
           +      L GAV  P     G   P   ++ +RK L LYAN+RP        +D +  +P
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 133 -----VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQ 187
                 D V+ RE    +Y    +    ++ G  VA   ++ +    + I  +A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 188 RLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKE 247
               +    +    K+NVL+ S  L+R+  +   ++  +F  ++   Q++DS    L K 
Sbjct: 181 H---EPPLPIWSLDKANVLASSR-LWRKTVEETIKN--EFPTLKVQHQLIDSAAMILVKN 234

Query: 248 PQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSAPDI 300
           P   + +I+  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSAPD+
Sbjct: 235 PTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDL 294

Query: 301 VGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVA 359
               + NPIATI SAA++L+  L LPE  + IE  V + + +  I+T DLGG+++  +V 
Sbjct: 295 PKNKV-NPIATILSAAMMLKLSLNLPEEGKAIEDAV-KKVLDAGIRTGDLGGSNSTTEVG 352

Query: 360 NDILSRI 366
           + +   +
Sbjct: 353 DAVAEEV 359

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  133 bits (334), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 112/367 (30%), Positives = 186/367 (50%), Gaps = 36/367 (9%)

Query: 22  IGLIPGDGIGKEVIPVGRKVLEKIGP-KYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQL 80
           I ++PGD +G+E+     KVL+ I   +  V F + +   G      TG  LPD+ +E  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 81  RNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVKS-----VDGTGDRP 132
           +      L GAV  P     G   P   ++ +RK L LYAN+RP        +D +  +P
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 133 -----VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQ 187
                 D V+ RE    +Y    +    ++ G  VA   ++ +    + I  +A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERK----EDDGDGVAWDCEQYTVPEVQRITRMAAFMALQ 180

Query: 188 RLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKE 247
               +    +    K+NVL+ S  L+R+  +   ++  +F  ++   Q++DS    L K 
Sbjct: 181 H---EPPLPIWSLDKANVLASSR-LWRKTVEETIKN--EFPTLKVQHQLIDSAAMILVKN 234

Query: 248 PQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSAPDI 300
           P   + +I+  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSAPD+
Sbjct: 235 PTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDL 294

Query: 301 VGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVA 359
               + NP+ATI SAA++L+  L LPE  + IE  V + + +  I+T DLGG+++  +V 
Sbjct: 295 PKNKV-NPVATILSAAMMLKLSLNLPEEGKAIEDAV-KRVLDAGIRTGDLGGSNSTTEVG 352

Query: 360 NDILSRI 366
           + +   +
Sbjct: 353 DAVAKEV 359

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  132 bits (333), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 117/374 (31%), Positives = 188/374 (50%), Gaps = 40/374 (10%)

Query: 17  SKSFTIGLIPGDGIGKEVIPVGRKVLEKIG---PKYGVDFKYIDLQAGWQTFLDTGKALP 73
           S +  I ++PGD +G+E+     KVL+ I    P+   +F+Y  +  G      TG+ LP
Sbjct: 2   STTKKIVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLI--GGAAIDATGEPLP 59

Query: 74  DDTVEQLRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRP--------- 121
           D ++E  + +    L GAV  P     G   P   ++ +RK L LYAN+RP         
Sbjct: 60  DASLEAAKKS-DAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 122 -VKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANI 180
            +  +     R  D V+ RE    +Y    +    ++TG  VA   ++ S    + I  +
Sbjct: 118 DLSPLKPECARGTDFVVVRELVGGIYFGERK----EDTGDGVAWDSEQYSVPEVQRITRM 173

Query: 181 ALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSM 240
           A  +ALQ        +L    K+NVL+ S  L+R+  +   ++  +F  +    Q++DS 
Sbjct: 174 AAFLALQHSPPLPVWSL---DKANVLASSR-LWRKTVEETIKN--EFPTLTVQHQLIDSA 227

Query: 241 VYRLFKEP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVG----PNIVIG--EPC 293
              L K P Q   VI+  N++GDI+SD A+ + GSLG++PS ++      N   G  EPC
Sbjct: 228 AMILVKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPC 287

Query: 294 HGSAPDIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGN 352
           HGSAPD+  +G  NPIATI SAA++L+  L + E    +E+ V   + ++ ++T DL G 
Sbjct: 288 HGSAPDL-PKGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAV-RKVLDSGVRTADLKGT 345

Query: 353 STGEQVANDILSRI 366
           ST  +V   ++  +
Sbjct: 346 STTSEVGEAVVKAL 359

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  132 bits (332), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 115/359 (32%), Positives = 185/359 (51%), Gaps = 38/359 (10%)

Query: 22  IGLIPGDGIGKEVIPVGRKVLEKIGPKY--GVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79
           I ++PGD +G+E++    KVLE +      G+ F++     G  +   TG  LPD+ ++ 
Sbjct: 6   IVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDA 65

Query: 80  LRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVKSVDGT--GDRPV- 133
            +N+    L GAV  P     G   P   ++ +RK L LYAN+RP   V  +  G  P+ 
Sbjct: 66  AKNS-DAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLSPLK 123

Query: 134 -------DLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIAL 186
                  D  + RE    +Y    +    ++ G   A   ++ +    + I  +A  +AL
Sbjct: 124 EEIAKGTDFTVVRELVGGIYFGDRK----EDDGDGSAWDCEKYTIPEVQRITRMAAFLAL 179

Query: 187 QRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFK 246
           Q        +L    K+NVL+ S  L+R+  +   ++  +F N++   Q++DS    L K
Sbjct: 180 QHDPPLPIWSL---DKANVLASSR-LWRKTVEETIKN--EFPNLKVQHQLIDSAAMILVK 233

Query: 247 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSAPD 299
            P+  + +I+  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSAPD
Sbjct: 234 SPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 300 IVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDL-GGNSTGE 356
           +  +G  NPIATI SAA++L+  L L +    IE+ V + + +  I+T DL G NST E
Sbjct: 294 L-PKGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAV-KQVLDAGIRTADLKGSNSTSE 350

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  132 bits (331), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 120/365 (32%), Positives = 188/365 (51%), Gaps = 40/365 (10%)

Query: 22  IGLIPGDGIGKEVIPVGRKVLEKIGP---KYGVDFKYIDLQAGWQTFLDTGKALPDDTVE 78
           I ++PGD +G+E+     KVL+ I         DF+Y  +  G      TG  LPD+ +E
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLI--GGAAIDATGVPLPDEALE 63

Query: 79  QLRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPV----KSVDGTGD- 130
             +N+    L GAV  P     G   P   ++ +RK LGLYAN+RP     +S+ G    
Sbjct: 64  ASKNS-DAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSPL 121

Query: 131 RP-----VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIA 185
           RP      D ++ RE    +Y    +    ++ G  VA   ++ S    + I  +A  +A
Sbjct: 122 RPEIAKGTDFMVVRELVGGIYFGKRK----EDEGDGVAWDSEQYSVPEVQRITRMAAFLA 177

Query: 186 LQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLF 245
           LQ        +L    K+NVL+ S  L+R+  +   ++  +F  +    Q++DS    L 
Sbjct: 178 LQHNPPLPIWSL---DKANVLASSR-LWRKTVEETIKN--EFPTLTVQNQLIDSAAMILV 231

Query: 246 KEP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSAP 298
           K P Q   +I+  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSAP
Sbjct: 232 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 291

Query: 299 DIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQ 357
           D+  +G  NPIATI SAA++L+  L L +    IE+ V + + +  I+T DLGG+++  +
Sbjct: 292 DL-PKGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAV-KKVLDAGIRTGDLGGSNSTTE 349

Query: 358 VANDI 362
           V + I
Sbjct: 350 VGDAI 354

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  131 bits (330), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 113/366 (30%), Positives = 182/366 (49%), Gaps = 36/366 (9%)

Query: 19  SFTIGLIPGDGIGKEVIPVGRKVLEKIGP-KYGVDFKYIDLQAGWQTFLDTGKALPDDTV 77
           S  I ++PGD +G+E+     KVL+ I   +    F +     G      TG  LPD+ +
Sbjct: 2   SKNIVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEAL 61

Query: 78  EQLRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRP----------VKS 124
           E  +      L GAV  P     G   P   ++ +RK L LYAN+RP          +  
Sbjct: 62  EASKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSP 119

Query: 125 VDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184
           +     +  D V+ RE    +Y    +    ++ G  VA   ++ S    + I  +A  +
Sbjct: 120 LKAQYAQGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEQYSVPEVQRITRMAAFL 175

Query: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244
           ALQ         +    K+NVL+ S  L+R+  +   +  ++F  +  N Q++DS    L
Sbjct: 176 ALQH---NPPLPIWSLDKANVLASSR-LWRKTVEKTIK--EEFPTLSVNHQLIDSAAMIL 229

Query: 245 FKEP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSA 297
            K P Q   +I+  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSA
Sbjct: 230 VKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSA 289

Query: 298 PDIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGE 356
           PD+  +G  NP+ATI SAA++L+  L + E    IEK V + + ++ I+T DLGG+++  
Sbjct: 290 PDL-AKGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAV-KKVLDDGIRTGDLGGSNSTS 347

Query: 357 QVANDI 362
           +V + +
Sbjct: 348 EVGDAV 353

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  131 bits (329), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 124/364 (34%), Positives = 181/364 (49%), Gaps = 38/364 (10%)

Query: 22  IGLIPGDGIGKEVIPVGRKVLEKIGP-KYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQL 80
           I + PGD IG E++    KVL+ I      V FKY     G      TG+ L D+ + Q+
Sbjct: 7   ITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLTDEAL-QV 65

Query: 81  RNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVKSVDGT--GDRPV-- 133
             N    L GAV  P     G   P   ++ +RK LG+YAN+RP + V  T     P+  
Sbjct: 66  AKNSDAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLLDLSPLKR 124

Query: 134 ------DLVIARENTEDLYIKSERTYIDKETGGR-VAEAIKRISEHATRNIANIALEIAL 186
                 D VI RE    +Y   ER    +E G   VA   +  S    + I  +A  +AL
Sbjct: 125 EIVQGTDFVIVRELVGGIYF-GER----QEAGDDGVAWDKESYSVPEIQRITRMAAFLAL 179

