Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_33252.286ON49649625600.0
KLLA0E08361g2.286ON49149217550.0
ADL215W2.286ON48448517400.0
SAKL0E07678g2.286ON47748517040.0
NDAI0G006602.286ON49649916770.0
KLTH0G10362g2.286ON52948816470.0
Kwal_27.115322.286ON47948416360.0
CAGL0M06941g2.286ON49249416180.0
KAFR0H033102.286ON48848916050.0
TDEL0G021702.286ON48448815890.0
ZYRO0A01892g2.286ON46548815340.0
TPHA0C034002.286ON49449615330.0
YNL022C2.286ON49049115300.0
NCAS0G037902.286ON49249515290.0
Kpol_1003.382.286ON49649715260.0
Skud_14.3072.286ON49049315220.0
Suva_14.3252.286ON49049115200.0
KNAG0H020002.286ON49849915180.0
TBLA0B069602.286ON50850715110.0
Smik_14.3092.286ON49049115060.0
TBLA0E038502.247ON6321971732e-12
CAGL0J10032g2.247ON6192021696e-12
AFR179C8.171ON7002971696e-12
NDAI0B018308.171ON6862941697e-12
TDEL0B043908.171ON6732981688e-12
SAKL0E08624g2.247ON6112021652e-11
KAFR0J009702.247ON6102371643e-11
NCAS0B043908.171ON6712961633e-11
ZYRO0A01562g2.247ON6171971634e-11
KNAG0I018702.247ON6292371625e-11
NCAS0B056408.171ON6592921625e-11
ZYRO0G08998g8.171ON6832961625e-11
ADL254W2.247ON6031971609e-11
TPHA0C031502.247ON6082021591e-10
KLLA0F03399g2.247ON6192001581e-10
Smik_2.928.171ON6742931582e-10
TPHA0H001508.171ON6492951582e-10
YBL024W (NCL1)8.171ON6842921572e-10
Kpol_1003.152.247ON6332011572e-10
KLTH0G09460g2.247ON6372021572e-10
Ecym_32842.247ON6062021563e-10
NCAS0G030302.247ON4901971553e-10
NDAI0D010502.247ON6252021563e-10
Kwal_23.48412.247ON6272391535e-10
Kpol_1002.1098.171ON6703011536e-10
Suva_2.978.171ON6702931536e-10
TDEL0C041502.247ON6142001536e-10
Skud_14.2712.247ON6191971536e-10
CAGL0K01991g8.171ON6722901537e-10
KNAG0G015108.171ON6662921528e-10
Smik_14.2662.247ON6182191528e-10
Suva_14.2802.247ON6201971519e-10
YNL061W (NOP2)2.247ON6181971519e-10
Skud_2.818.171ON6812921511e-09
SAKL0H19448g8.171ON6912881455e-09
KLTH0H08096g8.171ON6882941456e-09
KAFR0B022208.171ON6863021447e-09
KLLA0F12562g8.171ON7042991439e-09
TBLA0A087408.171ON6863041421e-08
Ecym_23538.171ON6902961412e-08
NDAI0B029808.171ON6792981402e-08
KNAG0D020508.171ON6822961384e-08
TPHA0C028708.171ON6742951332e-07
Kwal_14.20818.171ON2721271061e-04
NDAI0J020204.217ON666247910.019
Ecym_30036.1ON31973800.25
ZYRO0F00308g6.1ON31973751.1
AGR036W3.277ON30634713.1
KLTH0F01826g1.60ON66347714.8
ZYRO0B00770g4.38ON53368704.9
TDEL0C032707.463ON135196697.1
Ecym_62054.38ON561108698.0
TDEL0F015904.38ON51268689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3325
         (496 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   990   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   680   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   674   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   660   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   650   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   639   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   634   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   627   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   622   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   616   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   595   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   595   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   593   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   593   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   592   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   590   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   590   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   589   0.0  
TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   586   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   584   0.0  
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    71   2e-12
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    70   6e-12
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    70   6e-12
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    70   7e-12
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    69   8e-12
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    68   2e-11
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    68   3e-11
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    67   3e-11
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    67   4e-11
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    67   5e-11
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    67   5e-11
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    67   5e-11
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    66   9e-11
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    66   1e-10
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    65   1e-10
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    65   2e-10
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    65   2e-10
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    65   2e-10
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    65   2e-10
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    65   2e-10
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    65   3e-10
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    64   3e-10
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    65   3e-10
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    64   5e-10
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    64   6e-10
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    64   6e-10
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    64   6e-10
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    64   6e-10
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    64   7e-10
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    63   8e-10
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    63   8e-10
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    63   9e-10
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    63   9e-10
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    63   1e-09
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    60   5e-09
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    60   6e-09
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    60   7e-09
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    60   9e-09
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    59   1e-08
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    59   2e-08
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    59   2e-08
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    58   4e-08
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    56   2e-07
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    45   1e-04
NDAI0J02020 Chr10 (495949..497949) [2001 bp, 666 aa] {ON} Anc_4....    40   0.019
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    35   0.25 
ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}...    33   1.1  
AGR036W Chr7 (774273..775193) [921 bp, 306 aa] {ON} Syntenic hom...    32   3.1  
KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} simila...    32   4.8  
ZYRO0B00770g Chr2 complement(60190..61791) [1602 bp, 533 aa] {ON...    32   4.9  
TDEL0C03270 Chr3 (581846..585901) [4056 bp, 1351 aa] {ON} Anc_7....    31   7.1  
Ecym_6205 Chr6 complement(384134..385819) [1686 bp, 561 aa] {ON}...    31   8.0  
TDEL0F01590 Chr6 complement(291940..293478) [1539 bp, 512 aa] {O...    31   9.3  

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  990 bits (2560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/496 (96%), Positives = 479/496 (96%)

Query: 1   MISKQFSAQDILKMEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKH 60
           MISKQFSAQDILKMEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKH
Sbjct: 1   MISKQFSAQDILKMEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKH 60

Query: 61  IYAIVSSCWKYKMYLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMG 120
           IYAIVSSCWKYKMYLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMG
Sbjct: 61  IYAIVSSCWKYKMYLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMG 120

Query: 121 KHPIKAFVLKRQVRLSGEFXXXXXXXXXXXXXXXXXDNDADMSPVRWIRINPFRCQGKVD 180
           KHPIKAFVLKRQVRLSGEF                 DNDADMSPVRWIRINPFRCQGKVD
Sbjct: 121 KHPIKAFVLKRQVRLSGEFKKMLVKLKVKSLSELVEDNDADMSPVRWIRINPFRCQGKVD 180

Query: 181 DVLKELRKKFPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRA 240
           DVLKELRKKFPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRA
Sbjct: 181 DVLKELRKKFPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRA 240

Query: 241 SCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEK 300
           SCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEK
Sbjct: 241 SCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEK 300

Query: 301 MVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAE 360
           MVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAE
Sbjct: 301 MVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAE 360

Query: 361 KVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEEN 420
           KVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEEN
Sbjct: 361 KVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEEN 420

Query: 421 ERVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALP 480
           ERVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALP
Sbjct: 421 ERVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALP 480

Query: 481 KEDGGIGFFAVCFERE 496
           KEDGGIGFFAVCFERE
Sbjct: 481 KEDGGIGFFAVCFERE 496

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/492 (66%), Positives = 389/492 (79%), Gaps = 10/492 (2%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           MEFYRD++WVLE++EQE SK+ R++GSLQTLVL SCKRYKLKTNP+HIYAIVSS W+Y+ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YL+KIIK SG+L DVP KKG+P+F+K TI LLVHDLLLSK+KRI MGKHPIK F+LK Q 
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDA-DMSPVRWIRINPFRCQGKVDDVLKELRKKFPK 192
           RL  E                   +D  D++PVRWIRINP   + + DDVL EL KKFP+
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDDGEDVTPVRWIRINPILVKERYDDVLAELNKKFPQ 180

Query: 193 QVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTP 252
           +V+ W QIVPGSIY DEYIPNL+G+HP DKITSHE YKRGKIIIQDRASCFPA+ILNP  
Sbjct: 181 RVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPAHILNPNS 240

Query: 253 HDVVIDACSAPGNKTTHIAAHIFPDGNA--SDVKIYAFERDAKRAEILEKMVTSAGCESC 310
            DVVIDAC+APGNKTTH+AAHIF D +     VKI+AFE+D +RA+ L+ MV +AGC   
Sbjct: 241 TDVVIDACAAPGNKTTHVAAHIFGDVDTKVDSVKIHAFEKDPERAKTLQMMVATAGCAKG 300

Query: 311 IQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEEQ 370
           ++I VGDFT+L KP++F++VTGFI+DPSCSGSGIFGR+++D  N SK      +E     
Sbjct: 301 VKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGSSNTDEDQTSV 360

Query: 371 DPKEMEQNELY------KTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVV 424
           +P E E+ EL+      K RLAKLSSFQ+QIVKHAMSFP+AKK+ YSTCSIHAEENERVV
Sbjct: 361 EPVEQEK-ELFEKEQDLKNRLAKLSSFQYQIVKHAMSFPSAKKICYSTCSIHAEENERVV 419

Query: 425 IDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALPKEDG 484
           IDLLLD  +K++GWKV KR  VIP W RRG  SEFEEVFP E+A+ELA+GCIRALPKEDG
Sbjct: 420 IDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVFPKEEAKELAEGCIRALPKEDG 479

Query: 485 GIGFFAVCFERE 496
           GIGFFAVCFER+
Sbjct: 480 GIGFFAVCFERD 491

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/485 (65%), Positives = 391/485 (80%), Gaps = 3/485 (0%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           MEFYRD+SWVLEYIEQEF++ S+++GSL +LVL+S K+YKLK++ +H+YAIV+S WKYK 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YL++II+ SGLL DVP KKGEP F ++T+ L+VHDLLLSK KRIHMGKHP+KAFVLK Q 
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDADMSPVRWIRINPFRCQGKVDDVLKELRKKFPKQ 193
           RL GE+                 D   D +PVRWIR+NPFR +G+ ++VL+EL+KKFP++
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLVQDEREDATPVRWIRLNPFRIRGQREEVLQELQKKFPRR 180

Query: 194 VDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTPH 253
           V DW ++ PGSIY DEY+  LYGVHP+DKITSHELYKRGKIIIQDRASCFPA IL P   
Sbjct: 181 VADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPAQILAPGRS 240

Query: 254 DVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCIQI 313
           DV+IDAC+APGNKTTH+AAHIFP+G A   +I+AFERD +RA+ L KM+ +AGC++ I++
Sbjct: 241 DVIIDACAAPGNKTTHVAAHIFPEGGADHAQIHAFERDPQRAKTLRKMIATAGCDNAIEV 300

Query: 314 SVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKS-KLAEKVPNEVFEEQDP 372
            VGDFT+ A+P++FK+VTGFI+DPSCSGSGIFGRQ VD   ++ K  E  P+    E++ 
Sbjct: 301 HVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGTETDPSADVPEEET 360

Query: 373 KEMEQNEL-YKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDQ 431
            E  ++ +  K RLAKLSSFQFQIVKHAMSFP+AKKL+YSTCS+HAEENERVVIDLLLD 
Sbjct: 361 FEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYSTCSVHAEENERVVIDLLLDS 420

Query: 432 NIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALPKEDGGIGFFAV 491
            +++ GWKVA R  VIPAW RRG  +EFEEVFP +QA+ELA GCIR LPKEDGGIGFFAV
Sbjct: 421 KVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFP-DQAEELAGGCIRVLPKEDGGIGFFAV 479

Query: 492 CFERE 496
           CFERE
Sbjct: 480 CFERE 484

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/485 (67%), Positives = 388/485 (80%), Gaps = 10/485 (2%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M  YRD++WV EY+EQE SK  +I+GSLQTLVL SCKRYKLKTNPKH+YAIV SCWKYK 
Sbjct: 1   MNLYRDATWVFEYVEQEESK-GKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           +LEKI+K SG+L D+P KKG+P FS TTI+LLVHDLLLSKNKRI MGKHPIK FVLK +V
Sbjct: 60  FLEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKV 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDADMSPVRWIRINPFRCQGKVDDVLKELRKKFPKQ 193
           RL  E                  D+  DM+PVRWIRINP RC GKVDDV  EL+KKFP +
Sbjct: 120 RLQAELAKLKVKLRVTNLSQLVKDDSNDMTPVRWIRINPVRCNGKVDDVKGELQKKFPTK 179

Query: 194 VDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTPH 253
           V +W++IVPG+IY DE+IPNL+GVHP+DKITSHELYKRGKIIIQDRASCFPA+ILNPTP 
Sbjct: 180 VSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAHILNPTPE 239

Query: 254 DVVIDACSAPGNKTTHIAAHIF-PDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCIQ 312
           DV+ID+CSAPGNKTTH+AAH+F P+      +I+AFE+D +RA+ L+KM+  AGC+  I+
Sbjct: 240 DVIIDSCSAPGNKTTHVAAHMFDPEFVPKQKQIHAFEKDPERAKTLQKMIQVAGCDKSIE 299

