Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_33242.285ON70670638110.0
ADL216C2.285ON70570931950.0
SAKL0E07700g2.285ON71268630380.0
Kwal_27.115372.285ON70867029320.0
KLTH0G10340g2.285ON70867028990.0
NCAS0G038002.285ON72669728450.0
ZYRO0A01870g2.285ON70770528390.0
KLLA0E08383g2.285ON70470328350.0
TDEL0G021602.285ON71469928320.0
YNL021W (HDA1)2.285ON70667528280.0
Smik_14.3102.285ON70670828140.0
Skud_14.3082.285ON70668728110.0
Suva_14.3262.285ON70668728100.0
CAGL0J03454g2.285ON69367628090.0
NDAI0G006502.285ON68968028060.0
KNAG0H020102.285ON69368927950.0
KAFR0H033202.285ON70267427310.0
Kpol_1039.322.285ON65965625830.0
TPHA0C033902.285ON70170925090.0
TBLA0B069502.285ON79544619690.0
Kpol_1003.372.285ON57829813051e-172
SAKL0H25124g8.153ON4483723632e-36
TPHA0H003208.153ON4503553561e-35
TBLA0D021408.153ON4563673501e-34
KAFR0C029208.153ON4533563492e-34
Kpol_246.58.153ON4533563464e-34
KLTH0E06446g8.153ON4493693438e-34
KLLA0F09119g8.153ON4523603421e-33
AFR172C8.153ON4493613393e-33
NCAS0B054808.153ON4513673376e-33
YGL194C (HOS2)8.153ON4523583367e-33
Skud_7.798.153ON4523723351e-32
CAGL0A03322g8.153ON4503613332e-32
Smik_7.798.153ON4523303322e-32
TDEL0B045808.153ON4463673322e-32
Kwal_55.207908.153ON4493573313e-32
ZYRO0G19316g8.153ON4483643304e-32
Ecym_23468.153ON4853373315e-32
NDAI0B027108.153ON4533943281e-31
Suva_7.718.153ON4523573252e-31
KNAG0G013508.153ON4513573252e-31
KLTH0F19668g3.8ON4323263224e-31
TBLA0I005603.8ON4333263191e-30
Suva_14.113.8ON4333263191e-30
NCAS0C043203.8ON4343263181e-30
Kwal_55.221423.8ON4323263181e-30
Kpol_1038.113.8ON4333263181e-30
AGR395W3.8ON4333263172e-30
Ecym_20103.8ON4333253172e-30
ZYRO0C03498g3.8ON4333263162e-30
KNAG0A011603.8ON4333263162e-30
NDAI0G037403.8ON4333263162e-30
Skud_14.113.8ON4333263162e-30
SAKL0C13706g3.8ON4333253162e-30
TPHA0A003003.8ON4333263144e-30
CAGL0B01441g3.8ON4333253145e-30
KAFR0A086303.8ON4333263136e-30
KLLA0E01981g3.8ON4323263127e-30
YNL330C (RPD3)3.8ON4333263101e-29
Smik_14.23.8ON4333263101e-29
TDEL0A002703.8ON4333263064e-29
TDEL0C050403.362ON4541822036e-16
Suva_16.3963.362ON4771762001e-15
Skud_16.3533.362ON4711761964e-15
NDAI0A051203.362ON5082571912e-14
Kwal_23.37243.362ON4732021902e-14
CAGL0D01430g3.362ON4452071902e-14
SAKL0B07854g3.362ON4891761903e-14
KLTH0F10582g3.362ON4742041868e-14
KNAG0H006303.362ON4562311851e-13
KAFR0H008903.362ON4742101804e-13
TBLA0B023903.362ON5791771814e-13
Smik_16.3093.362ON4701761805e-13
YPR068C (HOS1)3.362ON4701761796e-13
Kpol_376.153.362ON5182431797e-13
NCAS0A111803.362ON4902031761e-12
ZYRO0C16390g3.362ON4361781761e-12
ADL339W3.362ON4372721733e-12
Kpol_479.68.607ON6882981701e-11
TDEL0A055208.607ON6743331663e-11
KLLA0B09394g3.362ON4411761634e-11
Ecym_82908.607ON7093001645e-11
ADL265W8.607ON6943101621e-10
ZYRO0F10780g8.607ON6683331602e-10
Ecym_34653.362ON4452291582e-10
SAKL0H08338g8.607ON6903361592e-10
KAFR0H027908.607ON717991573e-10
TBLA0E040808.607ON6942561557e-10
KLTH0D09592g8.607ON7052671512e-09
KNAG0J013008.607ON6773061503e-09
Kwal_26.85058.607ON7083361503e-09
YPL116W (HOS3)8.607ON6973841493e-09
Smik_6.3158.607ON6971341484e-09
KLLA0F00858g8.607ON715651484e-09
Suva_16.1948.607ON6991161468e-09
NDAI0E024808.607ON6843511451e-08
CAGL0J06974g8.607ON6782991422e-08
NCAS0C017608.607ON700991422e-08
TPHA0A011208.607ON698991404e-08
Skud_16.1648.607ON6971241386e-08
TPHA0M015903.362ON4942721376e-08
Smik_16.2238.78ON1226133860.12
KAFR0E023205.60ON433134790.59
YPL095C (EEB1)8.574ON45690771.1
Smik_16.1428.574ON45690733.1
KNAG0E022002.406ON135875734.5
NCAS0B055608.162ON35226714.9
SAKL0D05060g1.253ON177271726.2
NDAI0B029008.162ON35226707.6
Suva_2.1058.162ON35327699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3324
         (706 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1472   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1235   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1174   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1134   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1121   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1100   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1098   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1096   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1095   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1093   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1088   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1087   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1087   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1086   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1085   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1081   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1056   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...   999   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   971   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   763   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   507   e-172
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   144   2e-36
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   141   1e-35
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   139   1e-34
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   139   2e-34
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   137   4e-34
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   136   8e-34
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   136   1e-33
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   135   3e-33
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   134   6e-33
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   134   7e-33
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   133   1e-32
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   132   2e-32
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   132   2e-32
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   132   2e-32
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   132   3e-32
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   131   4e-32
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   132   5e-32
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    130   1e-31
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   129   2e-31
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   129   2e-31
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   128   4e-31
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   127   1e-30
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   127   1e-30
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      127   1e-30
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   127   1e-30
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   127   1e-30
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   126   2e-30
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   126   2e-30
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   126   2e-30
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   126   2e-30
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   126   2e-30
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   126   2e-30
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   126   2e-30
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   125   4e-30
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   125   5e-30
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   125   6e-30
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   124   7e-30
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   124   1e-29
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   124   1e-29
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   122   4e-29
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    83   6e-16
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    82   1e-15
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    80   4e-15
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    78   2e-14
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    78   2e-14
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    78   2e-14
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    78   3e-14
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    76   8e-14
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    76   1e-13
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    74   4e-13
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    74   4e-13
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    74   5e-13
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    74   6e-13
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    74   7e-13
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    72   1e-12
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    72   1e-12
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    71   3e-12
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    70   1e-11
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    69   3e-11
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    67   4e-11
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    68   5e-11
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    67   1e-10
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    66   2e-10
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    65   2e-10
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    66   2e-10
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    65   3e-10
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    64   7e-10
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    63   2e-09
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    62   3e-09
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    62   3e-09
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    62   3e-09
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    62   4e-09
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    62   4e-09
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    61   8e-09
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    60   1e-08
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    59   2e-08
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    59   2e-08
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    59   4e-08
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    58   6e-08
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    57   6e-08
Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL01...    38   0.12 
KAFR0E02320 Chr5 (466643..467944) [1302 bp, 433 aa] {ON} Anc_5.6...    35   0.59 
YPL095C Chr16 complement(368071..369441) [1371 bp, 456 aa] {ON} ...    34   1.1  
Smik_16.142 Chr16 complement(251287..252657) [1371 bp, 456 aa] {...    33   3.1  
KNAG0E02200 Chr5 complement(442946..447022) [4077 bp, 1358 aa] {...    33   4.5  
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    32   4.9  
SAKL0D05060g Chr4 complement(392306..397624) [5319 bp, 1772 aa] ...    32   6.2  
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    32   7.6  
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    31   9.9  