Query: 187 QRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFK 246
           Q        +L    K+NVL+ S  L+R+  +   ++  +F  +  N  ++DS    L +
Sbjct: 180 QHNPPLPVWSL---DKANVLATSR-LWRKTVEETIKN--EFPTLTINHHLIDSAAMTLVQ 233

Query: 247 EPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSAPD 299
            P   + V++  N++GDI+SD A+ + GSLG++PS ++      N  +G  EPCHGSAPD
Sbjct: 234 NPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEPCHGSAPD 293

Query: 300 IVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQV 358
           +     ANPIATI SAA++ +  L L +    IE+ V   I +  IKT DLGG +T  +V
Sbjct: 294 LPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGDLGGKNTTTEV 351

Query: 359 ANDI 362
            N +
Sbjct: 352 GNAV 355

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  130 bits (327), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 114/365 (31%), Positives = 184/365 (50%), Gaps = 40/365 (10%)

Query: 22  IGLIPGDGIGKEVIPVGRKVLEKIGP-KYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQL 80
           I ++PGD +G+E+     KVL+ I   +  V F++     G      TG+ LPD ++E  
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 81  RNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRP----------VKSVDG 127
           +      L GAV  P     G   P   ++ +RK L LYAN+RP          +  +  
Sbjct: 67  KK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 128 TGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQ 187
              R  D V+ RE    +Y    +    ++ G  VA   ++ S    + I  +A  +ALQ
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 188 RLKEKGHATLTVTH--KSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLF 245
                 +  L V    K+NVL+ S  L+R+  +   ++  +F  +    Q++DS    + 
Sbjct: 181 H-----NPPLPVWSLDKANVLASSR-LWRKTVEETIKN--EFPTLTVQHQLIDSAAMIMV 232

Query: 246 KEP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSAP 298
           K P Q   VI+  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSAP
Sbjct: 233 KNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 292

Query: 299 DIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQ 357
           D+  +G  NPIATI SAA++LE  L + E    +E+ V   + ++ I+T DL G+++ ++
Sbjct: 293 DL-EKGKVNPIATILSAAMMLELSLDMFEEGTAVEEAV-RRVLDSGIRTGDLRGSNSTQE 350

Query: 358 VANDI 362
           V + +
Sbjct: 351 VGDAV 355

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  128 bits (321), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 115/365 (31%), Positives = 181/365 (49%), Gaps = 37/365 (10%)

Query: 21  TIGLIPGDGIGKEVIPVGRKVLEKIGP--KYGVDFKYIDLQAGWQTFLDTGKALPDDTVE 78
           TI ++PGD +G+E+     KVL  I       V+FK+     G      TG  LPD+ +E
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 79  QLRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVK-SVDGTGD---- 130
             +      L GAV  P     G   P   ++ +RK L LYAN+RP   + D   D    
Sbjct: 66  ASKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 131 -----RPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIA 185
                R  D V+ RE    +Y    +    ++ G  VA   ++ S    + I  +A  +A
Sbjct: 124 KPEIARGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFMA 179

Query: 186 LQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLF 245
           LQ         +    K+NVL+ S  L+R+  +   ++  +F  +    Q++DS    L 
Sbjct: 180 LQH---NPPLPIWSLDKANVLASSR-LWRKTVEETIKN--EFPQLTVQHQLIDSAAMILV 233

Query: 246 KEPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHGSAP 298
           K P   + +I+  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSAP
Sbjct: 234 KNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAP 293

Query: 299 DIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQ 357
           D+  +G  NP+ATI SAA++L+  L L E    IE+ V + + ++ I+T DL G ++  +
Sbjct: 294 DL-PKGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAV-KKVLDSGIRTADLKGTNSTTE 351

Query: 358 VANDI 362
           V + +
Sbjct: 352 VGDAV 356

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  127 bits (319), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 118/374 (31%), Positives = 187/374 (50%), Gaps = 40/374 (10%)

Query: 9   LSTRTYVTSKSFT---IGLIPGDGIGKEVIPVGRKVLEKIGP-KYGVDFKYIDLQAGWQT 64
           +ST    T+ + T   I ++PGD +G+E+     KVL  I   +  V+F +     G   
Sbjct: 74  ISTHHSTTAMAQTTKHIVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAA 133

Query: 65  FLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRP 121
              TG  LPD+ +E  +      L GAV  P     G   P   ++ +RK L LYAN+RP
Sbjct: 134 IDATGVPLPDEALEASKK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRP 191

Query: 122 VKS-----VDGTGDRP-----VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISE 171
                   +D +  +P      D+ I RE    +Y    +    ++ G  VA   ++ S 
Sbjct: 192 CNFASDSLLDLSPLKPEIVKGTDICIVRELVGGIYFGERK----EDEGDGVAWDSEKYSV 247

Query: 172 HATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQ 231
              + I  +A  +ALQ        +L    K+NVL+ S  L+R+  +   ++  +F  + 
Sbjct: 248 SEVQRITRMAGFLALQHNPPLPVWSLD---KANVLASSR-LWRKTVEETIKN--EFPTLT 301

Query: 232 YNEQIVDSMVYRLFKEPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----N 286
              Q++DS    L K P   + V++A N++GDI+SD A+ + GSLG++PS ++      N
Sbjct: 302 VQHQLIDSAAMILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTN 361

Query: 287 IVIG--EPCHGSAPDIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENK 343
              G  EPCHGSAPD+  +G  NP+ATI S A++L+  L + E    +EK V + + ++ 
Sbjct: 362 TAFGLYEPCHGSAPDL-PKGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQ-VLDSG 419

Query: 344 IKTPDL-GGNSTGE 356
           ++T DL G NST E
Sbjct: 420 VRTADLRGSNSTSE 433

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  124 bits (312), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 117/374 (31%), Positives = 185/374 (49%), Gaps = 44/374 (11%)

Query: 17  SKSFTIGLIPGDGIGKEVIPVGRKVLEKIG---PKYGVDFKYIDLQAGWQTFLDTGKALP 73
           S +  I ++PGD +G+E+     KVL+ I    P    DF+Y  +  G      TG  L 
Sbjct: 2   STTKKIVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLI--GGAAIDATGVPLT 59

Query: 74  DDTVEQLRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRP--------- 121
           D+ +E  +      L GAV  P     G   P   ++ +RK L LYAN+RP         
Sbjct: 60  DEALEASKK-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLL 117

Query: 122 -VKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANI 180
            +  +     R  D V+ RE    +Y    +    ++ G  VA   ++ +    + I  +
Sbjct: 118 ELSPIKPQFARGTDFVVVRELVGGIYFGKRK----EDDGDGVAWDSEQYTVPEVQRITRM 173

Query: 181 ALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSM 240
           A  +ALQ    +    +    K+NVL+ S  L+R+  +   ++  +F  ++   Q++DS 
Sbjct: 174 AAFMALQH---QPPLPIWSLDKANVLASSR-LWRKTVEETIKN--EFPTLKVQHQLIDSA 227

Query: 241 VYRLFKEP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPC 293
              L K P Q   +I+  N++GDI+SD A+ + GSLG++PS ++      N   G  EPC
Sbjct: 228 AMILVKNPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPC 287

Query: 294 HGSAPDIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGG- 351
           HGSAPD+    + NPIATI SAA++L+  L +    + IE  V + + +  I+T DLGG 
Sbjct: 288 HGSAPDLPKNKV-NPIATILSAAMMLKLSLNMTAEGQAIEDAV-KKVLDAGIRTGDLGGS 345

Query: 352 NST---GEQVANDI 362
           NST   G+ VA ++
Sbjct: 346 NSTIEVGDAVAKEV 359

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  120 bits (302), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 114/368 (30%), Positives = 187/368 (50%), Gaps = 40/368 (10%)

Query: 19  SFTIGLIPGDGIGKEVIPVGRKVLEKIG---PKYGVDFKYIDLQAGWQTFLDTGKALPDD 75
           S  I ++PGD  G+E+     KVLE I    P+   +F++  +  G      TG  LPDD
Sbjct: 2   SKNIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLI--GGAAIDATGSPLPDD 59

Query: 76  TVEQLRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVKS-----VDG 127
            +   +      L GAV  P     G   P   ++ +RK L LYAN+RP        +D 
Sbjct: 60  ALAAAKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDL 117

Query: 128 TGDRP-----VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIAL 182
           +  +P      D V+ RE    +Y    +    ++ G  VA   ++ ++   + +  +A 
Sbjct: 118 SPLKPQHAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYTKPEVQRLTRMAA 173

Query: 183 EIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVY 242
            +ALQ         +    K+NVL+ S  L+R+  +   ++  +F  ++ N Q++DS   
Sbjct: 174 FLALQH---NPPLPIWSLDKANVLASSR-LWRKTVEETIKN--EFPQLKLNHQLIDSAAM 227

Query: 243 RLFKEP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP----NIVIG--EPCHG 295
            L K P Q   +++  NL+GDI+SD A+ + GSLG++PS ++      N   G  EPCHG
Sbjct: 228 ILVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHG 287

Query: 296 SAPDIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNST 354
           SAPD+  +G  NPIA I SAA++L+  L L +    +EK V + + ++ ++T DLGG+++
Sbjct: 288 SAPDL-PKGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQ-VLDSGVRTGDLGGSNS 345

Query: 355 GEQVANDI 362
             +V + I
Sbjct: 346 TSEVGDAI 353

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  120 bits (300), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 112/371 (30%), Positives = 182/371 (49%), Gaps = 41/371 (11%)

Query: 17  SKSFTIGLIPGDGIGKEVIPVGRKVLEKI----GPKYGVDFKYIDLQAGWQTFLDTGKAL 72
           S +  I ++PGD +G E+     KVL+ I      K   DF+Y  +  G       G  L
Sbjct: 2   STTKKIVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLI--GGAAIDAAGVPL 59

Query: 73  PDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVK--SVDG 127
            D+ +E  +      L GAV  P     G   P   ++ +RK LGLYAN+RP    S   
Sbjct: 60  TDEALEASKK-ADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPL 117

Query: 128 TGDRPV--------DLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIAN 179
            G  P+        D ++ RE    +Y    +    ++ G  VA   ++ S      I  
Sbjct: 118 LGLSPLRPEIAKGTDFMVVRELVGGIYFGERK----EDDGDGVAWDSEKYSVPEVERITR 173