Query: 313 ISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEEQDP 372
           + VGDFT+LAKP  F  VTGFI+DPSCSGSGIFGR+ +D  N         NEV  E++ 
Sbjct: 300 VHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNK-------NEVLPEEEQ 352

Query: 373 KEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDQN 432
           ++ E ++  KTRL KLSSFQFQI+KHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLD  
Sbjct: 353 EKEEMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDDK 412

Query: 433 IKQYGWKVAKRDSVIPAWQRRGILSEFEEVFP-HEQAQELADGCIRALPKEDGGIGFFAV 491
           ++Q+GW+V KR  VIP W RRG + EF++V+   +QAQELADGCIRALPKEDGGIGFFAV
Sbjct: 413 VQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQDKQQAQELADGCIRALPKEDGGIGFFAV 472

Query: 492 CFERE 496
           CFER+
Sbjct: 473 CFERD 477

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/499 (63%), Positives = 392/499 (78%), Gaps = 20/499 (4%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M FYRD++WVLEY+EQ+ +K  RISGSLQTLVL+SC +YKLK NPKH+YA++ SCWKYK 
Sbjct: 1   MNFYRDATWVLEYVEQQEAK-GRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YLEK++K SG+L D+P KKG+P++S+ T+MLL HDLL SK+KRI MGKHPIK +VLK + 
Sbjct: 60  YLEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKS 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDA--DMSPVRWIRINPFRC-QGK-VDDVLKELRKK 189
           RL  E                  +ND+  D++PVRWIRINP RC QG+ V+ VL+EL KK
Sbjct: 120 RLHSELVRLKLKLKVKNLSEIVDNNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEELGKK 179

Query: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249
           FPK+V++W  IVPGSIY DEYIP+LYG+HP DKITSHELYK+GKIIIQDRASCFPA+ILN
Sbjct: 180 FPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASD--VKIYAFERDAKRAEILEKMVTSAGC 307
           P+  D++IDAC+APGNKTTH+A+++F D    D  V+IYAFE+D +RA+ILEKM+  AGC
Sbjct: 240 PSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHVQIYAFEKDPERAKILEKMIKVAGC 299

Query: 308 ESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLAN---------KSKL 358
              IQ++VGDFT+ A P  FKDVTGFI+DPSCSGSGIFGR+ VD  N         K K 
Sbjct: 300 SKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNNDTTDKDKK 359

Query: 359 AEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAE 418
           + +  +EV +EQ+  +  + E  KTRLAKLSSFQFQ++KHAMSFP AKK+VYSTCSIHAE
Sbjct: 360 STEEDDEVPDEQE--DYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKIVYSTCSIHAE 417

Query: 419 ENERVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA--QELADGCI 476
           ENERVV+DLLLD  +KQ+GWKVA ++SVIP W RRG + EFEEVF  + A  Q LADGCI
Sbjct: 418 ENERVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPAKCQALADGCI 477

Query: 477 RALPKEDGGIGFFAVCFER 495
           RALP++DGGIGFFAVCFER
Sbjct: 478 RALPRDDGGIGFFAVCFER 496

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/488 (62%), Positives = 371/488 (76%), Gaps = 2/488 (0%)

Query: 10  DILKMEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCW 69
           D+  M FYRD++WVLEY+E    K  R++GSLQTLVL SCK+Y+LKTNPKHIYA V SCW
Sbjct: 43  DVPIMNFYRDATWVLEYVESA-EKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCW 101

Query: 70  KYKMYLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVL 129
           +Y  +L+K++K SG+L D+P KKG+ VF+ TTI LLVHDLL SKNKRI MGKHP+K FVL
Sbjct: 102 RYNEFLDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVL 161

Query: 130 KRQVRLSGEFXXXXXXXXXXXXXXXXXDNDADMSPVRWIRINPFRCQGKVDDVLKELRKK 189
           K + RLS E                  D+  DM+PVRW R+NP RC  K +D+L+EL KK
Sbjct: 162 KYKARLSSELVRLKIKLKVTDLQQLLKDDRNDMTPVRWFRLNPIRCGAKSEDILQELSKK 221

Query: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249
           FP +V+ WT I PG IY DEYIP L+GVHP+DKITSHELYK GK+IIQDRASCFPA+ILN
Sbjct: 222 FPTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAHILN 281

Query: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCES 309
            +  D++IDAC+APGNKTTH+AAHIF D     V+I+AFE+D +RA+ L  M+ +AGC  
Sbjct: 282 ASSEDLIIDACAAPGNKTTHVAAHIFQDQAVESVRIHAFEKDPERAKTLRTMINTAGCTK 341

Query: 310 CIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEE 369
            I++ VGDFTQLAKP  F DVTGFILDPSCSGSGIFGR+ +D  NKSK     P E  E+
Sbjct: 342 GIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSKADGASPVEEEEK 401

Query: 370 QDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLL 429
           ++ +E   ++  K RL KL+SFQF+IVKHAMSFP+AKKLVYSTCS+HAEENER+V+DLLL
Sbjct: 402 EEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYSTCSVHAEENERIVVDLLL 461

Query: 430 DQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQ-AQELADGCIRALPKEDGGIGF 488
           D  +K++GW+V KR  VIP W RRG   EFEEVF  E  A+ELA+ CIR  PKEDGGIGF
Sbjct: 462 DSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDTAKELAEACIRVAPKEDGGIGF 521

Query: 489 FAVCFERE 496
           FAVCFER+
Sbjct: 522 FAVCFERD 529

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/484 (62%), Positives = 373/484 (77%), Gaps = 6/484 (1%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M FYRD++WVLEY+E+  S + R++GSLQTLVL SCK+Y LKTNPKH+YA V SCW+Y  
Sbjct: 1   MNFYRDATWVLEYVEKAES-SGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNE 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           +LEK++K S +L DVP KKG+ +F+ TTI LLVHDLL +KNKRI MGKHP+K FVLK + 
Sbjct: 60  FLEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKT 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDADMSPVRWIRINPFRCQGKVDDVLKELRKKFPKQ 193
           RL+ E                  D+  DM+PVRW RINP RC GK ++V+ EL KKFP +
Sbjct: 120 RLNSELVRLKIKLKVTDLHQLLKDDRNDMTPVRWFRINPVRCHGKHEEVMAELAKKFPTR 179

Query: 194 VDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTPH 253
           VD W  +VPGSIY DEYIPNL+GVHP DKITSHELYK GKIIIQDRASCFPA+ILNP+P 
Sbjct: 180 VDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAHILNPSPS 239

Query: 254 DVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCIQI 313
           DV+IDAC+APGNKTTH+AAH+F +    +  I+AFE+D +RA+ L  MV +AGC   I I
Sbjct: 240 DVIIDACAAPGNKTTHVAAHMFLNDQPQEPLIHAFEKDPERAKTLRTMVKTAGCSKGINI 299

Query: 314 SVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEEQDPK 373
            VGDFT+LAKP +F +V+GFI+DPSCSGSGIFGRQ +D  NKS+    +P    +E++ +
Sbjct: 300 HVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSREEGALPT---QEEERQ 356

Query: 374 EMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLDQNI 433
           E+E  ++ K RLAKL+SFQF+IVK+A+SFP+AKKLVYSTCSIHAEENER+VIDLLLD  +
Sbjct: 357 EIEGKDI-KNRLAKLASFQFEIVKYALSFPSAKKLVYSTCSIHAEENERIVIDLLLDSKV 415

Query: 434 KQYGWKVAKRDSVIPAWQRRGILSEFEEVFPH-EQAQELADGCIRALPKEDGGIGFFAVC 492
           K++GW+V KR   IP W RRG   EFE+VF   + A+ELA+ CIR  PKEDGGIGFFAVC
Sbjct: 416 KEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDTAKELAEACIRVAPKEDGGIGFFAVC 475

Query: 493 FERE 496
           FER+
Sbjct: 476 FERD 479

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/494 (64%), Positives = 383/494 (77%), Gaps = 13/494 (2%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           MEFYRDS+WVLEY+E +  K  R+SGSLQT+VLR CK+Y++KTNPKHIYAIVSSCWKYK 
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YL+KI+K SGLL  +P KKG+P FSK T++LL HDLLLSK KRI MGKHPIK +VLK + 
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 134 RLSGEFXXXXXXXXXX--XXXXXXXDNDADMSPVRWIRINPFRCQGK-VDDVLKELRKKF 190
            L+ EF                   D   DM+PVRWIRINP R      D VL EL+KKF
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLRISNHDTDQVLNELKKKF 180

Query: 191 PKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNP 250
           P +V+ W  I+PGSIY DE+IPNLYG+H SDKITSHELYK+GKIIIQDRASCFPA+ILNP
Sbjct: 181 PTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPAHILNP 240

Query: 251 TPHDVVIDACSAPGNKTTHIAAHIFPDGN---ASDVKIYAFERDAKRAEILEKMVTSAGC 307
           +  DVVIDACSAPGNKTTH+AAHIF D       +V+IYAFE+D +RA+IL+KM+ +AGC
Sbjct: 241 SADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAFEKDPERAQILQKMIKTAGC 300

Query: 308 ESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVF 367
              I ++VGDFTQ+A P  + DVTGFILDPSCSGSGIFGR+SVD+ N     +K  +EV 
Sbjct: 301 HKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNH--GKKSNDEVP 358

Query: 368 EEQDPKEM--EQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVI 425
           +E D +E    +NE  K RL+KL+SFQFQIV+HAMSFPNAKK+VYSTCSIHAEENERVVI
Sbjct: 359 DENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAKKIVYSTCSIHAEENERVVI 418

Query: 426 DLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVF---PHEQAQELADGCIRALPKE 482
           DLLLD+ ++ +GW+VAK++ V+P W RRG   EF+EVF     ++ QELADGC+RALPKE
Sbjct: 419 DLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQECQELADGCVRALPKE 478

Query: 483 DGGIGFFAVCFERE 496
           DGGIGFFAVCF R+
Sbjct: 479 DGGIGFFAVCFVRD 492

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/489 (62%), Positives = 386/489 (78%), Gaps = 8/489 (1%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           MEFYRD++WVLEYIEQ+ SK  RISGSLQ+LVL+SC++YKLKTNPKHIYA++ SCWKYK 
Sbjct: 1   MEFYRDATWVLEYIEQQDSKG-RISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           +LEK++  SG+L D+P KKG+PV+++ T++LL+HDLLLSK KRI MGKHPIK FVL+ + 
Sbjct: 60  FLEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKS 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDA--DMSPVRWIRINPFRCQGKVDDVLKELRKKFP 191
           RL  E                    D+  D++PVRW RINP RC      V+KEL KKFP
Sbjct: 120 RLHSELVKLKLKAKVRDLSELVDTGDSSNDITPVRWFRINPLRCPD-ASAVMKELEKKFP 178

Query: 192 KQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPT 251
           ++V+ W  IVPGSIY DE+IP L+G+HP DKITSHELYK+G+IIIQDRASCFPA+ILNPT
Sbjct: 179 QRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAHILNPT 238

Query: 252 PHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCI 311
             D +IDACSAPGNKTTH+A+++F +G   DV+I+AFE+D +RA++L+KM+  AGC   I
Sbjct: 239 LEDKIIDACSAPGNKTTHVASYMFGNGLVDDVRIFAFEKDPERAKVLQKMIKVAGCSKQI 298

Query: 312 QISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEK-VPNEVFEEQ 370
            ++VGDFT+LA P  F DVTGFI+DPSCSGSGIFGR+ +D  N+ K  +  V N V +EQ
Sbjct: 299 SVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKKTQDIVDNGVPDEQ 358

Query: 371 DPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLLD 430
           +    ++N   + RL+KLSSFQFQ+VKHAMSFP AK++VYSTCSIHAEENERV +DLLLD
Sbjct: 359 EEMAEKENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYSTCSIHAEENERVALDLLLD 418

Query: 431 QNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA---QELADGCIRALPKEDGGIG 487
           + +KQ+GWK+AKR+SVIP W RRG +SEF+E+F  + A   QE+ADGCIRALP+EDGGIG
Sbjct: 419 EKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQEMADGCIRALPREDGGIG 478

Query: 488 FFAVCFERE 496
           FFA+CFER+
Sbjct: 479 FFAICFERD 487

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/488 (61%), Positives = 379/488 (77%), Gaps = 10/488 (2%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M FYRD++WVLEY+EQE  K  R+SGS+QTLVL+SC+RYKLK++PKH+YA+V SCW+YK 
Sbjct: 1   MNFYRDATWVLEYVEQEDEK-GRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKA 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
            LEKI+K S +  D+P KKG+P++S+ T++L+ HDLL+SK KRI MGK PIK +VLK + 
Sbjct: 60  LLEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKT 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDA--DMSPVRWIRINPFRC-QGKVDDVLKELRKKF 190
           RL+ E                    D+  D++PVRWIRINP RC +  V+ VLKEL KKF
Sbjct: 120 RLNSELVKLKLKLKVKSLSEIVDKEDSSNDVTPVRWIRINPLRCPKNDVEPVLKELIKKF 179