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1472 bits (3811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/706 (100%), Positives = 706/706 (100%)

Query: 1   MNQESKQKRKLEIDGNDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCY 60
           MNQESKQKRKLEIDGNDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCY
Sbjct: 1   MNQESKQKRKLEIDGNDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCY 60

Query: 61  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIP 120
           DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIP
Sbjct: 61  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIP 120

Query: 121 IREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAI 180
           IREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAI
Sbjct: 121 IREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAI 180

Query: 181 EACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMIL 240
           EACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMIL
Sbjct: 181 EACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMIL 240

Query: 241 DWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWS 300
           DWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWS
Sbjct: 241 DWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWS 300

Query: 301 CGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHML 360
           CGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHML
Sbjct: 301 CGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHML 360

Query: 361 KSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIR 420
           KSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIR
Sbjct: 361 KSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIR 420

Query: 421 EQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLD 480
           EQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLD
Sbjct: 421 EQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLD 480

Query: 481 MELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWAL 540
           MELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWAL
Sbjct: 481 MELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWAL 540

Query: 541 GRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGF 600
           GRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGF
Sbjct: 541 GRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGF 600

Query: 601 VHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGN 660
           VHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGN
Sbjct: 601 VHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGN 660

Query: 661 DSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706
           DSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE
Sbjct: 661 DSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1235 bits (3195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/709 (82%), Positives = 641/709 (90%), Gaps = 7/709 (0%)

Query: 1   MNQESKQKRKLEIDGNDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCY 60
           M + ++QKRKLE    D  G  N   A  K  V  QKRP+IVP V+PKI YVPLKTGLCY
Sbjct: 1   MEERTQQKRKLEEGSPD--GEANGGQASRKAIV--QKRPVIVPPVRPKISYVPLKTGLCY 56

Query: 61  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIP 120
           DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSG+D+IG LM KIP
Sbjct: 57  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIP 116

Query: 121 IREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAI 180
           +REATE+EIL VHSKEHVEFLKTTNTM REQLLKETEAGDSVYYNNDSL+SA+LSCGGAI
Sbjct: 117 VREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAI 176

Query: 181 EACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMIL 240
           EACKAVVEGRVKNA+AVVRPPGHHAEP VAGGFCLFSNVAVAA+NILKNYPESVR+VMIL
Sbjct: 177 EACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMIL 236