Query: 180 IALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDS 239
           +A  +ALQ         +    K+NVL+ S  L+R+  ++  ++  +F  +    Q++DS
Sbjct: 174 MAAFLALQH---NPPLPIWSLDKANVLASSR-LWRKTVEATIKN--EFPTLTVQNQLIDS 227

Query: 240 MVYRLFKEP-QCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVG----PNIVIG--EP 292
               L K P Q   +I+  N++GDI+SD A+ + GSLG++PS ++      N   G  EP
Sbjct: 228 AAMILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEP 287

Query: 293 CHGSAPDIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGG 351
           CHGSAPD+    + NP+ATI SAA++L+  L + +    +E+ V   + +  ++T DLGG
Sbjct: 288 CHGSAPDLPKNKV-NPVATILSAAMMLKLSLNMVKEGEAVEEAV-RRVLDAGVRTGDLGG 345

Query: 352 NSTGEQVANDI 362
           +++ ++V + I
Sbjct: 346 SNSTQEVGDAI 356

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  119 bits (298), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 109/369 (29%), Positives = 183/369 (49%), Gaps = 40/369 (10%)

Query: 22  IGLIPGDGIGKEVIPVGRKVLEKIG---PKYGVDFKYIDLQAGWQTFLDTGKALPDDTVE 78
           I ++PGD +G+E+     +VL+ I    P    D++Y  +  G      TG  LPD+ ++
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLI--GGAAIDATGVPLPDEALD 64

Query: 79  QLRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVKS-----VDGTGD 130
             +      L GAV  P     G   P   ++ +RK L LYAN+RP        +D +  
Sbjct: 65  AAKKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 122

Query: 131 RP-----VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIA 185
           +P      D V+ RE    +Y    +    ++ G  VA   ++ S    + I  +A  +A
Sbjct: 123 KPEYAKGTDFVVVRELVGGIYFGERK----EDEGDGVAWDSEKYSVPEVQRITRMAAFLA 178

Query: 186 LQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLF 245
           LQ   +     +    K+NVL+ S  L+R+  +   ++  +F  +    Q++DS    L 
Sbjct: 179 LQ---QNPPLPIWSLDKANVLASSR-LWRKTVEETIKN--EFPTLTVQHQLIDSAAMILV 232

Query: 246 KEPQCFD-VIVAPNLYGDILSDGAAALVGSLGVVPSVNVG----PNIVIG--EPCHGSAP 298
           K P   + +++  N++GDI+SD A+ + GSLG++PS ++      N   G  EPCHGSAP
Sbjct: 233 KSPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAP 292

Query: 299 DIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQ 357
           D+    + NPIATI SAA++L+  L L E    +E+ V   + +  I+T DL G ++  +
Sbjct: 293 DLPKNKV-NPIATILSAAMMLKLSLNLVEEGNAVEEAV-RRVLDAGIRTADLRGENSTSE 350

Query: 358 VANDILSRI 366
           V + ++  +
Sbjct: 351 VGDAVVKAV 359

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  109 bits (273), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 109/368 (29%), Positives = 177/368 (48%), Gaps = 45/368 (12%)

Query: 22  IGLIPGDGIGKEVIPVGRKVLEKI----GPKYGVDFKYIDLQAGWQTFLDTGKALPDDTV 77
           I ++PGD +G EV     K+L+ I      K   +F+Y  +  G      TG  LPD+++
Sbjct: 7   IVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLI--GGAAIDATGNPLPDESL 64

Query: 78  EQLRNNCQGALFGAVQSPTTKVQGYSSP---IVALRKALGLYANIRPVK-SVDGTGD--- 130
           E  +      L GAV  P     G   P   ++ +RK L LYAN+RP   + D   D   
Sbjct: 65  EASKR-ADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSP 122

Query: 131 ------RPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEI 184
                 +  D  + RE    +Y    +    ++ G  VA   ++ S    + I  +A  +
Sbjct: 123 LKEKYAKGTDFTVVRELVGGIYFGKRK----EDDGDGVAWDSEQYSVPEVQRITRMAAFL 178

Query: 185 ALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRL 244
           A+Q         +    K+NVL+ S  L+R+  +   Q+  +F +++ + Q++DS    L
Sbjct: 179 AMQH---NPPLPIWSLDKANVLASSR-LWRKTVEETIQN--EFPSLKVSHQLIDSAAMIL 232

Query: 245 FKEP-QCFDVIVAPNLYGDILSDGAAALVG--------SLGVVPSVNVGPNIVIGEPCHG 295
            K P Q   +I+  N++GDI+SD A+ + G        SL  +P  N    +   EPCHG
Sbjct: 233 VKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLY--EPCHG 290

Query: 296 SAPDIVGQGIANPIATIRSAALLLEF-LGLPEAARHIEKVVDENIRENKIKTPDLGGNST 354
           SAPD+  +G  NPI TI S A++L+  L L E    +E+ V   + +N I+T DLGG+++
Sbjct: 291 SAPDL-PKGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAV-RRVLDNNIRTADLGGSNS 348

Query: 355 GEQVANDI 362
              + + +
Sbjct: 349 TSDIGDAV 356

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 121/271 (44%), Gaps = 30/271 (11%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKET 158
           V G+  PI+  R A G       V +++G G+  + LV    + +       + Y   E+
Sbjct: 121 VPGWQRPIIIGRHAFGDQYKATDV-AIEGAGE--LRLVFRSRDGDQAKDLDLQVYEFPES 177

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICK 218
           GG VA A+   +E + R  A  + E+ALQR        L  T K+ +L + DG F++  +
Sbjct: 178 GG-VALAMYNTTE-SIRGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKDEFE 230

Query: 219 SVYQSN--KKF--ANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
           ++Y++   ++F  A + Y  +++D MV ++ K    F VI   N  GD+ SD  A   GS
Sbjct: 231 AMYEAEYRERFERAGIWYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGS 289

Query: 275 LGVVPSVNVGPN--IVIGEPCHGS----------APDIVGQGIANPIATIRSAALLLEFL 322
           LG++ SV V P+      E  HG+            +     IA+  A  R         
Sbjct: 290 LGLMTSVLVTPDGRAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLLQRGRLD 349

Query: 323 GLPEA---ARHIEKVVDENIRENKIKTPDLG 350
           G PE    AR +E      + E+ I T DL 
Sbjct: 350 GTPEVEGFARALETATVATVNEDGIMTKDLA 380

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 121/272 (44%), Gaps = 32/272 (11%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKET 158
           V G+  PI+     +G +A+    ++ D   ++   L +     +    K  + +  K T
Sbjct: 129 VPGWQKPII-----IGRHAHGDQYRATDAIIEKAGKLELVHRPADGSEPKILQVHEFKGT 183

Query: 159 GGR-VAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREIC 217
           G R VA A+    E + R  A+ + ++AL +        L ++ K+ +L Q DG F++I 
Sbjct: 184 GARGVALAMYNTDE-SIRGFAHASFKLALSK-----RLNLFMSTKNTILKQYDGRFKDIF 237

Query: 218 KSVY----QSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVG 273
           + VY    Q+  +   + Y  +++D MV ++ K    F V+   N  GD+LSD  A   G
Sbjct: 238 QEVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFG 296

Query: 274 SLGVVPSVNVGPN--IVIGEPCHGSAPDIVGQ----------GIANPIATIRSAALLLEF 321
           SLG++ S+ V P+      E  HG+      Q           IA+  A  R      E 
Sbjct: 297 SLGLMTSMLVTPDGKTFESEAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGLGKRGEL 356

Query: 322 LGLP---EAARHIEKVVDENIRENKIKTPDLG 350
            G P   E AR +E    E ++++ I T DL 
Sbjct: 357 DGTPDVVEFARKLEAATIETVQQHGIMTKDLA 388

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 94/200 (47%), Gaps = 25/200 (12%)

Query: 170 SEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQS--NKKF 227
           ++ + R  A+ + ++ALQ+        L ++ K+ +L + DG F++I + VY S   +KF
Sbjct: 197 TDESIRGFAHSSFKLALQK-----KLNLFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKF 251

Query: 228 A--NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP 285
           A  N+ Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLG++ S+ + P
Sbjct: 252 AELNITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITP 310

Query: 286 N--IVIGEPCHGS----------APDIVGQGIANPIATIRSAALLLEFLGLPEAARH--- 330
           +      E  HG+            +     IA+  A  R  A   E  G P+  R    
Sbjct: 311 DGKTFESEAAHGTVTRHYRKHQQGEETSTNSIASIFAWTRGLAKRGELDGTPDVVRFANI 370

Query: 331 IEKVVDENIRENKIKTPDLG 350
           +E      ++++ I T DL 
Sbjct: 371 LESATLNTVQQDGIMTKDLA 390

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 122/275 (44%), Gaps = 41/275 (14%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGT--GDRPVDLVIARENTEDLYIKSERTYID- 155
           V G+  PI+     +G +A+    K+ D    G   ++LV   E+       SE T ++ 
Sbjct: 134 VPGWEKPII-----IGRHAHADQYKATDAIIPGPGKLELVYKPEDG------SEPTKLEV 182

Query: 156 -KETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDG--- 211
               G  VA A+    E + R  A+ + ++AL +        L ++ K+ +L + DG   
Sbjct: 183 YDYKGAGVALAMYNTDE-SIRGFAHASFKLALNK-----KLNLFLSTKNTILKKYDGRFK 236

Query: 212 -LFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAA 270
            +F+EI  + Y++  + AN+ Y  +++D MV ++ K    F ++   N  GD+ SD  A 
Sbjct: 237 DIFQEIFDAEYKTQFEAANISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQ 295

Query: 271 LVGSLGVVPSVNVGPN--IVIGEPCHGSAPDIVGQ----------GIANPIATIRSAALL 318
             GSLG++ SV V P+      E  HG+      Q           IA+  A  R  A  
Sbjct: 296 GFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKR 355

Query: 319 LEFLGLPEAARH---IEKVVDENIRENKIKTPDLG 350
            E  G PE  +    +E      ++E+ I T DL 
Sbjct: 356 GELDGTPEVTKFANLLESATLNTVQEDGIMTKDLA 390