Query: 191 PKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNP 250
           P++V  W+ I  G++Y DE++PNL+GVHP DKITSHELY++GKIIIQDR+SCFPA+ILNP
Sbjct: 180 PQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAHILNP 239

Query: 251 TPHDVVIDACSAPGNKTTHIAAHIFPDGNASDV-KIYAFERDAKRAEILEKMVTSAGCES 309
             +DVVIDAC+APGNKTTH+AAHI P+       KIYAFE+D  RA IL+KM + AGC  
Sbjct: 240 GKNDVVIDACAAPGNKTTHVAAHILPEYTREQTPKIYAFEKDPARANILKKMTSVAGCGQ 299

Query: 310 CIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEE 369
            ++I VGDFT+LA P  FKDVTG I+DPSCSGSGIFGR+SVD  N +K   +  +E+ +E
Sbjct: 300 TVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTETDSEIPDE 359

Query: 370 QDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLL 429
           ++  +M  +++   RL+KL+SFQFQ+VKHAMS PNAKK+VYSTCSIHAEENERVVIDLLL
Sbjct: 360 EE--KMVGDDV-ANRLSKLASFQFQVVKHAMSMPNAKKIVYSTCSIHAEENERVVIDLLL 416

Query: 430 DQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHE--QAQELADGCIRALPKEDGGIG 487
           D+NIK++GWKVA R+ VIP W RRG + EFE+VF  +  +  ELADGCIRALP+EDGGIG
Sbjct: 417 DRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDPVKCNELADGCIRALPQEDGGIG 476

Query: 488 FFAVCFER 495
           FFAVCF+R
Sbjct: 477 FFAVCFKR 484

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/488 (57%), Positives = 363/488 (74%), Gaps = 29/488 (5%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M+FYRDS+W+LEY+E E  K  ++SGSLQ+ VL++C +YK+K NPKHIYA+V+SCWKY+M
Sbjct: 1   MDFYRDSTWILEYLEAE-EKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRM 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YLE+I+  SG+L  +P KKG+P FS+ TIMLL HDLL+SK KRI MGKHPIK +VLK + 
Sbjct: 60  YLERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKT 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDAD-MSPVRWIRINPFRCQGKVDDVLKELRKKFPK 192
           RL  E                   +D D  +PVRWIRINP +C   V  V+++L KKFP 
Sbjct: 120 RLHAELVKLKVKLKVKELSELVDQDDGDDATPVRWIRINPLKCDIPV--VVEQLNKKFPH 177

Query: 193 QVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTP 252
           +VD W Q+ PGSIY DEY+PNL+G+HPS+KITSH+LYK+GK+IIQDRASC PA+ILNP  
Sbjct: 178 RVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLPAHILNPGK 237

Query: 253 HDVVIDACSAPGNKTTHIAAHIFP---DGNASDVKIYAFERDAKRAEILEKMVTSAGCES 309
            DVV+DAC+APGNKTTH+AAHI     D N    +I+AFE++  RA++L+KM + AGC S
Sbjct: 238 EDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAFEKEPARAKVLQKMTSQAGCGS 297

Query: 310 CIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEE 369
            ++I VGDFT+LA P  F+DVT  ++DPSCSGSGIFGR+S++ +N S             
Sbjct: 298 LVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSNDS------------- 344

Query: 370 QDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLLL 429
                  Q++  + RL+KLSSFQFQ+VKHAMS PNA+K+VYSTCS+HAEENERVVIDLLL
Sbjct: 345 -------QDQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVVIDLLL 397

Query: 430 DQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHE--QAQELADGCIRALPKEDGGIG 487
           D  +K++GW+++ R  V+P W RRGI  EFEEVF  +  + Q LA+ CIRALP+EDGGIG
Sbjct: 398 DSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALPREDGGIG 457

Query: 488 FFAVCFER 495
           FFAVCF+R
Sbjct: 458 FFAVCFQR 465

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/496 (58%), Positives = 377/496 (76%), Gaps = 16/496 (3%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M FYRD++WVLE++E+E +K  +ISGS+Q++VL+SCK YK+++NPKHIYA+++SCWKYK 
Sbjct: 1   MNFYRDATWVLEFLEKEDAKG-KISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YLE I+K SG+L ++P K G+P F + TI+LL HDLL SK+KRI MGKHP+K +VLK + 
Sbjct: 60  YLETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKT 119

Query: 134 RLSGEFXXXXXXXXXXX--XXXXXXDNDADMSPVRWIRINPFRC--QGKVDDVLKELRKK 189
            L  E                    D+  D++PVRW RINP R      V+ +L+EL KK
Sbjct: 120 SLRSEMVKLQVKMKLKSWGDLISSQDDANDITPVRWFRINPIRTPLSKGVEGILEELEKK 179

Query: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249
           FP +VD W++I  G+IY DE+IPNL+GVH  DKITSHELYK+GKIIIQDRASCFPA++LN
Sbjct: 180 FPTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAHVLN 239

Query: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASD--VKIYAFERDAKRAEILEKMVTSAGC 307
           P   D+VID+C+APGNKTTH AA+I   G + D  ++I+AFE+D +RA++L+KMV +AGC
Sbjct: 240 PGKDDIVIDSCAAPGNKTTHTAAYIL-GGPSKDQKIQIHAFEKDPERAKVLQKMVRTAGC 298

Query: 308 ESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSK-----LAEKV 362
              I+++VGDFT++A P+ FK+VTGFI+DPSCSGSGIFGR+ +D  NK K       +  
Sbjct: 299 ARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKKEGEDVDEDDE 358

Query: 363 PNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENER 422
              +  EQD +E  + +  KTRL+KL+SFQFQ+VKHAM+FP A+KLVYSTCSIHAEENER
Sbjct: 359 SESIPVEQD-EEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYSTCSIHAEENER 417

Query: 423 VVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVF--PHEQAQELADGCIRALP 480
           VVIDLLLD+ IK+ GW+VA R+ VIP W RRG + EF+EVF    E+ +E+A GCIRALP
Sbjct: 418 VVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEEKCKEIAGGCIRALP 477

Query: 481 KEDGGIGFFAVCFERE 496
           KEDGGIGFFAVCFER+
Sbjct: 478 KEDGGIGFFAVCFERD 493

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/491 (61%), Positives = 379/491 (77%), Gaps = 9/491 (1%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M FYRD++WVLE IE+E +K  RISGS+QTLVL+SCKRYKLK+NPKHIYA++ SCWKYK 
Sbjct: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YLEK++K + +L D+P KKG+P+FS+ T++LL HDLLLSK KRI MGKHPIK +VLK + 
Sbjct: 60  YLEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKS 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDA--DMSPVRWIRINPFRCQ--GKVDDVLKELRKK 189
            L  E                    D   D+ PVRWIRINP +C   G+ + VL ELRKK
Sbjct: 120 PLHSEMVKLKLKLKVRELSELVLSEDISNDLPPVRWIRINPLKCHPNGETEPVLAELRKK 179

Query: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249
           F  +VD W+++VPGSIY DE+IPNL+G+HPSDKIT+HELYK GKIIIQDRASCFPA+ILN
Sbjct: 180 FTLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAHILN 239

Query: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDG-NASDVKIYAFERDAKRAEILEKMVTSAGCE 308
           P P D+VID+CSAPGNKTTH A++I+P+    ++ +IYAFE+D +RA++L+KM+  AGC 
Sbjct: 240 PGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNTRIYAFEKDPERAKVLQKMIKIAGCS 299

Query: 309 SCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFE 368
             I ++VGDFT+LA P+ +KDVT FI+DPSCSGSGIFGR+  D  N+ K+ +K  +    
Sbjct: 300 PNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKIDDKDDDGGIV 359

Query: 369 EQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLL 428
             + +E    E  +TRLAKLSSFQFQ+VKHAMSFP AKK+VYSTCSIHAEENERVVIDLL
Sbjct: 360 PDEQEEFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVIDLL 419

Query: 429 LDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHE---QAQELADGCIRALPKEDGG 485
           LD++++++GWKVA +  VIP+W RRG + EFEEVF        Q+LA+GCIRALPK DGG
Sbjct: 420 LDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTYDPQQLAEGCIRALPKSDGG 479

Query: 486 IGFFAVCFERE 496
           IGFFAVCFER+
Sbjct: 480 IGFFAVCFERD 490

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/495 (60%), Positives = 381/495 (76%), Gaps = 16/495 (3%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           MEFYRD++WVLE++EQE +K  RISGSLQTLV +SCKRYKLK NPKH+YA++ SCWKYK 
Sbjct: 1   MEFYRDATWVLEFVEQEDAK-GRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YLEK++K SG+L ++P +KG+P++S+ T+ML+ HDLL SK KRI MGK PIK +VLK + 
Sbjct: 60  YLEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKS 119

Query: 134 RLSGEFXXXXXXXXXXXXXX--XXXDNDADMSPVRWIRINPFRCQGKVDDVLKELRKKFP 191
           RL  E                    D++ DM+PVRWIRINP RC   V+    E++KKFP
Sbjct: 120 RLHSELVKLKLKLKVKNLSELVSNADSENDMTPVRWIRINPLRCD--VEATKLEIQKKFP 177

Query: 192 KQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPT 251
            +V++W+ IVPGSIY DEYIPNL+G+HP DKITSH LYK+GKIIIQDRASCFPA+IL+P 
Sbjct: 178 TRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAHILHPD 237

Query: 252 PHDVVIDACSAPGNKTTHIAAHIFPDGNAS-DVKIYAFERDAKRAEILEKMVTSAGCESC 310
            +DVVID C+APGNKTTH A+++  + +    ++IYAFE++ +RA+IL+KM+  AGC   
Sbjct: 238 ENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKIQIYAFEKNPERAKILDKMIKVAGCSKN 297

Query: 311 IQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEEQ 370
           I+I+VGDFT++A P+ +KDVTGFI+DPSCSGSGIFGR+ +D  N+ K+ +   ++   ++
Sbjct: 298 IKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLNRKKMNKDEADKKEGDE 357

Query: 371 DPKEMEQNELY------KTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVV 424
           + +  ++ E Y      KTRL+KLSSFQFQ+VKHAMSFPNAKK+VYSTCSIHAEENERVV
Sbjct: 358 EEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVYSTCSIHAEENERVV 417

Query: 425 IDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHE----QAQELADGCIRALP 480
           IDL+LD  +KQ+GWKVA R  VIP W RRG + EFEEVF  +    + +ELA GCIRALP
Sbjct: 418 IDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSSKCEELAGGCIRALP 477

Query: 481 KEDGGIGFFAVCFER 495
           + DGGIGFFAVCFER
Sbjct: 478 RSDGGIGFFAVCFER 492

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/497 (60%), Positives = 378/497 (76%), Gaps = 17/497 (3%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M+FYRDS+WVLEY+E+E +K+ +ISGSLQ LVL+SCK+YK+K+NP+H+YA VSSCWK K 
Sbjct: 1   MDFYRDSTWVLEYLEKENAKD-KISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YLEK++K SG+L D+P KKG+P F + T++LL HDLLLSK+KRI MGKHPIK ++LK + 
Sbjct: 60  YLEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKT 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDA--DMSPVRWIRINPFRCQ--GKVDDVLKELRKK 189
           RL  E                  D ++  D++PVRWIRINP R Q    ++ ++ EL KK
Sbjct: 120 RLHSELVKLKLKLKVRDLSELIEDENSNDDITPVRWIRINPIRAQYDKGLEPIMNELNKK 179

Query: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249
           FP +V+ W+ IVPG+IY D+YIPNL+GVH  DKITSHELYK GK+IIQDRASCFPA+ILN
Sbjct: 180 FPTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAHILN 239

Query: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASD--VKIYAFERDAKRAEILEKMVTSAGC 307
           P  +D+VIDAC+APGNKTTH A++I   G   D   +IYAFE+D +RA+IL+ M+  AGC
Sbjct: 240 PGKNDIVIDACAAPGNKTTHTASYIL-GGPKKDQTTQIYAFEKDPERAKILQHMIKVAGC 298

Query: 308 ESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVF 367
            + IQ++VGDFT++A P+ F++VTGFI+DPSCSGSGIFGR+ VD  NK K      N   
Sbjct: 299 SNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSINKKKQESSGDNGNQ 358

Query: 368 EEQDPKEMEQNELY-------KTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEEN 420
           +++D    EQ E +       KTRL+KL+SFQFQ+VKHAMSFP AKK+VYSTCSIHAEEN
Sbjct: 359 DDEDAVPDEQEEEFDLKRDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYSTCSIHAEEN 418