Query: 241 DWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWS 300
           DWDIHHGNGTQ+AFY DNRVLYVSLHRYELG+YYPGT YGNY+Q G+GKGEGFNCNIPWS
Sbjct: 237 DWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWS 296

Query: 301 CGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHML 360
           C GVGDAEYMWAFEQ+VIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGH+THML
Sbjct: 297 CSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHML 356

Query: 361 KSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIET-VI 419
           KSLA+GNMCVVLEGGYNLDSIAKSALGV KVLIGEPPDELP P KQPKPEAI TI+  ++
Sbjct: 357 KSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLV 416

Query: 420 REQAKYWDCFKSKHGNCGVNWKE-PVDESLTFKNFPLQSAVR-QEQFRRLSKEYKFVTLP 477
           +EQ+KYW+CFK +HGN G+NW+E  V++SLT KNFPLQ       QFRRL+KEYKFVTLP
Sbjct: 417 KEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLP 476

Query: 478 LLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITN 537
           LL+MEL  DTIICSPNIH TD +IICVHDTPE+WA+R+ LTG+IDPSTSIIVDTT+S+ N
Sbjct: 477 LLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVIN 536

Query: 538 WALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAY 597
           WALGR+YG+IDINIPQSLFE DNYSAVL+SQEV++YLWD YLK F  L RVAFVGIGDAY
Sbjct: 537 WALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAY 596

Query: 598 SGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGT 657
           SGFVHLLGHRDTRS+VKCAI+F DKKQLRPLVPLVDES+ DWYFKNSL+FTS YH CWGT
Sbjct: 597 SGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGT 656

Query: 658 EGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706
           +GNDSKKPRKKFGRVL+   DGMNNI+EER EEATDFILDSFEEWS+SE
Sbjct: 657 DGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1174 bits (3038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/686 (78%), Positives = 616/686 (89%)

Query: 21  VENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDP 80
           V+ M+  V     +    P+IVP V P+IHY  LKTGLCYDVRMRYHAKI+TSYFEYIDP
Sbjct: 27  VDTMEDEVESRKRSTGTLPVIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDP 86

Query: 81  HPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEF 140
           HPEDPRRIYRIYKILAENGLI DPTLSGVD+IG LMLKIP+REAT +EIL VH+KEH+ F
Sbjct: 87  HPEDPRRIYRIYKILAENGLIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAF 146

Query: 141 LKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRP 200
           L+ T  M+REQLLKETE GDSVY+NNDSL+SAKLSCGGAIEACKAVVEGRVKNALAV+RP
Sbjct: 147 LEKTPKMTREQLLKETETGDSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRP 206

Query: 201 PGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRV 260
           PGHHAEPE+AGGFCLFSNVAVAA+NILKNYPESVR++MILDWDIHHGNGTQ+AFY+DNRV
Sbjct: 207 PGHHAEPEIAGGFCLFSNVAVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRV 266

Query: 261 LYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPM 320
           LYVSLHRYELG+YYPGT +GNY Q+GEGKGEGFNCNIPW  GG+GDAEYMWAF+Q+V+PM
Sbjct: 267 LYVSLHRYELGKYYPGTVHGNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPM 326

Query: 321 GREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDS 380
           GREFQPDLVIISSGFDAADGDTIGQCHVSP+CYGHMTHMLKSLA+GN+CVVLEGGYNLDS
Sbjct: 327 GREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDS 386

Query: 381 IAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNW 440
           IAKSALGV K+LIGEPPDELP P +QPKPEAI TIETVIR Q+KYW+CFKS H N G N+
Sbjct: 387 IAKSALGVAKILIGEPPDELPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNF 446

Query: 441 KEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTL 500
           KE V ES   KNFPLQ A+RQEQ ++LS+++ FVTLPLL+ME+  DT+ICSPNI++ +T+
Sbjct: 447 KEEVTESTISKNFPLQQAIRQEQLQQLSEKFGFVTLPLLNMEVPQDTVICSPNIYDAETV 506

Query: 501 IICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELDN 560
           ++CVHDTPE+WA+RNP+TG IDPSTSIIVDTTL I  W+L R Y +ID+NIPQSLFE DN
Sbjct: 507 VVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDN 566

Query: 561 YSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFT 620
           YSA++TSQEVL Y+WD+YLK+F  L +VAF+G+GDAYSG VHLLGHRDTRS+VK A+SF 
Sbjct: 567 YSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFV 626

Query: 621 DKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGM 680
           D K L+ LVPLVDES+ +WYFKNSL+FTSK HSCWGT+GN++KKPRK+FGRVLKC++ GM
Sbjct: 627 DTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGM 686

Query: 681 NNILEERFEEATDFILDSFEEWSDSE 706
           NNI+EERF+EATDFILDSFEEWSDSE
Sbjct: 687 NNIVEERFQEATDFILDSFEEWSDSE 712

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1134 bits (2932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/670 (77%), Positives = 600/670 (89%), Gaps = 1/670 (0%)

Query: 37  KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 96
           KRP+IVP  + K+HY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 40  KRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99

Query: 97  ENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKET 156
           ENGLI DPTLSGVDDIG+LMLKIP REAT++EIL VH+ EH+EFL  T +M+REQLLKET
Sbjct: 100 ENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKET 159

Query: 157 EAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 216
           E GDSVY+NNDS +SAKLSCGGAIEAC+AVVEGRVKNALAVVRPPGHHAEP++AGGFCLF
Sbjct: 160 EKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLF 219