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 119/280 (42%), Gaps = 48/280 (17%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSE----RTYI 154
           V G++ PI+  R A G                +  D+VI  E T  L  +S+       +
Sbjct: 121 VPGWNEPIIVGRHAFG-------------DQYKATDVVIPGEGTLKLVFESKDGDKSKNL 167

Query: 155 DKET-----GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQS 209
           D E       G VA  +   ++  T   A  + E+ALQR        L  T K+ +L + 
Sbjct: 168 DLEVFEYPKDGGVAMTMYNTTDSIT-GFAKSSFELALQR-----KMPLYSTTKNTILKKY 221

Query: 210 DGLFREICKSVY--QSNKKF--ANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILS 265
           DG F++I + +Y  +  +KF  A + Y  +++D MV ++ K    F +I   N  GD+ S
Sbjct: 222 DGKFKDIFEGMYAAEYKEKFEAAGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQS 280

Query: 266 DGAAALVGSLGVVPSVNVGPN--IVIGEPCHGSAPDIVGQ----------GIANPIATIR 313
           D  A   GSLG++ SV V P+      E  HG+      Q           IA+  A  R
Sbjct: 281 DIVAQGFGSLGLMTSVLVSPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTR 340

Query: 314 SAALLLEFLGLPEAARH---IEKVVDENIRENKIKTPDLG 350
                 +  G P+  +    +EK   + ++E+ I T DL 
Sbjct: 341 GIIHRGKVDGTPDVVKFGELLEKSTLDTVQEDNIMTKDLA 380

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 117/280 (41%), Gaps = 48/280 (17%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKS----ERTYI 154
           V G+  PI+  R A G                +  D+VI  E T  L  KS    E   I
Sbjct: 121 VSGWKEPIIIGRHAFG-------------DQYKATDVVIPGEGTLKLVFKSKDGDESKDI 167

Query: 155 DKET-----GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQS 209
           D +       G VA ++   +E  T   A  + E+AL+R        L  T K+ +L + 
Sbjct: 168 DLDVFEFPKDGGVAMSMYNTAESIT-GFAKSSFELALER-----KMPLYSTTKNTILKKY 221

Query: 210 DGLFREICKSVYQS--NKKF--ANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILS 265
           DG F++I + +Y+    +KF    + Y  +++D MV ++ K    F +I   N  GD+ S
Sbjct: 222 DGQFKDIFEGMYEREYKQKFEAVGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQS 280

Query: 266 DGAAALVGSLGVVPSVNVGPN--IVIGEPCHGS----------APDIVGQGIANPIATIR 313
           D  A   GSLG++ SV V P+      E  HG+            +     IA+  A  R
Sbjct: 281 DIVAQGFGSLGLMTSVLVSPDGKTFESEAAHGTVTRHYRLHQQGKETSTNSIASIFAWSR 340

Query: 314 SAALLLEFLGLPEAARH---IEKVVDENIRENKIKTPDLG 350
                 +  G P+  +    +E    + ++E+ I T DL 
Sbjct: 341 GIIQRGKLDGTPDVVKFGQLLESATLDTVQEDGIMTKDLA 380

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 95/204 (46%), Gaps = 19/204 (9%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKET 158
           V  +S PIV  R A G       +  V G GD  + LV   +N ++    SE        
Sbjct: 121 VPQWSKPIVIGRHAFGDQYKASDM-VVKGEGD--LKLVFKSKNGDN---DSELDVFHFPP 174

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICK 218
            G VA A+   SE +    A  + E+ALQR        L  T K+ +L + DG F+++ +
Sbjct: 175 TGGVALAMYNTSE-SIAGFARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFE 228

Query: 219 SVY----QSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
           ++Y    QS  +   + Y  +++D MV ++ K    F +I   N  GD+ SD  A   GS
Sbjct: 229 AMYAAEYQSRFEELGIWYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGS 287

Query: 275 LGVVPSVNVGPN--IVIGEPCHGS 296
           LG++ SV V P+      E  HG+
Sbjct: 288 LGLMTSVLVTPDGKTFESEAAHGT 311

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 117/271 (43%), Gaps = 29/271 (10%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKET 158
           V  +  PI+  R A G       V  + G G   +       NTE++ +       D+E+
Sbjct: 121 VTNWEKPIIIGRHAFGDQYRATDV-VIPGAGKLKLVFESDDSNTENIELSVYD--FDEES 177

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICK 218
            G VA A+    E  T   A+ + ++AL+R        L  T K+ +L + DG F+++ +
Sbjct: 178 KGGVAMAMYNTLESIT-GFAHASFKMALER-----GLPLYSTTKNTILKKYDGKFKDVFE 231

Query: 219 SVYQSNKKFA----NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
           S+Y+S  K A     + Y  +++D MV ++ K    + +I   N  GD+ SD  A   GS
Sbjct: 232 SLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGS 290

Query: 275 LGVVPSVNVGPN--IVIGEPCHGSAPDIVGQ----------GIANPIATIRSAALLLEFL 322
           LG++ SV + P+      E  HG+      Q           IA+  A  R      +  
Sbjct: 291 LGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLIQRGKLD 350

Query: 323 GLPEAARH---IEKVVDENIRENKIKTPDLG 350
             P+  +    +E      ++E++I T DL 
Sbjct: 351 STPDVVKFAELVESATVNTVQEDEIMTKDLA 381

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 125/279 (44%), Gaps = 41/279 (14%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGT--GDRPVDLVIARENTEDLYIKSERTYIDK 156
           V G+  PI+     +G +A+    K+ D    G   ++LV   EN  +   K    Y  K
Sbjct: 133 VPGWEKPII-----IGRHAHGDQYKATDAVIPGPGKLELVYKPENGPE---KVMEVYDYK 184

Query: 157 ETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREI 216
             G  VA A+   +E + R  A+ + ++AL +        L ++ K+ +L + DG F++I
Sbjct: 185 GPG--VALAMYN-TEESIRGFAHASFKLALTK-----KLNLYLSTKNTILKKYDGRFKDI 236

Query: 217 CKSVYQS--NKKF--ANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALV 272
            + +Y +   K+F  A + Y  +++D MV ++ K    F ++   N  GD+ SD  A   
Sbjct: 237 FQELYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGF 295

Query: 273 GSLGVVPSVNVGPN--IVIGEPCHGSAPDIVGQ----------GIANPIATIRSAALLLE 320
           GSLG++ SV V P+      E  HG+      Q           IA+  A  R  A   E
Sbjct: 296 GSLGLMTSVLVTPDGKTFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWSRGLAKRGE 355

Query: 321 FLGLPEAARH---IEKVVDENIRENKIKTPDL---GGNS 353
               P+  R    +E      ++++ I T DL   GGN+
Sbjct: 356 LDNTPQVVRFANILEAATLNTVQQDGIMTKDLALAGGNT 394

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 118/271 (43%), Gaps = 33/271 (12%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKET 158
           V G+  PIV     +G +A+    K+ D     P  L +  + T+    K+   Y  K  
Sbjct: 140 VPGWEKPIV-----IGRHAHGDQYKATDLVVPGPGKLELVYKPTDGSETKTLEVYDYKGP 194

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDG----LFR 214
           G  +A A+    E + R  A+ + ++A+ +        L ++ K+ +L + DG    +F+
Sbjct: 195 G--IALAMYNTDE-SIRGFAHASFKLAITK-----KLNLYLSTKNTILKKYDGRFKDIFQ 246

Query: 215 EICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
           EI  S Y+S  +   + Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 247 EIYDSEYKSEFEKLGIWYEHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGFGS 305

Query: 275 LGVVPSVNVGPN--IVIGEPCHGSAPDIVGQ----------GIANPIATIRSAALLLEFL 322
           LG++ SV V P+      E  HG+      Q           IA+  A  R  A   E  
Sbjct: 306 LGLMTSVLVTPDGKAFESEAAHGTVTRHYRQYQQGKETSTNSIASIFAWTRGLAKRGELD 365

Query: 323 GLPEA---ARHIEKVVDENIRENKIKTPDLG 350
             PE    A  +EK     ++E+ I T DL 
Sbjct: 366 NTPEVVEFANLLEKSTLNTVQEDGIMTKDLA 396

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 96/210 (45%), Gaps = 26/210 (12%)

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDG----LFR 214
           GG V  A+    E + R  A+ + ++AL +        L ++ K+ +L + DG    LF+
Sbjct: 192 GGGVGLAMYNTDE-SIRGFAHASFKLALSK-----KLDLFLSTKNTILKRYDGRFKDLFQ 245

Query: 215 EICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
           EI  + Y+   + + +QY  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 246 EIFDAEYKQQFEESGIQYQHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 275 LGVVPSVNVGPN--IVIGEPCHGSAPDIV------GQGIANPIATI----RSAALLLEFL 322
           LG++ SV V P+      E  HG+            +   NPIA+I    R  A   E  
Sbjct: 305 LGLMTSVLVTPDGKTFESEAAHGTVTRHYRKYQRGEETSTNPIASIFAWTRGIAKRGELD 364

Query: 323 GLPEAARH---IEKVVDENIRENKIKTPDL 349
           G P+  R    +E      ++E+   T DL
Sbjct: 365 GTPDVVRFANILESATLNTVQEDGKMTKDL 394

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 104/246 (42%), Gaps = 33/246 (13%)

Query: 131 RPVDLVIARENTEDLYIKSERTYIDKE-------TGGRVAEAIKRISEHATRNIANIALE 183
           R  D+VI  E    L  KS+    D++         G V  A+   +E  T   A  + E
Sbjct: 139 RATDVVIPGEGELRLVFKSKDGKSDQDLHVFDFPKDGGVGMAMYNTTESIT-GFAKASFE 197

Query: 184 IALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVY----QSNKKFANVQYNEQIVDS 239
           +AL+R        L  T K+ +L + DG F+++ + +Y    QS  +   + Y  +++D 
Sbjct: 198 LALER-----KLPLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEELGIWYEHRLIDD 252

Query: 240 MVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIGEPCHGSA 297
           MV ++ K    F +I   N  GD+ SD  A   GSLG++ SV V P+      E  HG+ 
Sbjct: 253 MVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTV 311

Query: 298 PDIVGQ----------GIANPIATIRSAALLLEFLGLPEAARH---IEKVVDENIRENKI 344
                Q           IA+  A  R      +    PE  R    +EK   + ++ + I
Sbjct: 312 TRHFRQHQQGKETSTNSIASIFAWTRGVIQRGKLDDTPEVVRFGELLEKATVDTVQVDGI 371