Query: 421 ERVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVF--PHEQAQELADGCIRA 478
           E VVIDLLLD+ ++++GWKVA R  VIP W RRG  +EF +VF    E+ QELADGCIR 
Sbjct: 419 EGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFRDEDEKCQELADGCIRV 478

Query: 479 LPKEDGGIGFFAVCFER 495
           LPKEDGGIGFFAVCFER
Sbjct: 479 LPKEDGGIGFFAVCFER 495

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/493 (62%), Positives = 376/493 (76%), Gaps = 13/493 (2%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M FYRD++WVLE IE+E +K  RISGS+QTLVLRSCK+YKLK+NPKHIYA++ SCWKYK 
Sbjct: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YLEK++K + +L D+P KKG+P+FS+ T++LL HDLLLSK KRI MGKHPIK +VLK + 
Sbjct: 60  YLEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKS 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDA--DMSPVRWIRINPFRCQ--GKVDDVLKELRKK 189
            L  E                    D   D+ PVRWIRINP +C   G  + VL ELRKK
Sbjct: 120 PLHSEMVKLKLKLKVRDLSEVVLSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAELRKK 179

Query: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249
           F  +V+ W+ +VPGSIY DEYIPNL+G+HP+DKIT+HELYK GKIIIQDRASCFPA+IL+
Sbjct: 180 FTLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239

Query: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASD--VKIYAFERDAKRAEILEKMVTSAGC 307
           P   D+VIDACSAPGNKTTH A++I   G   D  ++IYAFE+D +RA+IL+KMV  AGC
Sbjct: 240 PGADDIVIDACSAPGNKTTHTASYIC-SGPPKDNIIRIYAFEKDPERAKILQKMVKVAGC 298

Query: 308 ESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEK-VPNEV 366
            S I + VGDFT+LA P   K  TGFI+DPSCSGSGIFGR+  D  NK K+ EK   N+V
Sbjct: 299 SSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKMDEKDDDNDV 358

Query: 367 FEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVID 426
             ++  + M + EL +TRLAKLSSFQFQ+VKHAMSFP AKK+VYSTCSIHAEENERVVID
Sbjct: 359 IPDEQEEFMAKEEL-QTRLAKLSSFQFQMVKHAMSFPAAKKIVYSTCSIHAEENERVVID 417

Query: 427 LLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA---QELADGCIRALPKED 483
           LLLD+ ++++GWKVA R  VIP+W RRG + EF EVF    A   ++LA+GCIRALPKED
Sbjct: 418 LLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPRQLAEGCIRALPKED 477

Query: 484 GGIGFFAVCFERE 496
           GGIGFFAVCFER+
Sbjct: 478 GGIGFFAVCFERK 490

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/491 (61%), Positives = 378/491 (76%), Gaps = 9/491 (1%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M FYRD++WVLE IE+E +K  RISGS+QTLVL+SCKRYKLK+NPKHIYA++ SCWKYK 
Sbjct: 1   MNFYRDATWVLEDIEKEAAK-VRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YLEK++K + +L ++P KKG+P+F++ T++LL HDLLLSK KRI MGKHPIK +VLK + 
Sbjct: 60  YLEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKS 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDA--DMSPVRWIRINPFRCQ--GKVDDVLKELRKK 189
            L  E                    D   D+ PVRWIRINP +C   G  + VL EL+KK
Sbjct: 120 PLHSEMVKLKLKLKVRDLSELVLSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAELKKK 179

Query: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249
           F ++VD+W+++VPGSIY DEYIPNL+G+HP+DKIT+HELYK GKIIIQDRASCFPA+IL+
Sbjct: 180 FTQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAHILH 239

Query: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDG-NASDVKIYAFERDAKRAEILEKMVTSAGCE 308
           P  +D+VIDACSAPGNKTTH A++IF +      ++IYAFE+D +RA+IL+KM+  AGC 
Sbjct: 240 PGSNDIVIDACSAPGNKTTHTASYIFSEPPKDKKIQIYAFEKDPERAKILQKMIKVAGCS 299

Query: 309 SCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFE 368
           + I ++VGDFT+LA P+  K VTGFI+DPSCSGSGIFGR+  D  N+ K+ EK   +   
Sbjct: 300 ANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDEKDDEDDAV 359

Query: 369 EQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLL 428
             + +E    E  +TRLAKLSSFQFQ+VKHAMSFP AKK+VYSTCSIHAEENERVVIDLL
Sbjct: 360 PDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYSTCSIHAEENERVVIDLL 419

Query: 429 LDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA---QELADGCIRALPKEDGG 485
           LD+ ++++GWKVA R  V+P+W RRG + EFEEVF    A   Q+LA+GCIRALPKEDGG
Sbjct: 420 LDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDPQQLAEGCIRALPKEDGG 479

Query: 486 IGFFAVCFERE 496
           IGFFAVCF R+
Sbjct: 480 IGFFAVCFVRK 490

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/499 (60%), Positives = 378/499 (75%), Gaps = 20/499 (4%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M+FYRD++WVLE IE + +K  ++SGSLQTLVL SCKR+K+KTNPKHIYA+VSSCW+YK 
Sbjct: 1   MDFYRDATWVLESIENQDAKG-KLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           +LEK++K S +L +VP KKG PVF + T++LL HDLLLSK+KRI MGKHPIK FVLK + 
Sbjct: 60  FLEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKT 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDA--DMSPVRWIRINPFRCQGK--VDDVLKELRKK 189
           RL+ E                   +D   D++PVRW R+NP RC  +  V  V+ ELRKK
Sbjct: 120 RLNAELAKMKVKLKVKDLSQLTDSDDLTNDITPVRWFRVNPLRCTAEKPVQSVVTELRKK 179

Query: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249
           F ++VD W  +VPGSIY DEYIPNL+ VHP DKITSHELYK+GKIIIQDRASCFPA+ILN
Sbjct: 180 FTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAHILN 239

Query: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDGNASD---VKIYAFERDAKRAEILEKMVTSAG 306
           P   D+VIDAC+APGNKTTH+AAH+F D  A +   V+IYAFE+D +RA++L KM+  AG
Sbjct: 240 PKSDDIVIDACAAPGNKTTHLAAHMFQDKTADEKPKVQIYAFEKDPERAQVLNKMIKIAG 299

Query: 307 CESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVP--- 363
           C   I++ VGDFT+LA PQ   +V G I+DPSCSGSGIFGR+ +D  N  K  E+     
Sbjct: 300 CSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKKTDEEKEEEE 359

Query: 364 ---NEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEEN 420
              + V EEQ+ +E++ N   KTRL+KLSSFQFQIVK+A+SFP A K+VYSTCSIHAEEN
Sbjct: 360 RELDAVPEEQEEQELDDN--LKTRLSKLSSFQFQIVKYALSFPQATKVVYSTCSIHAEEN 417

Query: 421 ERVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHE----QAQELADGCI 476
           ERVVIDLLLD+ +K+ GW+VA R  VIP W+RRG++ EF++VF  +      QE+ADGCI
Sbjct: 418 ERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNCQEMADGCI 477

Query: 477 RALPKEDGGIGFFAVCFER 495
           RALP+EDGGIGFFAVCFER
Sbjct: 478 RALPREDGGIGFFAVCFER 496

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/507 (56%), Positives = 381/507 (75%), Gaps = 26/507 (5%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M FYRD++WVLE++E +  K  R+SGSL +LV++SCK++K+++NPKH+YA+V S WK+K 
Sbjct: 1   MNFYRDATWVLEHLEAQ-DKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           ++E+I+  SG+L D+P KKG+P++ + T++LL+HDL+ SK++RI MGKHPIK FVL  + 
Sbjct: 60  FIERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKT 119

Query: 134 RLSGEFXXX------XXXXXXXXXXXXXXDNDADMSPVRWIRINPFRC--QGKVDDVLKE 185
           RL  E                        D+  D++PVRWIRINP R   Q   DD++ E
Sbjct: 120 RLHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILE 179

Query: 186 LRKKFPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPA 245
           LRKKF  +VD W++I PG IY DEYIPNL+G+ P+DKITSHELYK GKIIIQDRASCFPA
Sbjct: 180 LRKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPA 239

Query: 246 YILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDV-----KIYAFERDAKRAEILEK 300
           +ILN TP D +IDAC+APGNKTTH+A++I    N + +     +++AFE+D +R++IL+K
Sbjct: 240 HILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDK 299

Query: 301 MVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKS-KLA 359
           MV  AGC+  ++I+ GDFT++A P+ + +VTGFI+DPSCSGSGIFGR+ +D  N + KL 
Sbjct: 300 MVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLT 359

Query: 360 EKVPNEVFEEQDPKEMEQNEL--------YKTRLAKLSSFQFQIVKHAMSFPNAKKLVYS 411
           EKV +E  +++    +EQ  L         +TRL+KLSSFQFQ+VKHAMSFP+AKK+VYS
Sbjct: 360 EKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419

Query: 412 TCSIHAEENERVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA--- 468
           TCSIHAEENERVVIDLLLD+ +K++GWKV  R   IP W+RRG++SEFE+VF ++ A   
Sbjct: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479

Query: 469 QELADGCIRALPKEDGGIGFFAVCFER 495
           ++LA+GCIR LPKEDGGIGFFAVCFER
Sbjct: 480 KQLAEGCIRTLPKEDGGIGFFAVCFER 506

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/491 (62%), Positives = 377/491 (76%), Gaps = 9/491 (1%)

Query: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73
           M FYRD++WVLE IE+E +K  RISGS+QTLVL+SCKRYKLK+NPKH+YA++ SCWKYK 
Sbjct: 1   MNFYRDATWVLEDIEKEAAKE-RISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKP 59

Query: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133
           YLEK++K + +L D+P KKG+P+FS+ T++LL HDLL+SK KRI MGKHPIK +VLK + 
Sbjct: 60  YLEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKS 119

Query: 134 RLSGEFXXXXXXXXXXXXXXXXXDNDA--DMSPVRWIRINPFRC--QGKVDDVLKELRKK 189
            L  E                    D   D+ PVRWIRINP +C   GK + VL ELRKK
Sbjct: 120 PLHSEMVKLKLKLKVRNLSELVLSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAELRKK 179

Query: 190 FPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILN 249
           F  +V+ W+++VP SIY DEYIPNL+G+HPSDKIT+HELYK GKIIIQDRASCFPA+ILN
Sbjct: 180 FTLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAHILN 239

Query: 250 PTPHDVVIDACSAPGNKTTHIAAHIFPDG-NASDVKIYAFERDAKRAEILEKMVTSAGCE 308
           P P+D+VIDACSAPGNKTTH A++I  +    S  +IYAFE+D +RA+IL+KM+  AGC 
Sbjct: 240 PGPNDIVIDACSAPGNKTTHTASYICSEPPKDSRTRIYAFEKDPERAKILQKMIKIAGCS 299

Query: 309 SCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKSKLAEKVPNEVFE 368
           S I +SVGDFT+LA P+ FKD TGFI+DPSCSGSGIFGR+  D  N+ K+ +K  +    
Sbjct: 300 SNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDKDDDNDIV 359

Query: 369 EQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTCSIHAEENERVVIDLL 428
             + +E    E  +TRLAKLSSFQFQ+VKHAMSFP AKK+VYSTCSIHAEENERVVIDLL
Sbjct: 360 PDEQEEFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYSTCSIHAEENERVVIDLL 419

Query: 429 LDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA---QELADGCIRALPKEDGG 485
           LD+ ++++GW+VA R  VIP W RRG + EFEEVF    A   QELA+GCIRALPK+DGG
Sbjct: 420 LDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQELAEGCIRALPKDDGG 479

Query: 486 IGFFAVCFERE 496
           IGFFAVCFER+
Sbjct: 480 IGFFAVCFERK 490

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 92/197 (46%), Gaps = 30/197 (15%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ V+D  SAPG KTT+I+A +   G      I+A 
Sbjct: 336 YLAGNYILQAASSFLPVIALDPQENERVLDMASAPGGKTTYISALMKNTGC-----IFAN 390

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 391 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 447

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+            Q +L  + +  L S          +  N   
Sbjct: 448 QSVKVSRTEKDFIQIPH-----------LQKQLILSAIDSLDS----------NSKNGGV 486

Query: 408 LVYSTCSIHAEENERVV 424
           LVYSTCS+  EE+E VV
Sbjct: 487 LVYSTCSVAVEEDEAVV 503

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 94/202 (46%), Gaps = 40/202 (19%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ V+D  SAPG KTT+I+A +   G      ++A 
Sbjct: 325 YLAGNYILQAASSFLPVVALDPQENERVLDMASAPGGKTTYISALMKNTGC-----VFAN 379

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + + KR + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 380 DANKKRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRVLLDAPCSGTGVIGKD 436

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSF--PNA 405
           QSV ++   K   ++P+                           Q Q++  A+     N+
Sbjct: 437 QSVKVSRTEKDFIQIPH--------------------------LQKQLLLSAIDSVDANS 470

Query: 406 KK---LVYSTCSIHAEENERVV 424
           KK   +VYSTCS+  EE+E VV
Sbjct: 471 KKGGVIVYSTCSVAVEEDEAVV 492

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 116/297 (39%), Gaps = 67/297 (22%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KT  +   +  +G      + A + D
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGFVVANDAD 205

Query: 292 AKRAEILEKMVTSAGCESCIQIS--VGDFTQLAKPQMFKDVTGF---ILDPSCSGSGIFG 346
            +R+ +L   +      + I ++     F ++   +  KD   F   + D  CSG G   
Sbjct: 206 YRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGTM- 264

Query: 347 RQSV----DLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS- 401
           R+++    D    S L                             L + Q  I+   ++ 
Sbjct: 265 RKNINVWKDWGTGSGLG----------------------------LHTVQLNILNRGLTL 296

Query: 402 FPNAKKLVYSTCSIHAEENERVVIDLLLDQNIKQYGWKVA-----------KRDSVIPAW 450
             N  +LVYSTCS++  ENE VV   L     +++G K+             R + I +W
Sbjct: 297 LKNGGRLVYSTCSLNPIENEAVVAAAL-----RKWGAKIKLVNCDDQLLGLVRSTGISSW 351

Query: 451 ---------QRRGILSEFEEVFP--HEQAQELA-DGCIRALPKEDGGIGFFAVCFER 495
                    + +G        FP   E+A+E   + CIR  P +    GFF   FE+
Sbjct: 352 PVLDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTGGFFISVFEK 408

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 120/294 (40%), Gaps = 58/294 (19%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KT  +   +  D +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDAD 204

Query: 292 AKRAEILEKMVTSAGCESCIQIS--------VGDFTQLAKPQMFKDVTGFILDPSCSGSG 343
           AKR+ +L   +      + + ++        +   T   K +        + D  CSG G
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVPCSGDG 264

Query: 344 IFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS-F 402
              R++V+              V+++ +     Q  L       L + Q  I+   ++  
Sbjct: 265 TM-RKNVN--------------VWKDWNT----QGGL------GLHTVQLNILNRGLNLL 299

Query: 403 PNAKKLVYSTCSIHAEENERVVIDL---------LLDQNIKQYG---------WKVAKRD 444
            +  +LVYSTCS++  ENE VV +          L++ + K  G         W V  R+
Sbjct: 300 KSGGRLVYSTCSMNPIENEAVVAEALRKWGSKIKLVNCDDKLVGLVRSKGISNWPVLDRN 359

Query: 445 SVIPAWQRRGILSEFEEVF-PHEQAQEL--ADGCIRALPKEDGGIGFFAVCFER 495
             +   + +G     E  F P E+ +E+   D CIR  P +    GFF   FE+
Sbjct: 360 MAV---KNKGDEGTIESWFPPTEEEREIFHLDSCIRVYPHQQNTGGFFITVFEK 410

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 69.3 bits (168), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 120/298 (40%), Gaps = 65/298 (21%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KT  +   +  D +     + A + D
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQMIEALHKDTDEPTGFVVANDAD 202

Query: 292 AKRAEILE---KMVTSAGCESC---------IQISVGDFTQLAKPQMFKDVTGFILDPSC 339
           +KR+ +L    K + SA              I+ S  D +  A    F  V   + D  C
Sbjct: 203 SKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRV---LCDVPC 259

Query: 340 SGSGIFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHA 399
           SG G   R++V+              V+ +  P    Q  L       L + QF I+   
Sbjct: 260 SGDGTM-RKNVN--------------VWRDWTP----QGGL------GLHTVQFNILNRG 294

Query: 400 MS-FPNAKKLVYSTCSIHAEENERVVIDLL---------------LDQNIKQYG---WKV 440
           +    N  +LVYSTCS++  ENE VV + L               L   ++  G   W V
Sbjct: 295 LHLLKNKGRLVYSTCSMNPIENEAVVAEALRKWGDKIRLVSCEDKLPGLVRSKGVSQWPV 354

Query: 441 AKRDSVIPAWQRRGILSEFEEVFP---HEQAQELADGCIRALPKEDGGIGFFAVCFER 495
             R+ + P  + +G     +  FP    E A+   + CIR  P +    GFF   FE+
Sbjct: 355 IDRN-MTP--REKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPHQQNTGGFFITVFEK 409

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 91/202 (45%), Gaps = 40/202 (19%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 316 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGC-----VFAN 370

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 371 DANKARTKSLIANIHRLGCHNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 427

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+                           Q Q++  A+   +A  
Sbjct: 428 QSVKVSRTEKDFMQIPH--------------------------LQKQLILSAIDSVDAHS 461

Query: 408 -----LVYSTCSIHAEENERVV 424
                +VYSTCS+  EENE VV
Sbjct: 462 KTGGVIVYSTCSVAVEENEAVV 483

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 104/237 (43%), Gaps = 52/237 (21%)

Query: 194 VDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTPH 253
           + +WT++  G    D  +P   G  P         Y  G+ I+Q  +S  P   L+P  +
Sbjct: 294 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGQYILQAASSFLPVIALDPQEN 341

Query: 254 DVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCIQI 313
           + ++D  SAPG KTT+I+A +   G      ++A + +  R + L   +   GC + I  
Sbjct: 342 ERILDMASAPGGKTTYISALMKNTGC-----VFANDANKNRTKSLIANIHRLGCTNTI-- 394

Query: 314 SVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR-QSVDLANKSKLAEKVPNEVFEEQDP 372
            V ++     P++       +LD  CSG+G+ G+ QSV ++   K   ++P+        
Sbjct: 395 -VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPH-------- 445

Query: 373 KEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK-----LVYSTCSIHAEENERVV 424
                              Q Q++  A+   +A       +VYSTCS+  EE+E VV
Sbjct: 446 ------------------LQKQLLLSAIDSVDANSKSGGVIVYSTCSVAVEEDEAVV 484

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 117/296 (39%), Gaps = 62/296 (20%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   P   V+D C+APG+KT  +   +  D +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHKDTDEPTGFVVANDAD 204

Query: 292 AKRAEIL----------EKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSG 341
           A+R+ +L            MV +   +   +I + D  +  K  M K     + D  CSG
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAE-KKRDMLK-FDRILCDVPCSG 262

Query: 342 SGIFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS 401
            G   R++V+              V+++ +     Q  L       L + Q+ I+   + 
Sbjct: 263 DGTM-RKNVN--------------VWKDWNA----QGAL------GLHTVQWNILNRGLH 297

Query: 402 F--PNAKKLVYSTCSIHAEENERVVIDLL---------------LDQNIKQYG---WKVA 441
              PN  +LVYSTCS++  ENE VV   L               L   ++  G   W V 
Sbjct: 298 LLKPNG-RLVYSTCSLNPIENEAVVAQALRKWGNKIRLVNCDEKLPGLVRSKGISQWPVL 356

Query: 442 KRDSVIPAWQRRGILSEFEEVFPHEQAQEL--ADGCIRALPKEDGGIGFFAVCFER 495
            RD         G+L  +    P E+   L   D CIR  P +    GFF   FE+
Sbjct: 357 NRDLETKNKNDEGVLESW--FPPSEEEASLFNLDACIRVYPHQQNTGGFFITVFEK 410

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 94/197 (47%), Gaps = 30/197 (15%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 323 YLAGNYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGC-----VFAN 377

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 378 DANKSRTKSLVANIHRLGCTNTI---VCNYDAREFPRVIGGFDRILLDAPCSGTGVIGKD 434

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+            Q +L  + +  + S       H+ +      
Sbjct: 435 QSVKVSRTEKDFMQIPH-----------LQKQLLLSAIDSVDS-------HSKT---GGI 473

Query: 408 LVYSTCSIHAEENERVV 424
           +VYSTCS+  EE+E+VV
Sbjct: 474 IVYSTCSVAVEEDEQVV 490

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 105/237 (44%), Gaps = 52/237 (21%)

Query: 194 VDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPTPH 253
           + +WT++  G    D  +P   G  P         Y  G  I+Q  +S  P   L+P  +
Sbjct: 311 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 358

Query: 254 DVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCIQI 313
           + ++D  +APG KTT+I+A +   G      ++A + +  R + L   +   GC + I  
Sbjct: 359 ERILDMAAAPGGKTTYISAMMKNTGC-----VFANDANKNRTKSLIANIHRLGCTNTI-- 411

Query: 314 SVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR-QSVDLANKSKLAEKVPNEVFEEQDP 372
            V ++     P++       +LD  CSG+G+ G+ QSV ++   K   ++P+        
Sbjct: 412 -VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPH-------- 462

Query: 373 KEMEQNELYKTRLAKLSSFQFQIVKHAMSF--PNAKK---LVYSTCSIHAEENERVV 424
                              Q Q++  A+     N+KK   +VYSTCS+  EE+E VV
Sbjct: 463 ------------------LQKQLLLSAIDSVDANSKKGGIIVYSTCSVAVEEDEAVV 501

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 116/292 (39%), Gaps = 54/292 (18%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KT  +   +  D N     + A + D
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTAQLLEALHRDSNEPTGFVVANDSD 198

Query: 292 AKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTG---------FILDPSCSGS 342
           ++RA +L   +      + + ++  D     K ++  D T           + D  CSG 
Sbjct: 199 SRRAYMLVHQLKRLNSANLLVVN-HDAQFFPKIKLRADATNKSGMLKYDRILCDVPCSGD 257

Query: 343 GIFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS- 401
           G   R++V+              V+++ +     QN L       L + Q  I+   +  
Sbjct: 258 GTM-RKNVN--------------VWKDWN----TQNAL------GLHNVQLNILNRGLQL 292

Query: 402 FPNAKKLVYSTCSIHAEENERVV----------IDLLLDQN-----IKQYG---WKVAKR 443
             +  +LVYSTCS++  ENE VV          I L+  QN     ++  G   W V  R
Sbjct: 293 LKDNGRLVYSTCSLNPIENEAVVAAALRKWGNKIKLVDCQNKLQGLVRSNGISHWSVYDR 352

Query: 444 DSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALPKEDGGIGFFAVCFER 495
           +            S + E    E+     + C+R  P +    GFF   FE+
Sbjct: 353 EMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNTGGFFIAVFEK 404

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 120/296 (40%), Gaps = 62/296 (20%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L+  PH  V+D C+APG+KT  +  ++  D +     + A + D
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPSGFVVANDAD 201

Query: 292 AKRAEILEKMVTSAGCESCIQIS--VGDFTQL-AKPQMF--KDVTGF---ILDPSCSGSG 343
           AKR+ +L   +      + I ++     F ++ A P     KD+  F   + D  CSG G
Sbjct: 202 AKRSHMLVHQLKRLNSANLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCSGDG 261

Query: 344 IFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS-F 402
              R++V++                        QN L       L + Q  I+   +   
Sbjct: 262 TM-RKNVNVWRDW------------------TTQNGL------ALHNVQLNILNRGLHLL 296

Query: 403 PNAKKLVYSTCSIHAEENERVVIDLLLDQNIKQYGWKV-----------AKRDSVIPAW- 450
            +  +LVYSTCS++  ENE VV + L     +++G KV             R + I  W 
Sbjct: 297 KSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGGKVRLVDCSDKLPGLVRSNGINQWP 351

Query: 451 --------QRRGILSEFEEVFP---HEQAQELADGCIRALPKEDGGIGFFAVCFER 495
                   + +G     +  FP    E A+   D C+R  P +    GFF    E+
Sbjct: 352 VLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQNTGGFFITVLEK 407

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 91/197 (46%), Gaps = 30/197 (15%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 309 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC-----VFAN 363

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 364 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 420

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV +    K   ++P+            Q +L  + +  + S      KH         
Sbjct: 421 QSVKVNRTEKDFMQIPH-----------LQKQLILSAIDSVDSNS----KHGGV------ 459

Query: 408 LVYSTCSIHAEENERVV 424
           +VYSTCS+  EENE VV
Sbjct: 460 IVYSTCSVAVEENEAVV 476

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 92/202 (45%), Gaps = 40/202 (19%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G+ I+Q  +S  P   L+P  ++ V+D  +APG KTT+I+A +   G      ++A 
Sbjct: 317 YLAGQYILQAASSFLPVVALDPQLNERVLDMAAAPGGKTTYISALMKNTGC-----VFAN 371

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 372 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 428

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+                           Q Q++  A+   +A  
Sbjct: 429 QSVKVSRTEKDFIQIPH--------------------------LQKQLLLSAIDSVDANS 462

Query: 408 -----LVYSTCSIHAEENERVV 424
                +VYSTCS+  EE+E VV
Sbjct: 463 KTGGFIVYSTCSVAVEEDEAVV 484

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 93/200 (46%), Gaps = 36/200 (18%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 319 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISAMMKNTGC-----VFAN 373