Query: 217 SNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPG 276
           SNVAVAA+NILKNYPESV+K+MILDWD+HHGNGTQ+AFYND+RVLYVSLHR+ELG+YYPG
Sbjct: 220 SNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPG 279

Query: 277 TEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFD 336
           T +GN ++ GEGKGEGFNCNIPW   GVGDAEY+WAFEQ+V+PMGREFQPDLVIISSGFD
Sbjct: 280 TIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFD 339

Query: 337 AADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEP 396
           AADGDT+GQCHV+P+CYGHMTHMLKSLA+GN+C VLEGGY+LDSIAKSALGV KVLIGEP
Sbjct: 340 AADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEP 399

Query: 397 PDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQ 456
           PDELP   KQPKPEA+  I+ VI+ Q++YW CFKS H N G ++KEPV E+L  +NFPLQ
Sbjct: 400 PDELP-VVKQPKPEAVEVIDAVIKMQSRYWQCFKSTHANDGCSFKEPVTETLLNRNFPLQ 458

Query: 457 SAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNP 516
           +A+RQ+Q R L+ EY FVTLPL+  EL  DT +CSPNI+++ ++I+CVHDTPE+WA+R+ 
Sbjct: 459 TAIRQQQVRLLTTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSR 518

Query: 517 LTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWD 576
            TG IDPSTSIIVDTTL +  WA  R+YG+IDINIPQSL E DNYSAVLT+QEVL Y+WD
Sbjct: 519 ATGTIDPSTSIIVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWD 578

Query: 577 HYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESI 636
            YLK+F  L++VAFV IGDAYSG VHLLGHRDTR++VK AISF D++ LRPLVPLVDES+
Sbjct: 579 SYLKYFTSLSKVAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESL 638

Query: 637 SDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFIL 696
           +DWYFKNSL+F S  H+CWG +G ++KKPRKKFGRVLKCNSDG+NNILEERFEEATDFIL
Sbjct: 639 ADWYFKNSLVFASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFIL 698

Query: 697 DSFEEWSDSE 706
           D+FEEWSDSE
Sbjct: 699 DTFEEWSDSE 708

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1121 bits (2899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/670 (75%), Positives = 597/670 (89%), Gaps = 1/670 (0%)

Query: 37  KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 96
           KRP IVP  +PK+HY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 40  KRPTIVPACRPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99

Query: 97  ENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKET 156
           ENGLI+DPTLSGVD IG+LMLKIP+REAT++EIL VH+KEH+EF+  T +M+R+QLLKET
Sbjct: 100 ENGLIDDPTLSGVDSIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKET 159

Query: 157 EAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 216
           E GDSVY+NNDS +SAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF
Sbjct: 160 EKGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 219

Query: 217 SNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPG 276
           SNVAVAA+NILKNYPESVRK+M+LDWD+HHGNGTQ+AFY+D+RVLY+SLHR+ELG+YYPG
Sbjct: 220 SNVAVAAQNILKNYPESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPG 279

Query: 277 TEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFD 336
           T +GN ++ GEGKGEGFNCNIPW   GVGD+EY+WAFEQ+++PMGREF+PDLVIISSGFD
Sbjct: 280 TIHGNSDRVGEGKGEGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFD 339

Query: 337 AADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEP 396
           AADGDT+GQCHV+P+CYGHMTHMLKSLA+GN+C VLEGGY+LDSIAKSAL V KVLIGEP
Sbjct: 340 AADGDTVGQCHVTPSCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEP 399

Query: 397 PDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQ 456
           PDELP   KQPK EA+  I++VI+ Q+KYW CFKS HGN G ++KE   ++   KNFPLQ
Sbjct: 400 PDELP-VVKQPKLEAVEVIDSVIKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQ 458

Query: 457 SAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNP 516
           +A+RQ+Q R L+ E++FVTLPL   EL  DT ICSPNI++   +I+CVHDTP +WA+R+ 
Sbjct: 459 NAIRQQQMRLLANEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSR 518

Query: 517 LTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWD 576
            TG IDPSTSIIVDTTL +  WA  R+YG+IDINIPQSL E DNYSAV+T+QEVL ++WD
Sbjct: 519 ATGTIDPSTSIIVDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWD 578

Query: 577 HYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESI 636
           +YLK+F  L RVAFV IGDA+SG VHLLGHRDTRS+VK A+SF D++ LRPL+PLVDE++
Sbjct: 579 NYLKYFPSLNRVAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETL 638

Query: 637 SDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFIL 696
           +DWYFKNSL+F S  H+CWG +GN++KKPRKKFGRVLKC+SDG+NNILEERFEEATDFIL
Sbjct: 639 ADWYFKNSLVFASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFIL 698

Query: 697 DSFEEWSDSE 706
           D+FEEWSDSE
Sbjct: 699 DTFEEWSDSE 708

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1100 bits (2845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/697 (72%), Positives = 602/697 (86%), Gaps = 8/697 (1%)

Query: 16  NDTIGVENMKTAVSKLTVAQQK------RPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAK 69
           +DT    NM     +  + +QK      RP+IVP    ++ Y PLKTGLCYDVRMRYHAK
Sbjct: 32  SDTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSYTPLKTGLCYDVRMRYHAK 91