Query: 345 KTPDLG 350
            T DL 
Sbjct: 372 MTKDLA 377

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 79/314 (25%), Positives = 132/314 (42%), Gaps = 55/314 (17%)

Query: 25  IPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDL------QAGWQTFLDTGKAL------ 72
           + GD + + +  + R+ L  I P   VD KY DL      +   Q  +D+ KA       
Sbjct: 14  MDGDEMTRIIWHLIREKL--IYPYLDVDLKYFDLSIENRDKTDDQVTVDSAKATLKYGVA 71

Query: 73  -------PDDT-VEQ-------------LRNNCQGALFGA---VQSPTTKVQGYSSPIVA 108
                  PD++ VE+             +RN   G +F     +      V+ +  PI+ 
Sbjct: 72  VKCATITPDESRVEEFHLKKMWPSPNGTIRNILDGTVFREPIIIPKIPRLVRHWEKPIII 131

Query: 109 LRKALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKR 168
            R A G     +    V    +  + L+   ++T    I ++    D + G  +A    R
Sbjct: 132 GRHAFG--DQYKATDVVIPEEEGKLKLIFQPKDTNKPAIATDVFEFDGDGGVALAMYNTR 189

Query: 169 ISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFA 228
            S    +  A  + E+AL+R        L  T K+ VL + DG F++I + +Y+S+ K  
Sbjct: 190 KS---IKGFARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQ 241

Query: 229 ----NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVG 284
                + Y  +++D MV ++ K    F +I   N  GD+ SD  A   GSLG++ S+ V 
Sbjct: 242 FDEIGILYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVA 300

Query: 285 PN--IVIGEPCHGS 296
           P+      E  HG+
Sbjct: 301 PDGKTFESEAAHGT 314

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 97/207 (46%), Gaps = 25/207 (12%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGT--GDRPVDLVI-ARENTEDLYIKSERTYID 155
           V  +  PI+  R A G        K+ D    G+  + LV  + +  ED+ +K      D
Sbjct: 121 VPQWEKPIIIGRHAFG-----DQYKATDVVIPGEGELKLVFKSSDGGEDIDLK----VFD 171

Query: 156 KETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFRE 215
               G VA A+   +E  T   A  + E+AL+R        L  T K+ +L + DG F++
Sbjct: 172 FPKHGGVAMAMYNTTESIT-GFAKASFELALER-----KLPLYSTTKNTILKRYDGKFKD 225

Query: 216 ICKSVYQSN--KKFA--NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAAL 271
           I +S+Y S+   KF    + Y  +++D MV ++ K    + +I   N  GD+ SD  A  
Sbjct: 226 IFESMYASDYQDKFEVIGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQG 284

Query: 272 VGSLGVVPSVNVGPN--IVIGEPCHGS 296
            GSLG++ SV V P+      E  HG+
Sbjct: 285 FGSLGLMSSVLVTPDGKTFESEAAHGT 311

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 96/211 (45%), Gaps = 26/211 (12%)

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICK 218
           G  VA A+    E + R  A+ + ++AL +        L ++ K+ +L + DG F++I +
Sbjct: 190 GSGVALAMYNTDE-SIRGFAHSSFKLALTK-----KLNLFLSTKNTILKKYDGRFKDIFQ 243

Query: 219 SVY--QSNKKFAN--VQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
            ++  +   KFAN  + Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 244 EIFDMEYKTKFANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 302

Query: 275 LGVVPSVNVGPN--IVIGEPCHGS----------APDIVGQGIANPIATIRSAALLLEFL 322
           LG++ S+ V P+      E  HG+            +     IA+  A  R  A   E  
Sbjct: 303 LGLMTSILVTPDGKTFESEAAHGTVTRHYRKFQKGEETSTNSIASIFAWSRGLAKRGELD 362

Query: 323 GLPEAARH---IEKVVDENIRENKIKTPDLG 350
           G P+  R    +E      ++++ I T DL 
Sbjct: 363 GTPDVVRFANLLEAATLNTVQQDGIMTKDLA 393

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 70/143 (48%), Gaps = 13/143 (9%)

Query: 160 GRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKS 219
           G VA  +   +E  T + A  + E AL+R        L  T K+ +L Q DG F++I + 
Sbjct: 182 GGVAMTMYNTTESIT-DFAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFEE 235

Query: 220 VY----QSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSL 275
           +Y    +   K  N+ Y  +++D MV ++ K    F +I   N  GD+ SD  A   GSL
Sbjct: 236 MYAKEYEDKFKVLNIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSL 294

Query: 276 GVVPSVNVGPN--IVIGEPCHGS 296
           G++ SV + P+      E  HG+
Sbjct: 295 GLMTSVLLTPDGSSFESEAAHGT 317

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 105/244 (43%), Gaps = 31/244 (12%)

Query: 131 RPVDLVIARENTEDLYIKSERT-----YIDKETGGRVAEAIKRISEHATRNIANIALEIA 185
           R  D++I  +    L  +SE+        +   GG +A  +    E +  + A  +  +A
Sbjct: 140 RATDVIIPSDGILKLTFESEKNGFEIPVFEYPKGGGIAMVMYNTRE-SIESFARASFTMA 198

Query: 186 LQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFA----NVQYNEQIVDSMV 241
           ++R        L  T K+ +L Q DG F++I K+VY++  K       + Y  +++D MV
Sbjct: 199 IER-----KLPLYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEELGIWYEHRLIDDMV 253

Query: 242 YRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIGEPCHGSAPD 299
            ++ K    F +I   N  GD+ SD  A   GSLG++ S  +  +      E  HG+   
Sbjct: 254 AQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGKTFESEAAHGTVTR 312

Query: 300 IVGQ----------GIANPIATIRSAALLLEFLGLPEAARH---IEKVVDENIRENKIKT 346
              Q           IA+  A  R      +    PE  R    +E++V E ++++ I T
Sbjct: 313 HYRQHQQGKETSTNSIASIFAWTRGIIHRGKVDDTPEVRRFGELLEELVVETVQDDNIMT 372

Query: 347 PDLG 350
            DL 
Sbjct: 373 KDLA 376

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 85/179 (47%), Gaps = 20/179 (11%)

Query: 131 RPVDLVIARENTEDLYIKSERTYIDKE-------TGGRVAEAIKRISEHATRNIANIALE 183
           +  D VI  E    L  KS+    D++        GG VA A+   +E +    A  + E
Sbjct: 141 KATDTVIPDEGELKLVFKSKDGKHDQDLQVFEFPKGGGVAMAMYNTTE-SIEGFAKASFE 199

Query: 184 IALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQ----SNKKFANVQYNEQIVDS 239
           +AL+R        L  T K+ +L + DG F++I +++Y+    S  +   + Y  +++D 
Sbjct: 200 LALER-----KQPLYSTTKNTILKKYDGKFKDIFEAMYEKEYRSQFEKLGIWYEHRLIDD 254

Query: 240 MVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIGEPCHGS 296
           MV ++ K    + +I   N  GD+ SD  A   GSLG++ SV V P+      E  HG+
Sbjct: 255 MVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 312

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 123/273 (45%), Gaps = 35/273 (12%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGT--GDRPVDLVIARENTEDLYIKSERTYIDK 156
           V+ +  PI+     +G +A+    K+ D    G   ++LV   ++ +    +    Y  K
Sbjct: 142 VKNWEKPII-----IGRHAHADQYKATDTLIPGPGTLELVYKSKDNDPSKTQVLNVYDYK 196

Query: 157 ETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREI 216
            +G  VA A+    E  T   A+ + ++A+ +        L ++ K+ +L + DG F+++
Sbjct: 197 SSG--VALAMYNTDESIT-GFAHSSFKLAIDK-----KLDLFLSTKNTILKKYDGRFKDV 248

Query: 217 CKSVYQSN--KKFA--NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALV 272
            + V+ S    KF   N++Y  +++D MV ++ K    + ++   N  GD+ SD  A   
Sbjct: 249 FQEVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKGGY-IMALKNYDGDVQSDIVAQGF 307

Query: 273 GSLGVVPSVNVGPN--IVIGEPCHGSAPDIVGQ----------GIANPIATIRSAALLLE 320
           GSLG++ S+ V P+      E  HG+      Q           IA+  A  R  A   E
Sbjct: 308 GSLGLMTSILVTPDGKTFESEAAHGTVTRHYRQHQQGKQTSTNSIASIFAWSRGLAKRGE 367

Query: 321 FLGLPEA---ARHIEKVVDENIRENKIKTPDLG 350
               P+    A+ +EK   + ++E+ I T DL 
Sbjct: 368 LDNTPDVMKFAQTLEKATLDTVQEDGIMTKDLA 400

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 112/271 (41%), Gaps = 31/271 (11%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKET 158
           V G+  PI+     +G +A+    ++ D     P  L +           +   ++    
Sbjct: 129 VPGWQQPII-----IGRHAHGDQYRATDTLVPGPGKLELVFRPAGRGAAAARTLHVHDFE 183

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICK 218
           G  VA A+    E + R  A+ +  +AL +        L +  K+ +L Q DG F+++ +
Sbjct: 184 GAGVALAMYNTDE-SIRGFAHASFRLALSK-----QLNLFLATKNTILKQYDGRFKDLFQ 237

Query: 219 SVYQSNKK----FANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
            +Y +  +     A + Y  +++D MV ++ K    F V+   N  GD+ SD  A   GS
Sbjct: 238 QLYDAEYREAFERAGISYEHRLIDDMVAQMIKSRGGF-VLALKNYDGDVQSDIVAQGFGS 296

Query: 275 LGVVPSVNVGP--NIVIGEPCHGS----------APDIVGQGIANPIATIRSAALLLEFL 322
           LG++ SV + P  N    E  HG+            +     IA+  A  R  A   +  
Sbjct: 297 LGLMSSVLITPDGNAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLARRADLD 356

Query: 323 GLP---EAARHIEKVVDENIRENKIKTPDLG 350
           G P   + A  +E      ++++ I T DL 
Sbjct: 357 GTPAVADFAHALEGATLRTVQDDAIMTKDLA 387