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 374 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 430

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+            Q +L  + +  + S             N+K 
Sbjct: 431 QSVKVSRTEKDFMQIPH-----------LQKQLLLSAIDSVDS-------------NSKT 466

Query: 408 ---LVYSTCSIHAEENERVV 424
              +VYSTCS+  +ENE VV
Sbjct: 467 GGVIVYSTCSVAVDENEAVV 486

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 111/293 (37%), Gaps = 56/293 (19%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KT  +   +  D +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 292 AKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMF------KDVTGF---ILDPSCSGS 342
           A+R+ +L   +      + + ++  D     + ++        DV  F   + D  CSG 
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVN-HDAQFFPRIRLHGNSSNKNDVLKFDRILCDVPCSGD 263

Query: 343 GIFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLA-KLSSFQFQIVKHAMS 401
           G   R++V++                            + T+    L + Q  I+   + 
Sbjct: 264 GTM-RKNVNVWKD-------------------------WNTQAGLGLHTVQLNILNRGLH 297

Query: 402 -FPNAKKLVYSTCSIHAEENERVVIDLL---------------LDQNIKQYG---WKVAK 442
              N  +LVYSTCS++  ENE VV + L               L   I+  G   W V  
Sbjct: 298 LLKNNGRLVYSTCSLNPIENEAVVAEALRKWGDKIRLVNCDDKLPGLIRSKGVSKWPVYD 357

Query: 443 RDSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALPKEDGGIGFFAVCFER 495
           R+         G L  F      E ++     C+R  P +    GFF   FE+
Sbjct: 358 RNLTEKTKGDEGTLESFFSPSEEEASRFNLQNCMRVYPHQQNTGGFFITVFEK 410

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 115/295 (38%), Gaps = 58/295 (19%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L+  PH  V+D C+APG+KT  +   +  D +     + A + D
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESLHIDSDEPSGFVIANDAD 199

Query: 292 AKRAEILEKMVTSAGCESCIQI--------SVGDFTQLAKPQMFKDVTGFILDPSCSGSG 343
            KR+ +L   +      + + +        ++   T+ A  Q        + D  CSG G
Sbjct: 200 NKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKDASSQEDLKFDRILCDVPCSGDG 259

Query: 344 IFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS-F 402
              R++V++                        QN L       L + QF I+   ++  
Sbjct: 260 TM-RKNVNVWKNWNT------------------QNAL------GLHNVQFNILDRGLTLL 294

Query: 403 PNAKKLVYSTCSIHAEENERVVIDLL---------------LDQNIKQYG---WKVAKRD 444
               KLVYSTCS++  ENE VV  +L               L   I+  G   W V  RD
Sbjct: 295 KETGKLVYSTCSLNPIENEAVVAAVLRKWGDKVRLVCCDDKLKGLIRSKGLTTWPVINRD 354

Query: 445 -SVIPAWQRRGILSEFEEVFP---HEQAQELADGCIRALPKEDGGIGFFAVCFER 495
              +P  + R      +  +P    E ++   D C+R  P +    GFF   FE+
Sbjct: 355 MEEVP--RNRSDDKINKSCYPPTEEEVSKFNLDRCMRVYPHQQNTGGFFITMFEK 407

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 110/292 (37%), Gaps = 54/292 (18%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KT  +   +  D +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 292 AKRAEILEKMVTSAGCESCIQIS--VGDFTQL---AKPQMFKDVTGF---ILDPSCSGSG 343
           A+R+ +L   +      + + ++     F ++          DV  F   + D  CSG G
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVPCSGDG 264

Query: 344 IFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLA-KLSSFQFQIVKHAMS- 401
              R++V++                            + T+    L + Q  I+   +  
Sbjct: 265 TM-RKNVNVWKD-------------------------WNTQAGLGLHAVQLNILNRGLHL 298

Query: 402 FPNAKKLVYSTCSIHAEENERVVIDLL---------------LDQNIKQYG---WKVAKR 443
             N  +LVYSTCS++  ENE VV + L               L   I+  G   W V  R
Sbjct: 299 LKNNGRLVYSTCSLNPIENEAVVAEALRKWGDKIRLVNCDDKLPGLIRSKGVSKWPVYDR 358

Query: 444 DSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALPKEDGGIGFFAVCFER 495
           +         G L  F      E ++     C+R  P +    GFF   FE+
Sbjct: 359 NLTEKTKGDEGTLDSFFSPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 90/201 (44%), Gaps = 38/201 (18%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G+ I+Q  +S  P   L+P  ++ V+D  +APG KTT+I+A +   G      ++A 
Sbjct: 337 YLAGQYILQAASSFLPVVALDPQENERVLDMAAAPGGKTTYISALMKNTGC-----VFAN 391

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQ 348
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 392 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGK- 447

Query: 349 SVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK- 407
             D + KS   EK                         ++   Q Q++  A+   +A   
Sbjct: 448 --DQSVKSSRTEK----------------------DFIQIPHLQKQLLLSAIDSVDANSK 483

Query: 408 ----LVYSTCSIHAEENERVV 424
               +VYSTCS+  EE+E VV
Sbjct: 484 TGGVIVYSTCSVAVEEDEAVV 504

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 90/202 (44%), Gaps = 40/202 (19%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 333 YLAGHYILQAASSFLPVVALDPHENERILDMAAAPGGKTTYISAMMKNTGC-----VFAN 387

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+  + 
Sbjct: 388 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIAKD 444

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+                           Q Q++  A+   +A  
Sbjct: 445 QSVKVSRTDKDFMQIPH--------------------------LQKQLLLSAIDSVDANS 478

Query: 408 -----LVYSTCSIHAEENERVV 424
                +VYSTCS+  EENE VV
Sbjct: 479 KTGGVIVYSTCSVAVEENEAVV 500

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 91/202 (45%), Gaps = 40/202 (19%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 311 YLAGHYILQAASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGC-----VFAN 365

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+  + 
Sbjct: 366 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIAKD 422

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSF--PNA 405
           QSV ++   K   ++P+                           Q Q++  A+     N+
Sbjct: 423 QSVKVSRTEKDFMQIPH--------------------------LQKQLILSAIDSVDSNS 456

Query: 406 KK---LVYSTCSIHAEENERVV 424
           K    +VYSTCS+  EENE VV
Sbjct: 457 KTGGIIVYSTCSVAVEENEAVV 478

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 92/197 (46%), Gaps = 30/197 (15%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 194 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC-----VFAN 248

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 249 DANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 305

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+            Q +L    L+ + S      KH         
Sbjct: 306 QSVKVSRTEKDFIQIPH-----------LQKQLL---LSAIDSVDCN-SKHGGV------ 344

Query: 408 LVYSTCSIHAEENERVV 424
           +VYSTCS+  EE+E VV
Sbjct: 345 IVYSTCSVAVEEDEAVV 361

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 90/202 (44%), Gaps = 40/202 (19%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 329 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMKNTGT-----VFAN 383

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 384 DANKNRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 440

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+                           Q Q++  A+   +   
Sbjct: 441 QSVKVSRTEKDFIQIPH--------------------------LQKQLLLSAIDSVDCNS 474

Query: 408 -----LVYSTCSIHAEENERVV 424
                +VYSTCS+  EE+E VV
Sbjct: 475 KHGGIIVYSTCSVAVEEDEAVV 496

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 102/239 (42%), Gaps = 52/239 (21%)

Query: 192 KQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPAYILNPT 251
           K +  WT++  G    D  +P   G  P         Y  G  I+Q  +S  P   L+P 
Sbjct: 306 KPIGPWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPH 353

Query: 252 PHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCI 311
            ++ ++D  +APG KTT+I+A +   G      ++A + +  R + L   +   GC + I
Sbjct: 354 ENERILDMAAAPGGKTTYISAMMKNTGC-----VFANDANKARTKSLIANIHRLGCTNTI 408

Query: 312 QISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR-QSVDLANKSKLAEKVPNEVFEEQ 370
              V ++     P++       +LD  CSG+G+  + QSV ++   K   ++P+      
Sbjct: 409 ---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIAKDQSVKVSRTEKDFIQIPH------ 459

Query: 371 DPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK-----LVYSTCSIHAEENERVV 424
                                Q Q++  A+   +A       +VYSTCS+  EENE V+
Sbjct: 460 --------------------LQKQLLLSAIDSVDANSKTGGVIVYSTCSVAVEENEAVI 498

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 114/301 (37%), Gaps = 72/301 (23%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KT  +   +  + +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHMEDDEPSGFVVANDAD 204

Query: 292 AKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTG---------FILDPSCSGS 342
           AKR+ +L   +      + + ++  D     + ++ +D T           + D  CSG 
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVN-HDAQFFPRIKLHEDATQKKDVLRFDRVLCDVPCSGD 263

Query: 343 GIFGRQSV----DLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKH 398
           G   R++V    D   +S L                             L + Q  I+  
Sbjct: 264 GTM-RKNVNVWRDWNTQSGLG----------------------------LHTVQLNILNR 294

Query: 399 AMSFPNAK-KLVYSTCSIHAEENERVVIDLLLDQNIKQYGWKV-----------AKRDSV 446
            +     K +LVYSTCS++  ENE VV   L     +++G K+             R   
Sbjct: 295 GLHLLKPKGRLVYSTCSMNPIENEAVVAAAL-----RKWGDKIRLVNCDDKLPGLVRSKG 349

Query: 447 IPAW---------QRRGILSEFEEVF---PHEQAQELADGCIRALPKEDGGIGFFAVCFE 494
           I  W         +++G  +  E  F   P E  +     CIR  P +    GFF   FE
Sbjct: 350 ISTWPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNTGGFFITVFE 409

Query: 495 R 495
           +
Sbjct: 410 K 410

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 112/293 (38%), Gaps = 56/293 (19%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KT  +   +  D +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 292 AKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFK------DVTGF---ILDPSCSGS 342
           A+R+ +L   +      + + ++  D     + ++ +      DV  F   + D  CSG 
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVN-HDAQFFPRIRLHENSNKKNDVLKFDRILCDVPCSGD 263

Query: 343 GIFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLA-KLSSFQFQIVKHAMS 401
           G   R++V++                            + T+    L + Q  I+   + 
Sbjct: 264 GTM-RKNVNVWKD-------------------------WNTQAGLGLHTVQLNILNRGLH 297

Query: 402 -FPNAKKLVYSTCSIHAEENERVVIDLL---------------LDQNIKQYG---WKVAK 442
              +  +LVYSTCS++  ENE V+ + L               L   ++  G   W V  
Sbjct: 298 LLKDGGRLVYSTCSLNPIENEAVIAEALRKWGDKIRLVNCDDKLSGLVRSKGVSKWPVYD 357

Query: 443 RDSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALPKEDGGIGFFAVCFER 495
           R+         G L  F      E ++     C+R  P +    GFF   FE+
Sbjct: 358 RNLTEKTKGDEGTLESFFAPSEEEASKFNLQNCMRVYPHQQNTGGFFITVFEK 410

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 93/200 (46%), Gaps = 36/200 (18%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 319 YLAGNYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISALMKNTGC-----VFAN 373

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  C+G+G+ G+ 
Sbjct: 374 DANKARTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCTGTGVIGKD 430

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   +VP+            Q +L  + +  + S             N+K 
Sbjct: 431 QSVKVSRTEKDFIQVPH-----------LQKQLLLSAIDSVDS-------------NSKT 466

Query: 408 ---LVYSTCSIHAEENERVV 424
              +VYSTCS+  EE+E VV
Sbjct: 467 GGIIVYSTCSVAVEEDEMVV 486

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 92/197 (46%), Gaps = 30/197 (15%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 323 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC-----VFAN 377

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 378 DANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 434

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+            Q +L    L+ + S      KH         
Sbjct: 435 QSVKVSRTEKDFIQIPH-----------LQKQLL---LSAIDSVDCN-SKHGGV------ 473

Query: 408 LVYSTCSIHAEENERVV 424
           +VYSTCS+  EE+E VV
Sbjct: 474 IVYSTCSVAVEEDEAVV 490

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 114/290 (39%), Gaps = 62/290 (21%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KTT +   +  D +     + A + D
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTGFVVANDAD 202

Query: 292 AKRAEIL----------EKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSG 341
           ++R+ +L            MV +   +   +I + D     K Q+  D    + D  CSG
Sbjct: 203 SRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFD--RILCDVPCSG 260

Query: 342 SGIFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLA-KLSSFQFQIVKHAM 400
            G   R++V++                            + T+ A  L + Q  I+   +
Sbjct: 261 DGTM-RKNVNVWKD-------------------------WNTQGALGLHTVQLNILDRGL 294