Query: 70  IFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEI 129
           IFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSG++DIG+LMLKIP+R+ATE+EI
Sbjct: 92  IFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIEDIGDLMLKIPVRDATEEEI 151

Query: 130 LLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEG 189
           L VHSKEH +F++ T+TM+RE+LLK TE GDSVY+NNDS  SAKL  GG+IEACKAVVEG
Sbjct: 152 LEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFASAKLPVGGSIEACKAVVEG 211

Query: 190 RVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNG 249
           RVKN+LAVVRPPGHHAEP+ AGGFCLFSNVA+AA+NILKNYPESVR++MILDWDIHHGNG
Sbjct: 212 RVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYPESVRRIMILDWDIHHGNG 271

Query: 250 TQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEY 309
           TQ+AFY+D+RVLY+SLHR+ELG+YYPGT  G Y+Q+GEGKGEGFNCNI W  GGVGDAEY
Sbjct: 272 TQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGEGFNCNITWPVGGVGDAEY 331

Query: 310 MWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMC 369
           +WAFEQ+V+PM REFQPDLVIISSGFDAADGD+IGQCHV+P+CYGHMTHMLKSLAKGN+C
Sbjct: 332 IWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPSCYGHMTHMLKSLAKGNLC 391

Query: 370 VVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCF 429
           VVLEGGYNLD+IA+SAL V K+LIGEPPDELPDP + PKPEAI  I+ VIR Q+KYW CF
Sbjct: 392 VVLEGGYNLDAIARSALSVAKILIGEPPDELPDPLRDPKPEAIEIIDKVIRLQSKYWKCF 451

Query: 430 KSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTII 489
           K ++GN G N+K+ ++ESL  KNFPLQ A+R++Q   LS+++KF TLPLL  EL  DT++
Sbjct: 452 KRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDFKFATLPLLKPELPKDTVL 511

Query: 490 CSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDI 549
           CSPN++++ T+IIC HDTPE+WAKR+ + G IDPS+SIIVD+TL    WA  + YG+IDI
Sbjct: 512 CSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEKKYGVIDI 571

Query: 550 NIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDT 609
           NIPQ+LFE +NYSA++TSQEVL+Y+WD+YLK+F  + +VAF+GIGDAYSG VHLLGHRDT
Sbjct: 572 NIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVHLLGHRDT 631

Query: 610 RSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKF 669
           RS+VK  I+F  +KQLR LVPLVDES+SDWYFKNSL+F+ K H+ WG + N  KKPRKK+
Sbjct: 632 RSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKEN--KKPRKKY 689

Query: 670 GRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706
           GR+L+C +DG+NNI+EERFEEATDFILDSFEEWSDSE
Sbjct: 690 GRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/705 (72%), Positives = 603/705 (85%), Gaps = 6/705 (0%)

Query: 2   NQESKQKRKLEIDGNDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYD 61
            ++   KRKLE   N   G    K  V+ ++  +QKR IIVP  +PKIHY PLKTGLCYD
Sbjct: 9   QEDEGSKRKLEESPN---GPVEKKPNVASVSNGRQKRQIIVPACEPKIHYTPLKTGLCYD 65

Query: 62  VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPI 121
           VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG DDIG LMLKIP+
Sbjct: 66  VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKIPV 125

Query: 122 REATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIE 181
           REAT +E+L VH+KEH+EF++ T+ M+RE+LLKETE GDSVY+N+DS  +AKL CGGAIE
Sbjct: 126 REATVEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGAIE 185

Query: 182 ACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILD 241
           ACKAVVEGRVKNALAV+RPPGHHAEPE+AGGFCLFSNVAVAA+NILKNYPESVR+++ILD
Sbjct: 186 ACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILILD 245

Query: 242 WDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSC 301
           WDIHHGNGTQ+AFYND+RVLY+SLHR+ELG+YYPGT +G Y+Q+GEGKGEGFNCNI W  
Sbjct: 246 WDIHHGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITWPV 305

Query: 302 GGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLK 361
           GGVGDAEYM AFEQIV+PM RE++PDLVIISSGFDAADGDTIGQCHVSP+CYGHMTHMLK
Sbjct: 306 GGVGDAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLK 365

Query: 362 SLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIRE 421
           SLA+GN+CV LEGGYNLD+IA SAL V K+LIGEPP+ELPDP K PK EAI  I+ VI  
Sbjct: 366 SLARGNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDKVIHV 425

Query: 422 QAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDM 481
           Q+KYW CF+ + GN G N+KEPV ESL  KNFPLQ A+RQEQF +L KEY FVTLP+  +
Sbjct: 426 QSKYWKCFR-RLGNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTLPVPKL 484

Query: 482 ELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALG 541
           EL  DT++CSP++ +  T+II VHDTPE+WAKR+ +TG IDPSTSI VD+ L    W+L 
Sbjct: 485 ELPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLA 544

Query: 542 RSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFV 601
           R YG+ID+NIPQSLFE DNYSA++TSQEVL YLWD+++K+F  L++VAFVG+GDAYSG V
Sbjct: 545 RKYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIV 604

Query: 602 HLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGND 661
           HLLGHRDTRS+VK  I+F  +KQL+PLVPLVDES+ DWYFKNSL+F+ + + CW    N+
Sbjct: 605 HLLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVD--NE 662

Query: 662 SKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706
           +KKPR+KFGRVL+C SDG+NN +EERF+EATDFILDSFEEWSDSE
Sbjct: 663 NKKPRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/703 (70%), Positives = 601/703 (85%)

Query: 4   ESKQKRKLEIDGNDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVR 63
           ESK+  +  ++      ++N  TA +  +  + +RP+IVP  KPKI Y  LKTG+CYDVR
Sbjct: 2   ESKKPAEEPLERPSIKEIKNEGTAYTLPSKDESQRPVIVPPTKPKIRYSLLKTGICYDVR 61

Query: 64  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIRE 123
           MRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI+DPTLSG D IG+LM+K+P+RE
Sbjct: 62  MRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGADSIGDLMVKVPVRE 121

Query: 124 ATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEAC 183
           A E+EIL VHS++H++F+  T  + RE LLKETE GDSVY+NNDS +SAKLSCGGAIEAC
Sbjct: 122 AEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYLSAKLSCGGAIEAC 181

Query: 184 KAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWD 243
           KAVVEGRVKN++AVVRPPGHHAEPE+AGGFCLFSNVAVAA N+LK+YPESVRK+MI+DWD
Sbjct: 182 KAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSYPESVRKIMIVDWD 241

Query: 244 IHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGG 303
           IHHGNGTQ+AFY+D+RVLYVSLHRY+LG+YYPGT +GNY+Q+GEGKGEGFNCNI W  GG
Sbjct: 242 IHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKGEGFNCNITWPTGG 301

Query: 304 VGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSL 363
           VGDAEYMWAFEQ+++PMGREF+PDLV+ISSGFDAADGDTIGQCHV+PACYGHMTHML SL
Sbjct: 302 VGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTPACYGHMTHMLLSL 361

Query: 364 AKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQA 423
           AKGN+CVVLEGGYNLDSIAKSALGV KVL+GEPPDELP P KQP PEA   IETVIR Q+
Sbjct: 362 AKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPEAKKMIETVIRTQS 421

Query: 424 KYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMEL 483
           KYW CFK++HGN G+N+K+ +  +L  +NFPLQ+A+R+ Q  +LS ++ FV LP+LD+ L
Sbjct: 422 KYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQNAIREYQVSQLSSQFNFVQLPILDLNL 481

Query: 484 SGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRS 543
             +T++C+  I +++TL++ VHDTPE+W++R+  TG IDPS+SIIVD  L + NWA+ R 
Sbjct: 482 PANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDRR 541

Query: 544 YGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHL 603
           YGIIDINIPQ+LFE  NY  V +SQE+L YLWD+YLKFF  L +VAF+GIGDAY G VHL
Sbjct: 542 YGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVHL 601

Query: 604 LGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSK 663
           LGHRDTRS+VKCAISF DKK L+ +VPL+DE++ DWYFKNSL+FTS  HSCWG+  N++K
Sbjct: 602 LGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANENK 661

Query: 664 KPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706
           K RKK+GRVLK + DGM NI +ERFEEATDFILDSFEEWS+SE
Sbjct: 662 KLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1095 bits (2832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/699 (72%), Positives = 597/699 (85%), Gaps = 5/699 (0%)

Query: 8   KRKLEIDGNDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYH 67
           KRK+E + ND  G++  K+ +++       + +IVP   P +HY PLKT LCYDVRMRYH
Sbjct: 21  KRKME-EQND--GLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYH 77

Query: 68  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATED 127
           AKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSG+D+IG+LMLKIP+REAT++
Sbjct: 78  AKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDE 137

Query: 128 EILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVV 187
           EIL VHSKE++EF++ ++ M RE+LLKETE GDSVY+NNDS VSAKLSCGG I+ACKAVV
Sbjct: 138 EILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVV 197

Query: 188 EGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHG 247
           EGRVKNALAVVRPPGHHAEPE  GGFCLFSNVAVAA+NILK YPESVR+++ILDWDIHHG
Sbjct: 198 EGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHG 257

Query: 248 NGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDA 307
           NGTQ+AFYND RVLY+SLHR+E+G+YYPGT  G Y+Q+GEGKGEGFNCNI W  GGVGDA
Sbjct: 258 NGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDA 317

Query: 308 EYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGN 367
           EYM AFEQIV+PM REFQPDLVIISSGFDAADGDTIGQCHV+P+CYG MTHMLKSLA+GN
Sbjct: 318 EYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGN 377

Query: 368 MCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWD 427
           +CV LEGGYNLD+IA SAL V KVLIGEPPDELPDP K PK EAI  I+TVI  Q+KYW 
Sbjct: 378 LCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQSKYWK 437

Query: 428 CFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDT 487
           CF+ K GN G N+ EPV E++  K+FPLQ+A+RQEQFR+LSKEY FVTLP+  +E+  D+
Sbjct: 438 CFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLEIPDDS 497

Query: 488 IICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGII 547
           ++CSP + +  T++I VHDTPE+WAKR+ +TG IDPSTSIIVD+ L  T W + R YG+I
Sbjct: 498 VLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYGVI 557

Query: 548 DINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHR 607
           D+NIPQSLFE DNYSA++TSQEVL Y+WD+Y+K+F  L +VAFVG GDAY+G VHLLGHR
Sbjct: 558 DVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLGHR 617

Query: 608 DTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRK 667
           DTR+ VK  +SF  +KQL+PLVPLVDES+SDWYFKNSLIFT K H CW    N+SKKPRK
Sbjct: 618 DTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWA--DNESKKPRK 675