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 87/200 (43%), Gaps = 25/200 (12%)

Query: 170 SEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFA- 228
           +E + R  A+ +  +AL +        L ++ K+ +L Q DG F+++ + +YQ+  K   
Sbjct: 202 TEESIRGFAHASFRLALAK-----QLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEF 256

Query: 229 ---NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP 285
               + Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLG++ SV V P
Sbjct: 257 ERLGIYYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 315

Query: 286 N--IVIGEPCHGSAPDIVGQ----------GIANPIATIRSAALLLEFLGLPEA---ARH 330
           +      E  HG+      Q           IA+  A  R  A   E    P+    A  
Sbjct: 316 DGKTFESEAAHGTVTRHFRQHQAGKETSTNSIASIFAWTRGLAKRGELDNTPDVVNFAHA 375

Query: 331 IEKVVDENIRENKIKTPDLG 350
           +E      ++ + I T DL 
Sbjct: 376 LEAATTNTVQLDGIMTKDLA 395

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 99/226 (43%), Gaps = 30/226 (13%)

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICK 218
           GG V  A+    E +    A+ + ++AL +        L +  K+ +L + DG F++I +
Sbjct: 187 GGGVGMAMYNTDE-SIEGFAHSSFQVALNK-----KLNLFLATKNTILKKYDGRFKDIFQ 240

Query: 219 SVY--QSNKKFAN--VQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
            +Y  Q   KF    + Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 241 QIYNGQYKAKFEQLGITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 299

Query: 275 LGVVPSVNVGPN--IVIGEPCHGS----------APDIVGQGIANPIATIRSAALLLEFL 322
           LG++ S+ V P+      E  HG+            +     IA+  A  R  A   E  
Sbjct: 300 LGLMTSILVSPDGKTFESEAAHGTVTRHFRRHQMGEETSTNSIASIFAWSRGLAKRGELD 359

Query: 323 GLPEA---ARHIEKVVDENIRENKIKTPDL----GGNSTGEQVAND 361
           G  +    A  +E    ++++E+ I T DL    G N+  + V  D
Sbjct: 360 GTKDVIAFANKLEAATLDSVQEDGIMTKDLALASGKNNRSDYVNTD 405

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 101/213 (47%), Gaps = 36/213 (16%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVD----GTGDRPVDLVI--AREN---TEDLYIKS 149
           + G+  PI+     +G +A+    K+ D    G G   ++ +   A+EN   T D+Y   
Sbjct: 137 IPGWEKPII-----IGRHAHADQYKATDTLIPGPGKLQLNFIPSNAQENSPITLDVY--- 188

Query: 150 ERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQS 209
                    G  VA A+    E +    A+ + ++A+ +        L ++ K+ +L + 
Sbjct: 189 ------DYKGSGVALAMYNTDE-SIEGFAHSSFKLAIDK-----KLNLFLSTKNTILKKY 236

Query: 210 DGLFREICKSVYQSNKKFA----NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILS 265
           DG F++I +S+Y+++ K      N+ Y  +++D MV ++ K    F ++   N  GD+ S
Sbjct: 237 DGRFKDIFQSIYETHYKAKFQQLNINYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQS 295

Query: 266 DGAAALVGSLGVVPSVNVGPN--IVIGEPCHGS 296
           D  A   GSLG++ S+ V P+      E  HG+
Sbjct: 296 DIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 64/126 (50%), Gaps = 12/126 (9%)

Query: 177 IANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSN--KKFA--NVQY 232
            A  + E AL+R        L  T K+ +L + DG F++I +S+Y+    +KF   N+ Y
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKALNIWY 257

Query: 233 NEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIG 290
             +++D MV ++ K    F +I   N  GD+ SD  A   GSLG++ SV +  +      
Sbjct: 258 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFES 316

Query: 291 EPCHGS 296
           E  HG+
Sbjct: 317 EAAHGT 322

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 86/199 (43%), Gaps = 25/199 (12%)

Query: 173 ATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK--FAN- 229
           A    A  + ++AL+R        L  T K+ +L + DG F+ + + +Y+   K  F + 
Sbjct: 190 AIEGFARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDL 244

Query: 230 -VQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN-- 286
            + Y  +++D MV ++ K    F +I   N  GD+ SD  A   GSLG++ SV V P+  
Sbjct: 245 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGK 303

Query: 287 IVIGEPCHGSAPDIVGQ----------GIANPIATIRSAALLLEFLGLPEAARH---IEK 333
               E  HG+      Q           IA+  A  R      +    PE  +    +EK
Sbjct: 304 TFESEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGIIQRGKLDDTPEVVKFGELLEK 363

Query: 334 VVDENIRENKIKTPDLGGN 352
              E ++ + I T DL  N
Sbjct: 364 ATIETVQIDGIMTKDLALN 382

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 115/271 (42%), Gaps = 33/271 (12%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKET 158
           V G+  PI+     +G +A+    K+ D    +P  L +     +     +   Y  K  
Sbjct: 133 VPGWEKPII-----IGRHAHADQYKATDTLVAKPGKLELVHRPEDGSEPTTLEVYDYKGP 187

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICK 218
           G  VA A+    E + R   + + ++AL +        L ++ K+ +L + DG F++I +
Sbjct: 188 G--VALAMYNTDE-SIRGFGHASFKLALDK-----KLNLYLSTKNTILKKYDGRFKDIFQ 239

Query: 219 SVYQSNKKF----ANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
            +Y +  K     A + Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 240 ELYDTQYKAEFEKAGIFYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGS 298

Query: 275 LGVVPSVNVGPN--IVIGEPCHGSAPDIVGQ----------GIANPIATIRSAALLLEFL 322
           LG++ SV + P+      E  HG+      Q           IA+  A  R  A   E  
Sbjct: 299 LGLMTSVLITPDGKTFESEAAHGTVTRHYRQHQQGRETSTNSIASIFAWSRGLAKRGELD 358

Query: 323 GLPEAARH---IEKVVDENIRENKIKTPDLG 350
             PE  +    +E    + ++++ I T DL 
Sbjct: 359 STPEVTKFANLLESATLDTVQKDGIMTKDLA 389

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 85/181 (46%), Gaps = 24/181 (13%)

Query: 131 RPVDLVIARENTEDLYIKSE--RTYID-------KETGGRVAEAIKRISEHATRNIANIA 181
           R  D+VI  E    L  KS+  +T ID       KE G  VA  +   +E + R  A  +
Sbjct: 140 RATDVVIPDEGEVRLVYKSKDGKTDIDIPVYNFPKEGG--VAMMMYNTTE-SIRGFARAS 196

Query: 182 LEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK----FANVQYNEQIV 237
             +AL+         L  T K+ +L + DG F++  +S+Y++  K       + Y  +++
Sbjct: 197 FNMALEH-----EMPLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAKGIWYEHRLI 251

Query: 238 DSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIGEPCHG 295
           D MV ++ K    F +I   N  GD+ SD  A   GSLG++ SV + P+      E  HG
Sbjct: 252 DDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGKTFESEAAHG 310

Query: 296 S 296
           +
Sbjct: 311 T 311

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (48%), Gaps = 13/141 (9%)

Query: 162 VAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVY 221
           VA A+    E  T   A  + E+A++R        L  T K+ +L + DG F++I + +Y
Sbjct: 179 VALAMYNTDESIT-GFARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMY 232

Query: 222 QSNKK--FAN--VQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGV 277
             + K  F    + Y  +++D MV ++ K    F +I   N  GD+ SD  A   GSLG+
Sbjct: 233 DEDYKGKFKELGISYEHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGL 291

Query: 278 VPSVNVGPN--IVIGEPCHGS 296
           + S  + P+  I   E  HG+
Sbjct: 292 MTSTLLTPDGKIFESEAAHGT 312

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 68/133 (51%), Gaps = 12/133 (9%)

Query: 170 SEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQS--NKKF 227
           ++ +    A  + ++A++R        L  T K+ +L + DG+F++I + +Y+    +KF
Sbjct: 188 TKESIEGFAKASFQLAVER-----KMPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKF 242

Query: 228 AN--VQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP 285
               + Y  +++D MV ++ K    + +I   N  GD+ SD  A   GSLG++ SV + P
Sbjct: 243 EELGIWYEHRLIDDMVAQMLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITP 301

Query: 286 N--IVIGEPCHGS 296
           +      E  HG+
Sbjct: 302 DGKTFESEAAHGT 314

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 99/226 (43%), Gaps = 21/226 (9%)

Query: 80  LRNNCQGALFG---AVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLV 136
           +RN  QG +F     +      +  +  PI+  R A G        K+ D     P  + 
Sbjct: 101 IRNILQGTVFREPIVIPCVPRLIPNWDKPIIIGRHAFG-----DQYKATDLKIPGPGKMS 155

Query: 137 IARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHAT 196
           +  +   +   K E    D    G V  A+   +  +  + A  + E+AL+R        
Sbjct: 156 LVFQPKHNPGEKKEWEVFDFPKNGGVTMAMYNTT-GSIESFAKSSFELALKR-----KLP 209

Query: 197 LTVTHKSNVLSQSDGLFREICKSVYQSN--KKFAN--VQYNEQIVDSMVYRLFKEPQCFD 252
           L    K+ +L + DGLF++I + +Y+ +   KF    + +  +++D MV ++ K    F 
Sbjct: 210 LFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEELGITFEHRLIDDMVAQMLKSNGGF- 268

Query: 253 VIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIGEPCHGS 296
           ++   N  GD+ SD  A   GSLG++ S+ V P+  +   E  HG+
Sbjct: 269 ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDSVFESEAAHGT 314

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 66/126 (52%), Gaps = 12/126 (9%)

Query: 177 IANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSN--KKFAN--VQY 232
            A  + E+A++R        L  T K+ +L + DG F+++ +++Y  N  +KF +  + Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESLGIWY 246

Query: 233 NEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIG 290
             +++D MV ++ K    + +I   N  GD+ SD  A   GSLG++ S+ + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGKTFES 305

Query: 291 EPCHGS 296
           E  HG+
Sbjct: 306 EAAHGT 311

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 90/200 (45%), Gaps = 25/200 (12%)

Query: 170 SEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDG----LFREICKSVYQSNK 225
           ++ + R  A+ + ++A+ +        L ++ K+ +L + DG    +F+EI +S Y+S  
Sbjct: 196 TDESIRGFAHSSFKLAINK-----KLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQF 250