Query: 401 S-FPNAKKLVYSTCSIHAEENERVVID--------------------LLLDQNIKQYGWK 439
               N  +LVYSTCS++  ENE VV +                    L+  Q I Q  W 
Sbjct: 295 HLLQNNGRLVYSTCSMNPIENEAVVAEALRRWGDKVRLVDCSEKLPGLIRSQGITQ--WP 352

Query: 440 VAKRDSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALPKEDGGIGFF 489
           V  R+      +  G+++ +      E ++   + C+R  P +    GFF
Sbjct: 353 VIDRNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTGGFF 402

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 113/292 (38%), Gaps = 56/292 (19%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L    +  V+D C+APG+KT  +   +  D +     I A + D
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKTAQLIEQLHKDTDEPTGIIVANDSD 218

Query: 292 AKRAEILEKMVTSAGCESCIQIS--VGDFTQLAKPQMFKDVT----GFILDPSCSGSGIF 345
            +R+ +L   +      + + ++     F  +    +  ++T      + D  CSG G  
Sbjct: 219 MRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCSGDGTL 278

Query: 346 GRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS-FPN 404
            R+++++ N  +                   QN L   RL      Q  I+   +    N
Sbjct: 279 -RKNINIWNDWRF------------------QNALGLHRL------QNNILNRGLQLLRN 313

Query: 405 AKKLVYSTCSIHAEENERVVIDLL---------------LDQNIKQYG---WKVAKRDSV 446
             +LVYSTCS++  ENE V+ + L               L   I+  G   W V  R+  
Sbjct: 314 GGRLVYSTCSMNPIENEAVIANALRNWAGEVSLVNFDDELPGLIRSRGISSWPVIDRNGE 373

Query: 447 IPAWQRRGILSEFEEVFP---HEQAQELADGCIRALPKEDGGIGFFAVCFER 495
           +   + RG     +  FP    EQ     + CIR  P +     FF   FE+
Sbjct: 374 M---RERGDPETLDSWFPPTADEQKTFNLEKCIRVYPHQQDTGAFFIAVFEK 422

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 102/219 (46%), Gaps = 35/219 (15%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC-----VFAN 376

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 377 DANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 433

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+            Q +L    L+ + S      KH         
Sbjct: 434 QSVKVSRTEKDFIQIPH-----------LQKQLL---LSAIDSVDCN-SKHGGV------ 472

Query: 408 LVYSTCSIHAEENERVVIDLLLDQ--NIK--QYGWKVAK 442
           +VYSTCS+  EE+E  VID  L +  N+K  + G  + K
Sbjct: 473 IVYSTCSVAVEEDE-AVIDYALRKRPNVKLVETGLAIGK 510

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 92/197 (46%), Gaps = 30/197 (15%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 324 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC-----VFAN 378

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 379 DANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 435

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+            Q +L    L+ + S      KH         
Sbjct: 436 QSVKVSRTEKDFIQIPH-----------LQKQLL---LSAIDSVDCN-SKHGGV------ 474

Query: 408 LVYSTCSIHAEENERVV 424
           +VYSTCS+  EE+E VV
Sbjct: 475 IVYSTCSVAVEEDEAVV 491

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 92/197 (46%), Gaps = 30/197 (15%)

Query: 229 YKRGKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAF 288
           Y  G  I+Q  +S  P   L+P  ++ ++D  +APG KTT+I+A +   G      ++A 
Sbjct: 322 YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTTYISAMMKNTGC-----VFAN 376

Query: 289 ERDAKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGR- 347
           + +  R + L   +   GC + I   V ++     P++       +LD  CSG+G+ G+ 
Sbjct: 377 DANKSRTKSLIANIHRLGCTNTI---VCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKD 433

Query: 348 QSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKK 407
           QSV ++   K   ++P+            Q +L    L+ + S      KH         
Sbjct: 434 QSVKVSRTEKDFIQIPH-----------LQKQLL---LSAIDSVDCN-SKHGGV------ 472

Query: 408 LVYSTCSIHAEENERVV 424
           +VYSTCS+  EE+E V+
Sbjct: 473 IVYSTCSVAVEEDEAVI 489

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 116/292 (39%), Gaps = 54/292 (18%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KT  +   +  D +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIEALHKDTDEPSGFVVANDAD 204

Query: 292 AKRAEILEKMVTSAGCESCIQIS--VGDFTQL---AKPQMFKDVTGF---ILDPSCSGSG 343
           A+R+ +L   +      + + ++     F ++          D+  F   + D  CSG G
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVPCSGDG 264

Query: 344 IFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLA-KLSSFQFQIVKHAMSF 402
              R++V++                            + T+    L + Q  I+   +  
Sbjct: 265 TM-RKNVNVWKD-------------------------WNTQAGLGLHTVQLNILNRGLHL 298

Query: 403 PNAK-KLVYSTCSIHAEENERVVIDL---------LLDQNIKQYGWKVAKRDSVIPAWQR 452
             +  +LVYSTCS++  ENE V+ +          L++ + K  G   +K  S  P + R
Sbjct: 299 LKSNGRLVYSTCSLNPIENEAVIAEALRKWGDKIRLVNCDDKLTGLIRSKGVSKWPVYDR 358

Query: 453 ------RGILSEFEEVFP--HEQAQELA-DGCIRALPKEDGGIGFFAVCFER 495
                 +G     E  FP   E+A +     C+R  P +    GFF   FE+
Sbjct: 359 NLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQNTGGFFISVFEK 410

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 114/288 (39%), Gaps = 49/288 (17%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   P+  V+D C+APG+KT  +   +    +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHAQEDEPTGFVVANDAD 204

Query: 292 AKRAEILEKMVTSAGCESCIQIS--VGDFTQLAKPQMFKDVTGF---ILDPSCSGSGIFG 346
           AKR+ +L   +      + + ++     F ++      K+   F   + D  CSG G   
Sbjct: 205 AKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDGTM- 263

Query: 347 RQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS-FPNA 405
           R++V++      A  +                         L + Q  I+   ++   + 
Sbjct: 264 RKNVNVWRDWGTASGL------------------------GLHTVQLNILNRGLNLLKDG 299

Query: 406 KKLVYSTCSIHAEENERVVIDL---------LLDQNIKQYGWKVAKRDSVIPAWQRRGIL 456
            +LVYSTCS++  ENE V+            L++ + K  G   +K  +  P + +   L
Sbjct: 300 GRLVYSTCSLNPIENESVIAAALRKWGDKIRLVNCDEKLPGLVRSKGITQWPVYDKNFAL 359

Query: 457 SE------FEEVFP--HEQAQEL-ADGCIRALPKEDGGIGFFAVCFER 495
            E       E  FP   E+A     + CIR  P +    GFF   FE+
Sbjct: 360 KEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGFFITVFEK 407

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 110/294 (37%), Gaps = 61/294 (20%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L    H  V+D C+APG+KT  +   +    +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHSSEDEPTGFVVANDAD 204

Query: 292 AKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGF------ILDPSCSGSGIF 345
           A+R+ +L   +      + + ++  D     + +  K+   F      + D  CSG G  
Sbjct: 205 ARRSHMLVHQLKRLNSANLVVVN-HDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGTM 263

Query: 346 GRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS-FPN 404
            R++V++      A  +                         L + Q  I+K  ++    
Sbjct: 264 -RKNVNVWKDWGTASGL------------------------GLHTVQLNILKRGLNLLKK 298

Query: 405 AKKLVYSTCSIHAEENERVVIDLLLDQNIKQYGWKVA-----------KRDSVIPAW--- 450
             +LVYSTCS++  ENE VV   L     +Q+G K+             R   I  W   
Sbjct: 299 GGRLVYSTCSMNPIENEAVVAAAL-----RQWGDKIKLVDCSDKLPGLVRSKGISNWPVI 353

Query: 451 ------QRRGILSEFEEVFP---HEQAQELADGCIRALPKEDGGIGFFAVCFER 495
                 + +G     E  FP    E A    D CIR  P +    GFF    E+
Sbjct: 354 DKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTGGFFITVIEK 407

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 114/302 (37%), Gaps = 74/302 (24%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   P   V+D C+APG+KT  +   +  D +     + A + D
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIEALHMDTDEPTGFVVANDAD 205

Query: 292 AKRAEIL----------EKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSG 341
           ++R+ +L            MV +   +   +I + + +   K  +  D    + D  CSG
Sbjct: 206 SRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFD--RILCDVPCSG 263

Query: 342 SGIFGRQSV----DLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVK 397
            G   R++V    D   +S L                             L + Q+ I+ 
Sbjct: 264 DGTM-RKNVNVWKDWNTQSGLG----------------------------LHTVQYNILN 294

Query: 398 HAMS-FPNAKKLVYSTCSIHAEENERVVID--------------------LLLDQNIKQY 436
             ++   +  +LVYSTCS++  ENE VV                      L+  Q I Q 
Sbjct: 295 RGLNLLKSGGRLVYSTCSLNPIENEAVVAQALRTWGDKIKLVNCGDKLPGLVRSQGISQ- 353

Query: 437 GWKVAKRDSVIPAWQRRGILSEFEEVFP--HEQAQEL-ADGCIRALPKEDGGIGFFAVCF 493
            W V  R+      + +G     E  FP   E+A+    + CIR  P +    GFF    
Sbjct: 354 -WPVIDRNMTE---KNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNTGGFFITVI 409

Query: 494 ER 495
           E+
Sbjct: 410 EK 411

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 116/299 (38%), Gaps = 67/299 (22%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L+  PH  V+D C+APG+KT  +   +  + +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHAESDEPSGFVIANDAD 204

Query: 292 AKRAEIL----------EKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSG 341
            KR+ +L            MV +   +   +I V D T+ +K   F      + D  CSG
Sbjct: 205 YKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKV-DSTEGSKGPQFLKFDRVLCDVPCSG 263

Query: 342 SGIFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS 401
            G   R++V++         +                         L   Q  I++  ++
Sbjct: 264 DGTM-RKNVNVWKDWNTGSGL------------------------GLHIVQLNILERGLN 298

Query: 402 -FPNAKKLVYSTCSIHAEENERVVIDLLLDQNIKQYGWKV--AKRDSVIPAWQRRGILSE 458
                 KLVYSTCS++  ENE V+   L     +++G KV     D  +P   R   ++E
Sbjct: 299 LLKEGGKLVYSTCSLNPIENEAVIAAAL-----RRWGDKVRLVNCDDQLPGLVRSKGITE 353

Query: 459 F------------------EEVFPHEQAQELA----DGCIRALPKEDGGIGFFAVCFER 495
           +                  +  FP   A+E+     + C+R    +    GFF   FE+
Sbjct: 354 WKVYDKQFQVREKGHENCLDSWFP-PTAEEVEKFHLENCMRVYQHQQNTGGFFITVFEK 411

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 112/304 (36%), Gaps = 78/304 (25%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KT  +   +  +       + A + D
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIEALHMENAEPTGFVVANDSD 204

Query: 292 AKRAEILE---KMVTSAGCESC---------IQISVGDFTQLAKPQMFKDVTGF---ILD 336
            +R+ +L    K + SA              I++SVGD          KD   F   + D
Sbjct: 205 YRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGD-------NKAKDALKFDRILCD 257

Query: 337 PSCSGSGIFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLA-KLSSFQFQI 395
             CSG G   R++V++                            + T+    L + Q+ I
Sbjct: 258 VPCSGDGTM-RKNVNVWKD-------------------------WNTQAGLGLHTIQYNI 291

Query: 396 VKHAMS-FPNAKKLVYSTCSIHAEENERVVIDLLLDQNIKQYGWKVA-----------KR 443
           +   +       +LVYSTCS++  ENE VV   L     + +G K+             R
Sbjct: 292 LNRGLHLLKTGGRLVYSTCSLNPIENEAVVARAL-----RTWGSKIKIINCDDKLPGLIR 346

Query: 444 DSVIPAW---------QRRGILSEFEEVFPHEQAQELA---DGCIRALPKEDGGIGFFAV 491
            + +  W         + +G     E  FP    +  A     C+R  P +    GFF  
Sbjct: 347 SNGVTQWPVFDRNMESKNKGDEGTLESWFPPTDEEVTAFNLQNCMRVYPHQQNTGGFFIT 406

Query: 492 CFER 495
             E+
Sbjct: 407 VIEK 410

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 111/296 (37%), Gaps = 65/296 (21%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   P   V+D C+APG+KT  +   +   G      + A + D
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEPSGFVVANDAD 204

Query: 292 AKRAEILEKMVTSAGCESCIQIS--VGDFTQLAKPQMFKDVTGF---ILDPSCSGSGIFG 346
            +R+ +L   +      + I ++     F ++   +  KD   F   + D  CSG G   
Sbjct: 205 YRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDGTM- 263

Query: 347 RQSV----DLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS- 401
           R+++    D A  S L                             L + Q  I+   ++ 
Sbjct: 264 RKNINVWKDWATASGLG----------------------------LHTVQVNILNRGLNL 295