Query: 668 KFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706
           KFGRVL+C++DG+N+ +EERFEEATDFILD FEEWSDSE
Sbjct: 676 KFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/675 (73%), Positives = 590/675 (87%), Gaps = 2/675 (0%)

Query: 32  TVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 91
           T ++ KR +IVPV  PKIHY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI
Sbjct: 34  TTSKSKRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRI 93

Query: 92  YKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQ 151
           YKILAENGLI DPTLSGVDD+G+LMLKIP+R AT +EIL VH+KEH+EF+++T  MSRE+
Sbjct: 94  YKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREE 153

Query: 152 LLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAG 211
           LLKETE GDSVY+NNDS  SA+L CGGAIEACKAVVEGRVKN+LAVVRPPGHHAEP+ AG
Sbjct: 154 LLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAG 213

Query: 212 GFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELG 271
           GFCLFSNVAVAA+NILKNYPESVR++MILDWDIHHGNGTQ++FY D++VLYVSLHR+E+G
Sbjct: 214 GFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMG 273

Query: 272 RYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVII 331
           +YYPGT  G Y+Q+GEGKGEGFNCNI W  GGVGDAEYMWAFEQ+V+PMGREF+PDLVII
Sbjct: 274 KYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVII 333

Query: 332 SSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKV 391
           SSGFDAADGDTIGQCHV+P+CYGHMTHMLKSLA+GN+CVVLEGGYNLD+IA+SAL V KV
Sbjct: 334 SSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKV 393

Query: 392 LIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFK 451
           LIGEPPDELPDP   PKPE I  I+ VIR Q+KYW+CF+ +H N G N+ EP+++S+  K
Sbjct: 394 LIGEPPDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISK 453

Query: 452 NFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHDTPEVW 511
           NFPLQ A+RQ+Q   LS E+ FVTLPL+ M+L  +T++C+PNI E++T+II VHDT ++W
Sbjct: 454 NFPLQKAIRQQQQHYLSDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIW 513

Query: 512 AKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELDNYSAVLTSQEVL 571
           AKRN ++G ID S+S+I+D +L    W L R YGIID+NIP +LFE DNYS ++TSQEVL
Sbjct: 514 AKRNVISGTIDLSSSVIIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVL 573

Query: 572 SYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPL 631
            YLWD+Y+K+F  + ++AF+GIGD+YSG VHLLGHRDTR++ K  I+F   KQL+PLVPL
Sbjct: 574 IYLWDNYIKYFPSVAKIAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPL 633

Query: 632 VDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEA 691
           VDE++S+WYFKNSLIF++  H CW  + N+S+KPRKKFGRVL+C++DG+NNI+EERFEEA
Sbjct: 634 VDETLSEWYFKNSLIFSNNSHQCW--KENESRKPRKKFGRVLRCDTDGLNNIIEERFEEA 691

Query: 692 TDFILDSFEEWSDSE 706
           TDFILDSFEEWSD E
Sbjct: 692 TDFILDSFEEWSDEE 706

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1088 bits (2814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/708 (70%), Positives = 599/708 (84%), Gaps = 4/708 (0%)

Query: 1   MNQESKQKRKLE-IDGNDTIGVENMKTAVSKL-TVAQQKRPIIVPVVKPKIHYVPLKTGL 58
           M+ E  +K   E  DGN    +E  K   + L T +  KR +IVP   PKIHY PLKTGL
Sbjct: 1   MDSEIVKKEAWENPDGNLKRRLEETKEDQNSLSTTSNNKRQVIVPACTPKIHYSPLKTGL 60

Query: 59  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLK 118
           CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVDD+G+LMLK
Sbjct: 61  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLK 120

Query: 119 IPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGG 178
           IP+R AT +EIL VH+KEH+EF+++T  MSREQLLKETE GDSVY+NNDS  SA+L CGG
Sbjct: 121 IPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGG 180

Query: 179 AIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           AIEACKAVVEGRVKN+LAVVRPPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVR++M
Sbjct: 181 AIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIM 240

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
           ILDWDIHHGNGTQ++FY D++VLYVSLHR+E+G+YYPGT  G Y+Q+GEGKGEGFNCNI 
Sbjct: 241 ILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNIT 300

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
           W  GGVGDAEYMWAFEQ+V+PMGREF+PDLVIISSGFDAADGDTIGQCHV+P+CYGHMTH
Sbjct: 301 WPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTH 360

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETV 418
           MLKSLA+GN+CVVLEGGYNLD+IA+SAL V KVLIGEPPDELPD    PKPE I  I+ V
Sbjct: 361 MLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKV 420

Query: 419 IREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPL 478
           IR Q+KYW+CF+ +H N G N+ EP+++S+  KNFPLQ A+RQ+Q   LS E+  VTLPL
Sbjct: 421 IRLQSKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPL 480

Query: 479 LDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNW 538
           ++M+L  +T++C+PN++E+ TL++ VHDT ++WAKRN ++G ID S+S+I+D  L    W
Sbjct: 481 INMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKW 540

Query: 539 ALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYS 598
            L R YGIID+NIP SLFE DNYS ++TSQEVL YLWD+Y+K+F  + ++AFVGIGD+YS
Sbjct: 541 GLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYS 600