Query: 226 KFANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP 285
           +   + Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLG++ SV V P
Sbjct: 251 ENLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 309

Query: 286 N--IVIGEPCHGSAPDIVGQ----------GIANPIATIRSAALLLEFLGLPEA---ARH 330
           +      E  HG+      Q           IA+  A  R  A   E    P+    A  
Sbjct: 310 DGKTFESEAAHGTVTRHYRQYEQGKETSTNSIASIFAWSRGLAKRGELDSTPDVIKFANL 369

Query: 331 IEKVVDENIRENKIKTPDLG 350
           +E      ++++ I T DL 
Sbjct: 370 LESATLNTVQQDGIMTKDLA 389

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 86/180 (47%), Gaps = 22/180 (12%)

Query: 131 RPVDLVIARENTEDLYIKSE--------RTYIDKETGGRVAEAIKRISEHATRNIANIAL 182
           +  D+V+  E    L  KS+        + Y   E GG VA  +   ++ + +  A  + 
Sbjct: 140 KATDVVVPEEGELRLVYKSKSGKHDLDLKVYDYPENGG-VAMMMYNTTD-SIKGFAKASF 197

Query: 183 EIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQS--NKKFA--NVQYNEQIVD 238
           E+AL+R        L  T K+ +L + DG F+++ +++Y     +KF    + Y  +++D
Sbjct: 198 ELALER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEALGIWYEHRLID 252

Query: 239 SMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIGEPCHGS 296
            MV ++ K    + +I   N  GD+ SD  A   GSLG++ S+ + P+      E  HG+
Sbjct: 253 DMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGKTFESEAAHGT 311

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 71/144 (49%), Gaps = 13/144 (9%)

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICK 218
           G  VA A+    E +    A+ + ++A+ +        L ++ K+ +L + DG F++I +
Sbjct: 192 GSGVAMAMYNTDE-SIEGFAHSSFKLAIDK-----KLNLFLSTKNTILKKYDGRFKDIFQ 245

Query: 219 SVY--QSNKKFAN--VQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
            VY  Q   KF    + Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 246 EVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 275 LGVVPSVNVGPN--IVIGEPCHGS 296
           LG++ S+ V P+      E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 67/133 (50%), Gaps = 12/133 (9%)

Query: 170 SEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK--F 227
           ++ + R  A+ + ++AL +        L ++ K+ +L   DG F++I + +Y +  K  F
Sbjct: 198 TDESIRGFAHASFKLALTK-----KLNLFLSTKNTILKTYDGRFKDIFQELYDTQYKTEF 252

Query: 228 AN--VQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP 285
            N  + Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLG++ S+   P
Sbjct: 253 ENHGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILATP 311

Query: 286 N--IVIGEPCHGS 296
           +      E  HG+
Sbjct: 312 DGKTFESEAAHGT 324

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 66/126 (52%), Gaps = 12/126 (9%)

Query: 177 IANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSN--KKFAN--VQY 232
            A  + E+A++R        L  T K+ +L + DG F+++ +++Y  +  +KF +  + Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESLGIWY 246

Query: 233 NEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIG 290
             +++D MV ++ K    + +I   N  GD+ SD  A   GSLG++ SV + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 291 EPCHGS 296
           E  HG+
Sbjct: 306 EAAHGT 311

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 71/144 (49%), Gaps = 13/144 (9%)

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICK 218
           G  VA A+    E +    A+ + ++A+ +        L ++ K+ +L + DG F++I +
Sbjct: 192 GSGVAMAMYNTDE-SIEGFAHSSFKLAIDK-----KLNLFLSTKNTILKKYDGRFKDIFQ 245

Query: 219 SVY--QSNKKFA--NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
            VY  Q   KF    + Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 246 KVYEAQYKSKFEALGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 275 LGVVPSVNVGPN--IVIGEPCHGS 296
           LG++ S+ V P+      E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 72/144 (50%), Gaps = 13/144 (9%)

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICK 218
           G  VA A+    E +    A+ + ++A+ +        L ++ K+ +L + DG F++I +
Sbjct: 193 GSGVAMAMYNTDE-SIEGFAHSSFKLAIDK-----KLNLFLSTKNTILKKYDGRFKDIFQ 246

Query: 219 SVYQS--NKKFAN--VQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
            VY++    KF    + Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 247 EVYEAEYKSKFEKLGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 305

Query: 275 LGVVPSVNVGPN--IVIGEPCHGS 296
           LG++ S+ V P+      E  HG+
Sbjct: 306 LGLMTSILVTPDGKTFESEAAHGT 329

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 65/126 (51%), Gaps = 12/126 (9%)

Query: 177 IANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSN--KKFAN--VQY 232
            A  + E+A++R        L  T K+ +L + DG F+++ + +Y  +  +KF +  + Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 233 NEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIG 290
             +++D MV ++ K    + +I   N  GD+ SD  A   GSLG++ SV + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 291 EPCHGS 296
           E  HG+
Sbjct: 306 EAAHGT 311

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 108/260 (41%), Gaps = 49/260 (18%)

Query: 54  KYIDLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFGA---VQSPTTKVQGYSSPIVALR 110
           K  +L+  W++        P+ T+   RN   G +F     + S    V  +  PI+  R
Sbjct: 84  KEFNLKKMWKS--------PNGTI---RNILDGTVFREPIIIPSIPRLVPHWEKPIIIGR 132

Query: 111 KALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSE--------RTYIDKETGGRV 162
            A G                R  D+ I R     L   SE        + Y   ++GG +
Sbjct: 133 HAFG-------------DQYRATDIKINRAGKLRLQFNSEDGKENIDLKVYDFPDSGG-I 178

Query: 163 AEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQ 222
           A A+   + ++    A  + E+AL+R        L  T K+ +L   D  F++I   ++ 
Sbjct: 179 AMAMFN-TNNSIEGFAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFN 232

Query: 223 SN--KKFA--NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVV 278
               +KF    ++Y  +++D MV ++ K    F +I   N  GD+ SD  A   GSLG++
Sbjct: 233 EKYREKFQALGIKYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLM 291

Query: 279 PSVNVGPN--IVIGEPCHGS 296
            S+ V P+      E  HG+
Sbjct: 292 TSILVTPDGKTFESEAAHGT 311

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 72/144 (50%), Gaps = 13/144 (9%)

Query: 159 GGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICK 218
           G  VA A+    E +    A+ + ++A+ +        L ++ K+ +L + DG F++I +
Sbjct: 193 GSGVAMAMYNTDE-SIEGFAHSSFKMAIDK-----KLNLFLSTKNTILKKYDGRFKDIFQ 246

Query: 219 SVY--QSNKKFAN--VQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGS 274
           ++Y  Q   KF    + Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 247 NIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGS 305

Query: 275 LGVVPSVNVGPN--IVIGEPCHGS 296
           LG++ S+ V P+      E  HG+
Sbjct: 306 LGLMTSILVTPDGKTFESEAAHGT 329

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 71/146 (48%), Gaps = 14/146 (9%)

Query: 157 ETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREI 216
           E+GG VA A+   ++ + +  A  + E+AL+R        L  T K+ +L   D  F++I
Sbjct: 174 ESGG-VAMAMFNTND-SIKGFAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQI 226

Query: 217 CKSVYQSNKK----FANVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALV 272
              ++ +  K       + Y  +++D MV ++ K    F +I   N  GD+ SD  A   
Sbjct: 227 FDKLFDAEYKEQFQALGITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGF 285

Query: 273 GSLGVVPSVNVGPN--IVIGEPCHGS 296
           GSLG++ S+ + P+      E  HG+
Sbjct: 286 GSLGLMTSILITPDGKTFESEAAHGT 311

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 64/130 (49%), Gaps = 12/130 (9%)

Query: 173 ATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVY--QSNKKFA-- 228
           + +  A  + E+AL+R        L  T K+ +L   D  F++I  +++  +  +KF   
Sbjct: 188 SIKGFAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQAL 242

Query: 229 NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN-- 286
            + Y  +++D MV ++ K    F +I   N  GD+ SD  A   GSLG++ S+ + P+  
Sbjct: 243 KITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGK 301

Query: 287 IVIGEPCHGS 296
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 68/133 (51%), Gaps = 12/133 (9%)

Query: 170 SEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQS--NKKF 227
           ++ + R  A  +  +A+ +     +  L +  K+ +L + DG F++I + +Y++   K+F
Sbjct: 200 TDDSIRGFAYSSFNLAVNK-----NMNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEF 254

Query: 228 A--NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGP 285
              N+ Y  +++D MV ++ K    + ++   N  GD+ SD  A   GSLG++ S+   P
Sbjct: 255 ERLNITYEHRLIDDMVAQMIKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILASP 313

Query: 286 N--IVIGEPCHGS 296
           +      E  HG+
Sbjct: 314 DGKTFESEAAHGT 326

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 64/130 (49%), Gaps = 12/130 (9%)

Query: 173 ATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK----FA 228
           + +  A+ + E AL    EKG   L  T K+ +L + DG +++I   +Y+ + K      
Sbjct: 193 SIKGFAHSSFEFAL----EKG-LPLYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAK 247

Query: 229 NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN-- 286
            + Y  +++D MV ++ K    F VI   N  GD+ SD  A   GSLG++ S+ +  +  
Sbjct: 248 GIWYEHRLIDDMVAQMLKSKGGF-VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGK 306

Query: 287 IVIGEPCHGS 296
               E  HG+
Sbjct: 307 TFESEAAHGT 316

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 93/205 (45%), Gaps = 18/205 (8%)

Query: 99  VQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVDLVIA-RENTEDLYIKSERTYIDKE 157
           V  +  PI+  R A   Y +      ++   ++ + L+I  + + ED  I +  ++ +  
Sbjct: 121 VSNWEKPIIIGRHA---YGDQYKATDLEIPPNKDIKLLIQDKADKEDSKIINVFSFPNDG 177

Query: 158 TGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREIC 217
           TGG     I  +  +   +I   A    +  LK K    L +  K+ +L + DG F+ I 
Sbjct: 178 TGG-----IAMVMYNTVDSIKGFAKASFIMALKRK--LPLFLATKNTILKKYDGRFKSIF 230