Query: 402 FPNAKKLVYSTCSIHAEENERVVI--------------------DLLLDQNIKQYGWKVA 441
             +  +LVYSTCS++  ENE VV                      L+  Q I Q  W V 
Sbjct: 296 LKDGGRLVYSTCSLNPIENEAVVAAALRKWGDKIKLVECGDKLPGLIRSQGISQ--WPV- 352

Query: 442 KRDSVIPAWQR--RGILSEFEEVFPHEQAQELADGCIRALPKEDGGIGFFAVCFER 495
             D    A QR   G+ + +      E ++   + C+R  P +    GFF   FE+
Sbjct: 353 -YDKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGFFIAVFEK 407

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 113/298 (37%), Gaps = 65/298 (21%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L+  PH  V+D C+APG+KT  +   +  DG      + A + D
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKTAQLIEALHMDGPEPSGFVVANDSD 198

Query: 292 AKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQM----------FKDVTGFILDPSCSG 341
           +KR+ +L   +      + + ++  D     K Q+          +      + D  CSG
Sbjct: 199 SKRSHMLVHQLKRLNSANLMVVN-HDAQFFPKIQLDSNKGRHNKEYLKFDRILCDVPCSG 257

Query: 342 SGIFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS 401
            G   R++V++                        QN L       L + Q  I+   + 
Sbjct: 258 DGTI-RKNVNIWKDWN------------------TQNSL------GLHNVQLNILNRGIQ 292

Query: 402 -FPNAKKLVYSTCSIHAEENERVVIDLLLDQNIKQYGWKVAKRD--SVIPAWQRRGILSE 458
              +  +LVYSTCS+   ENE V+        ++++G K+   D   ++P       +S+
Sbjct: 293 LLKSGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKEMLPGLISSPGISK 347

Query: 459 FE-----------------EVFPHEQAQELAD----GCIRALPKEDGGIGFFAVCFER 495
           +E                 + +     +E  D     CIR  P +    GFF    E+
Sbjct: 348 WEVYDRTMSIVSKGAEKSKDTWFQPTEEEANDFNLSHCIRVFPHQQNTGGFFIAVLEK 405

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 113/296 (38%), Gaps = 62/296 (20%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   P   V+D C+APG+KT  +   +  D +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLLEALHRDTDEPTGFVVANDAD 204

Query: 292 AKRAEILEKMVTSAGCESCIQIS--------VGDFTQLAKPQMFKDVTGFILDPSCSGSG 343
            +R+ +L   +      + I ++        +       K          + D  CSG G
Sbjct: 205 NRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVPCSGDG 264

Query: 344 IFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMS-F 402
              R++V+              V+ + +     QN L       L   Q  I+   +   
Sbjct: 265 TM-RKNVN--------------VWRDWNT----QNAL------GLHQVQANILNRGLHLL 299

Query: 403 PNAKKLVYSTCSIHAEENERVVIDLLLDQNIKQYGWKV--AKRDSVIPAWQRRGILSEFE 460
               +LVYSTCS++  ENE VV      Q ++++G KV     D  +P   R   +S++ 
Sbjct: 300 KKGGRLVYSTCSMNPIENEAVVA-----QALRKWGDKVRLVNCDDKLPGLVRNKGISKWP 354

Query: 461 EVFPH----EQAQELAD-----------------GCIRALPKEDGGIGFFAVCFER 495
            +  +    E+ QE A+                  CIR  P +    GFF   FE+
Sbjct: 355 TLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNTGGFFITVFEK 410

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 110/295 (37%), Gaps = 60/295 (20%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L    +  V+D C+APG+KT  +   +  + +     + A + D
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEALHTNEDEPTGIVVANDAD 203

Query: 292 AKRAEILEKMVTSAGCESCIQIS--VGDFTQLAKPQMFKDVTGF------ILDPSCSGSG 343
           A+R+ +L   +      + + ++     F ++A  +   D   F      + D  CSG G
Sbjct: 204 ARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCDVPCSGDG 263

Query: 344 IFGRQSV----DLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHA 399
              R++V    D  ++  L                             L + Q  I+   
Sbjct: 264 TM-RKNVNVWRDWTSQGGLG----------------------------LHNIQLNILNRG 294

Query: 400 MSFPNAK-KLVYSTCSIHAEENERVVIDLL---------------LDQNIKQYG---WKV 440
           +     K +LVYSTCS++  ENE V+   L               L   ++  G   W V
Sbjct: 295 LHLLKPKGRLVYSTCSMNPIENEAVIAAALRKWGSKIRVINCDEKLPGLVRSKGIDSWPV 354

Query: 441 AKRDSVIPAWQRRGILSEFEEVFPHEQAQELADGCIRALPKEDGGIGFFAVCFER 495
             RD  I     +G+ + +      E++Q     CIR  P +     FF    E+
Sbjct: 355 FNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQNTGAFFITVIEK 409

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 8/127 (6%)

Query: 232 GKIIIQDRASCFPAYILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERD 291
           G I  Q+  S  P  +L   PH  V+D C+APG+KT  +   +    +     + A + D
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHATEDEPTGFVVANDAD 204

Query: 292 AKRAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFKDVTGF------ILDPSCSGSGIF 345
           A+R+ +L   +      + + ++  D     + ++  D   F      + D  CSG G  
Sbjct: 205 ARRSHMLVHQLKRLNSANLMVVN-HDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSGDGTM 263

Query: 346 GRQSVDL 352
            R++V++
Sbjct: 264 -RKNVNV 269

>NDAI0J02020 Chr10 (495949..497949) [2001 bp, 666 aa] {ON} Anc_4.217
          Length = 666

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 88/247 (35%), Gaps = 48/247 (19%)

Query: 191 PKQVDDWTQIVPGSIYR----DEYIPNLYGVHPSDKITSHELYKRGKIIIQDRAS--CFP 244
           P  VDD   I+ G + R     + + NL+G  P+  +   E    G  I     S     
Sbjct: 371 PDDVDDV--ILVGGMTRMPKIRKTVENLFGKKPNITVNPDETVALGAAIQGGILSGEIKN 428

Query: 245 AYILNPTPHDVVIDACSA------PGNKTTHIA-AHIFPDG----NASDVKIYAFERDAK 293
             +L+ TP  + I+          P N T  +    +F  G       D+K+Y  ER   
Sbjct: 429 VLLLDVTPLTLGIETFGGAFAPLIPRNTTVPVTKTEVFSTGVDGQTGVDIKVYQGERGLV 488

Query: 294 RAEILEKMVTSAGCESCIQISVGDFTQLAKPQMFK-----------DVTGFILDPSCSGS 342
           R   L                +GDF     P M K           D  G I+D S S  
Sbjct: 489 RDNKL----------------IGDFKLTGIPPMLKGIPQIFVTFDIDADG-IIDVSASEK 531

Query: 343 GIFGRQSVDLANKSKLAEKVPNEVFEEQDPKEMEQNELYKTRLAKLSSFQFQIVKHAMSF 402
                QS+ +  KS L E   N++ EE +      N L + RL  ++     I    +SF
Sbjct: 532 SSGKEQSITVVPKSGLTEDEINKLIEEANANRSNDN-LIRQRLELITKADIMISDTELSF 590

Query: 403 PNAKKLV 409
              K L+
Sbjct: 591 AKYKGLI 597

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 8/73 (10%)

Query: 252 PHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCI 311
           P D+V++     GN TT I             K+ A E D + A  L K V     E  +
Sbjct: 56  PSDIVLEVGPGTGNLTTRILEKA--------RKVVAVEFDPRMAAELTKRVHGTAAEKKL 107

Query: 312 QISVGDFTQLAKP 324
           +I +GDFT+   P
Sbjct: 108 EIILGDFTKTELP 120

>ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 319

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 252 PHDVVIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFERDAKRAEILEKMVTSAGCESCI 311
           P D V++     GN T  I   +         K YA E D + A  L K V     E  +
Sbjct: 57  PSDTVLEVGPGTGNLTVRILEQVR--------KAYAVEMDPRMAAELTKRVRGTDGERKL 108

Query: 312 QISVGDFTQLAKP 324
           +I +GDF +   P
Sbjct: 109 EILLGDFIKTDLP 121

>AGR036W Chr7 (774273..775193) [921 bp, 306 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR061C (TRM7)
          Length = 306

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 256 VIDACSAPGNKTTHIAAHIFPDGNASDVKIYAFE 289
           V+D C+APG+ +  ++  +FPDG  +  +I A +
Sbjct: 45  VVDLCAAPGSWSQVLSRELFPDGKNTKKRIVAVD 78

>KLTH0F01826g Chr6 (142334..144325) [1992 bp, 663 aa] {ON} similar
           to uniprot|P09959 Saccharomyces cerevisiae YLR182W SWI6
           Transcription cofactor forms complexes with DNA-binding
           proteins Swi4p and Mbp1p to regulate transcription at
           the G1/S transition involved in meiotic gene expression
           localization regulated by phosphorylation potential
           Cdc28p substrate
          Length = 663

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 89  PLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQVRL 135
           PLKK +P  +  T+    HDL L+    + + K P+K F  + +V+L
Sbjct: 131 PLKKLKPAEAFQTVRTFSHDLDLASPLAVQLAKKPLKTFQPEERVKL 177

>ZYRO0B00770g Chr2 complement(60190..61791) [1602 bp, 533 aa] {ON}
           similar to uniprot|P32457 Saccharomyces cerevisiae
           YLR314C CDC3 Component of the septin ring of the mother-
           bud neck that is required for cytokinesis septins
           recruit proteins to the neck and can act as a barrier to
           diffusion at the membrane and they comprise the 10nm
           filaments seen with EM
          Length = 533

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 356 SKLAEKVPNEVFEEQDP--KEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTC 413
           SKL  K  N VF E DP  ++ E+ +L++ +LAKL S + + V H       KKL  S  
Sbjct: 426 SKLGIKQDNSVFREFDPDMRQKEEKQLHEAKLAKLES-EMKTVFHQKVAEKEKKLQKSEA 484

Query: 414 SIHAEENE 421
            + +   E
Sbjct: 485 ELFSRHKE 492

>TDEL0C03270 Chr3 (581846..585901) [4056 bp, 1351 aa] {ON} Anc_7.463
           YJR092W
          Length = 1351

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 9/96 (9%)

Query: 157 DNDADMSPVRWIRINPFRCQGKVDDVLKELRKKFPKQVD--------DWTQIVPGSIYRD 208
           +NDA+    + I   P      VDDV +E  ++  KQ D        D    +P +  +D
Sbjct: 741 ENDAESLDDKEIVTGPAEEHTVVDDVAEERNQEIEKQPDHDFSAFQLDLLPCLPDAKLKD 800

Query: 209 EYIPNLYGV-HPSDKITSHELYKRGKIIIQDRASCF 243
           E++  L  V H +  I +H   + GK  + D  S F
Sbjct: 801 EFMSYLEAVSHDNRSILNHSEIETGKYNVWDHQSEF 836

>Ecym_6205 Chr6 complement(384134..385819) [1686 bp, 561 aa] {ON}
           similar to Ashbya gossypii AFR111C
          Length = 561

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 55/108 (50%), Gaps = 8/108 (7%)

Query: 356 SKLAEKVPNEVFEEQDP--KEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTC 413
           +K+  K  N VF+E DP  ++ E+  L++ +LAKL +    + +  +S    KKL  S  
Sbjct: 454 TKIGIKQDNSVFKEFDPELRQQEEKHLHEAKLAKLEAEMKAVFQQKVS-EKEKKLQKSEA 512

Query: 414 SI---HAEENERVVIDL-LLDQNIKQYGWKVAKRDSVIPAW-QRRGIL 456
            +   H E  E+++  L  L++   Q    +A + S  PA  +++G L
Sbjct: 513 ELFARHKEMKEKLMKQLKALEEKKHQLEMSLANQSSQSPAQPKKKGFL 560

>TDEL0F01590 Chr6 complement(291940..293478) [1539 bp, 512 aa] {ON}
           Anc_4.38 YLR314C
          Length = 512

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 356 SKLAEKVPNEVFEEQDP--KEMEQNELYKTRLAKLSSFQFQIVKHAMSFPNAKKLVYSTC 413
           SKL  K  N VF+E DP  ++ E+ +L++ +LAKL + + + V H       KKL  S  
Sbjct: 405 SKLGIKQDNSVFKEFDPESRQKEEKQLHEAKLAKLEA-EMKSVFHQKVSEKEKKLQKSEA 463

Query: 414 SIHAEENE 421
            + A   E
Sbjct: 464 ELFARHKE 471

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,823,314
Number of extensions: 2227991
Number of successful extensions: 6487
Number of sequences better than 10.0: 90
Number of HSP's gapped: 6512
Number of HSP's successfully gapped: 111
Length of query: 496
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 382
Effective length of database: 40,409,475
Effective search space: 15436419450
Effective search space used: 15436419450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)