Query: 218 KSVYQS--NKKFANV--QYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVG 273
             +YQ+   +KF  +   Y  +++D MV ++ K    F +I   N  GD+ SD  A   G
Sbjct: 231 DDMYQNEFKEKFEKLGLTYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFG 289

Query: 274 SLGVVPSVNVGPN--IVIGEPCHGS 296
           SLG++ S  + P+      E  HG+
Sbjct: 290 SLGLMTSQLITPDGKTFQSEAAHGT 314

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 12/126 (9%)

Query: 177 IANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQS--NKKFA--NVQY 232
            A  + E+AL+R        L  T K+ +L   D  F+EI   ++ +   +KF    + Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 233 NEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIG 290
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLG++ S+ + P+      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 291 EPCHGS 296
           E  HG+
Sbjct: 306 EAAHGT 311

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (50%), Gaps = 7/106 (6%)

Query: 197 LTVTHKSNVLSQSDGLFREICKSVYQSNKK--FAN--VQYNEQIVDSMVYRLFKEPQCFD 252
           L  T K+ +L + DG F++I   +Y +  K  F    + Y  +++D MV ++ K    F 
Sbjct: 211 LYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFYEHRLIDDMVAQMLKSKGGF- 269

Query: 253 VIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN--IVIGEPCHGS 296
           +I   N  GD+ SD  A   GSLG++ SV + P+      E  HG+
Sbjct: 270 IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGT 315

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 107/261 (40%), Gaps = 50/261 (19%)

Query: 54  KYIDLQAGWQTFLDTGKALPDDTVEQLRNNCQGALFG---AVQSPTTKVQGYSSPIVALR 110
           K  DL+  W++        P+ T+   RN   G LF     + +    V  +  PI+  R
Sbjct: 91  KEFDLKKMWKS--------PNGTI---RNVLGGTLFREPIVIDNIPRLVPNWEKPIIIGR 139

Query: 111 KALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSER---------TYIDKETGGR 161
            A G     +             DLVI  +    +  KS +          +   E GG 
Sbjct: 140 HAFGDQYKAK-------------DLVIPHDGQLKIVFKSNKGPDQDIDLNVFQFPECGG- 185

Query: 162 VAEAIKRISEHATRNIANIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVY 221
           VA  +    E +    A  + ++AL+R        L  T K+ +L + DG F++I +++Y
Sbjct: 186 VAMMMYNTIE-SIEGFALSSFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMY 239

Query: 222 QSNKKFA----NVQYNEQIVDSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGV 277
           +   +       + Y  +++D MV ++ K    F +I   N  GD+ SD  A   GSLG+
Sbjct: 240 EEQFREQFEELGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGL 298

Query: 278 VPSVNVGPN--IVIGEPCHGS 296
           + SV +  +      E  HG+
Sbjct: 299 MTSVLISSDGKSFESEAAHGT 319

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 41.6 bits (96), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 31/50 (62%)

Query: 317 LLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366
           L+L  LGL E+A  I K V E I E K  T D+GG+S+     N+I++++
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>CAGL0E06314g Chr5 complement(634890..636785) [1896 bp, 631 aa] {ON}
           similar to uniprot|P36056 Saccharomyces cerevisiae
           YKL155c CAP1
          Length = 631

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 51/118 (43%), Gaps = 22/118 (18%)

Query: 126 DGTGDRPVDLV-IARENTEDL------YIKSERTYIDKETGGRVAEAIKRISEHATRN-- 176
           D  GDR VDL    R N  D       YI  ERT  DK T     E IKR  E++  N  
Sbjct: 425 DRKGDRFVDLSGSGRRNGNDYEIVNFCYIIMERTSTDKST----LEKIKRARENSKNNHT 480

Query: 177 IANIALE--------IALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK 226
            A+  LE        I  + +K KGH TL V   + ++ +   + +   K +Y   +K
Sbjct: 481 AADFNLECSSVTWPRIITEPVKRKGHVTLDVVTATGLIEKW-TIPKSFSKEIYHDARK 537

>CAGL0D01034g Chr4 complement(121908..122993) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P41940 Saccharomyces
           cerevisiae YDL055c PSA1 mannose-1-phosphate
           guanyltransferase
          Length = 361

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGE 291
           N+ G+++ D +A +  S  V P V +GPN+ IGE
Sbjct: 250 NIVGNVMVDPSAKIAASAKVGPDVVIGPNVTIGE 283

>AFR599W Chr6 (1516363..1517448) [1086 bp, 361 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL055C (PSA1)
          Length = 361

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGE 291
           N+ G+++ D +A + GS  + P V +GPN+ IGE
Sbjct: 250 NIVGNVIIDPSAKISGSAKLGPDVVIGPNVTIGE 283

>CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some
           similarities with uniprot|Q05854 Saccharomyces
           cerevisiae YLR278c
          Length = 1423

 Score = 32.3 bits (72), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 28/56 (50%)

Query: 79  QLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDRPVD 134
           Q  NN  G    A+ +PT  +   +S I+ L    G ++N+ P++S   +   PVD
Sbjct: 381 QAGNNSLGQPSSAISTPTASIATPNSGILPLPPVQGNHSNVYPIRSPYTSNGTPVD 436

>TPHA0A01710 Chr1 (347874..348728) [855 bp, 284 aa] {ON} Anc_8.276
           YLR093C
          Length = 284

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 40/97 (41%), Gaps = 7/97 (7%)

Query: 214 REICKSVYQSNKKFANVQYNEQIVDSMVYRLFKE----PQCFDVIVAPNLYGDILSDGAA 269
           R I    YQ N   ANV Y   I D  V   F+E    P   +++  PN++  +++D   
Sbjct: 16  RAISSCFYQDN---ANVNYGSIIHDDNVDNNFREPAESPSAVELMATPNMFHKLINDVVV 72

Query: 270 ALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIA 306
             V  +       V  +I+ G  C+ +  D +   I 
Sbjct: 73  PNVVPVLGNKVTKVSMHILDGYDCYYTTSDTLNGSIT 109

>TBLA0A08130 Chr1 complement(2009133..2010218) [1086 bp, 361 aa]
           {ON} Anc_4.231 YDL055C
          Length = 361

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGE 291
           N+ G +L D  A +  +  + P+V +GPN++IG+
Sbjct: 250 NVVGSVLVDSTAKIASTAKIGPNVTIGPNVIIGD 283

>Ecym_2782 Chr2 (1519759..1520844) [1086 bp, 361 aa] {ON} similar to
           Ashbya gossypii AFR599W
          Length = 361

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 24/34 (70%)

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGE 291
           N+ G+++ D +A++  +  + P V VGPN++IG+
Sbjct: 250 NIVGNVMIDPSASISSTAKIGPDVVVGPNVIIGD 283

>TPHA0B00890 Chr2 complement(207124..208209) [1086 bp, 361 aa] {ON}
           Anc_4.231 YDL055C
          Length = 361

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 23/34 (67%)

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGE 291
           N+ G+++ D +A +  S  + P+V +GPN VIG+
Sbjct: 250 NIVGNVIVDPSAKISPSAKIGPNVTIGPNCVIGD 283

>ZYRO0E06666g Chr5 complement(501139..504231) [3093 bp, 1030 aa]
           {ON} similar to uniprot|P35729 Saccharomyces cerevisiae
           YKL057C NUP120 Subunit of the Nup84p subcomplex of the
           nuclear pore complex (NPC) required for even
           distribution of NPCs around the nuclear envelope
           involved in establishment of a normal nucleocytoplasmic
           concentration gradient of the GTPase Gsp1p
          Length = 1030

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 49/109 (44%), Gaps = 11/109 (10%)

Query: 182 LEIALQRLKEKGH--ATLTVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYN--EQIV 237
           LE  L+ LK K    ++LT+     +L  S    ++   SVY++N    N+ YN   ++ 
Sbjct: 439 LETVLKDLKSKSDEVSSLTIYRDEIILVNS---LQKYNHSVYKTNTPLENIYYNIHSELN 495

Query: 238 DSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPN 286
           D  + R  K    F   ++     D+L D +   +G +    + N+ PN
Sbjct: 496 DDELTRYLKTLHGFSSTIS----KDVLKDVSERFIGIVSGAVAGNLSPN 540

>KLLA0E05435g Chr5 complement(488881..489966) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P41940 Saccharomyces
           cerevisiae YDL055C PSA1 GDP-mannose pyrophosphorylase
           (mannose-1-phosphate guanyltransferase) synthesizes GDP-
           mannose from GTP and mannose-1-phosphate in cell wall
           biosynthesis required for normal cell wall structure
          Length = 361

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGE 291
           N+ G++L D  A +  +  V P V +GPN+VIG+
Sbjct: 250 NIVGNVLVDPTAKISPTAKVGPDVVIGPNVVIGD 283

>TPHA0B02325 Chr2 complement(532389..533474) [1086 bp, 361 aa] {ON}
          Length = 361

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 258 NLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGE 291
           N+ G+++ D  A +  S  + P+V +GPN VIG+
Sbjct: 250 NIVGNVIVDPTAKISPSAKIGPNVTIGPNCVIGD 283

>KNAG0A03750 Chr1 (487451..489943) [2493 bp, 830 aa] {ON} Anc_8.531
           YBR202W
          Length = 830

 Score = 30.4 bits (67), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 4/96 (4%)

Query: 106 IVALRKALGLYANIRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEA 165
           I+ L +AL   A +R V  V+   D    L + R + E LY  + +T  D+    R+   
Sbjct: 695 IIRLAQAL---AKLRLVNRVE-VEDVEEALRLVRVSKESLYQDNTKTREDQNPTTRIYNL 750

Query: 166 IKRISEHATRNIANIALEIALQRLKEKGHATLTVTH 201
           IKR+S+    N   ++ +  ++ ++ +G   L + +
Sbjct: 751 IKRMSQDTLENRGTLSYDTIVKTVRSRGFTMLQLNN 786

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,267,729
Number of extensions: 1603735
Number of successful extensions: 4715
Number of sequences better than 10.0: 159
Number of HSP's gapped: 4480
Number of HSP's successfully gapped: 159
Length of query: 366
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 255
Effective length of database: 40,753,473
Effective search space: 10392135615
Effective search space used: 10392135615
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)