Query: 599 GFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTE 658
           G VHLLGHRDTR++ K  I+F   KQL+PLVPLVDE++S+WYFKNSLIF++  H CW  +
Sbjct: 601 GIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCW--K 658

Query: 659 GNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706
            N+S+KPRKKFGRVL+C++DG+NN +EERFEEATDFILDSFEEWSD E
Sbjct: 659 ENESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/687 (71%), Positives = 591/687 (86%), Gaps = 3/687 (0%)

Query: 21  VENMKTAVSKL-TVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYID 79
           +EN K   + L T ++ KR +IVP   PKIHY PLKTGLCYDVRMRYHAKIFTSYFEYID
Sbjct: 22  LENTKEDQNSLSTTSRNKRQVIVPACTPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYID 81

Query: 80  PHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVE 139
           PHPEDPRRIYRIYKILAENGLI DPTLSGVDDIG+LMLKIP+R AT +EIL VH+KEH+E
Sbjct: 82  PHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLMLKIPVRAATSEEILEVHTKEHLE 141

Query: 140 FLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVR 199
           F+++T  MSREQLLKETE GDSVY+NNDS  SA+L CGGAIEACKAVVEGRVKN+LAVVR
Sbjct: 142 FIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVR 201

Query: 200 PPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNR 259
           PPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVR++MILDWDIHHGNGTQ++FY D++
Sbjct: 202 PPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQ 261

Query: 260 VLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIP 319
           VLYVSLHR+E+G+YYPGT  G Y+Q+GEGKGEGFNCNI W  GGVGDAEYMWAFEQ+V+P
Sbjct: 262 VLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMP 321

Query: 320 MGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLD 379
           MGREF+PDLVIISSGFDAADGDTIGQCHVSP+CYGHMTHMLKSLA+GN+CVVLEGGYNLD
Sbjct: 322 MGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLD 381

Query: 380 SIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVN 439
           +IA+SAL V KVLIGEPPDELPD    PKPE I  I+ VIR Q+KYW+CF+ +H N G N
Sbjct: 382 AIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCN 441

Query: 440 WKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDT 499
           + EP+++S+  KNFPLQ A+RQ+Q + LS E+ FVTLPL++M L  +T +C+PN+ E++ 
Sbjct: 442 FNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPLINMGLPDNTALCTPNVFESNA 501

Query: 500 LIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELD 559
           L++ VHDT +VWAKRN ++G ID S+S+I+D  +    W L R YGIID+NIP +LFE D
Sbjct: 502 LLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGLDRKYGIIDVNIPLTLFEAD 561

Query: 560 NYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISF 619
           NYS ++TSQEVL YLWD+Y+K+F  + ++AF+GIGD++SG VHLLGHRDTR++ K  I+F
Sbjct: 562 NYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSGIVHLLGHRDTRAVTKTVINF 621

Query: 620 TDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDG 679
              KQL+PLVPLVDE++S+WYFKNSLIF++  H CW  + N+S+KPRKKFGRVL+C++DG
Sbjct: 622 LGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCW--KENESRKPRKKFGRVLRCDTDG 679

Query: 680 MNNILEERFEEATDFILDSFEEWSDSE 706
           ++N +EERFEEATDFILDSFEEWSD E
Sbjct: 680 LSNTIEERFEEATDFILDSFEEWSDDE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1087 bits (2810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/687 (70%), Positives = 591/687 (86%), Gaps = 3/687 (0%)

Query: 21  VENMKTAVSKL-TVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYID 79
           +E MK   + L T ++ KR +IVP   PK+HY PL+TGLCYDVRMRYHAKIFTSYFEYID
Sbjct: 22  LEGMKEEQNSLSTTSKNKRQVIVPACTPKLHYTPLRTGLCYDVRMRYHAKIFTSYFEYID 81

Query: 80  PHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVE 139
           PHPEDPRRIYRIYKILAENGLI DPTLSGVDD+G+LMLKIP+R AT +EIL VH+KEH+E
Sbjct: 82  PHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLE 141

Query: 140 FLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVR 199
           F+++T  MSREQLLKETE GDSVY+NNDS  SA+L CGGAIEACKAVVEGRVKN+LAVVR
Sbjct: 142 FIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVR 201

Query: 200 PPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNR 259
           PPGHHAEP+ AGGFCLFSNVAVAA+NILKNYPESVR++MILDWDIHHGNGTQ++FY D++
Sbjct: 202 PPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQ 261

Query: 260 VLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIP 319
           VLY+SLHR+E+G+YYPGT  G Y+Q+GEGKGEGFNCNI W  GGVGDAEYMWAFEQ+V+P
Sbjct: 262 VLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMP 321

Query: 320 MGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLD 379
           MGREF+PDLVIISSGFDAADGDTIGQCHV+P+CYGHMTHMLKSLA+GN+CVVLEGGYNLD
Sbjct: 322 MGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLD 381

Query: 380 SIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVN 439
           +IA SAL V KVLIGEPPDELPDP   PKPE I  I+ V+R Q+KYW+CF+ +H N G N
Sbjct: 382 AIAISALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVVRLQSKYWNCFRRRHANSGCN 441

Query: 440 WKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDT 499
           + EP+++S+  KNFPLQ A+RQ+Q   LS E+ FVTLPL++MEL  + ++C+PN+ E+ T
Sbjct: 442 FNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINMELPDNIVLCTPNVSESST 501

Query: 500 LIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELD 559
           L++ VHDT +VWAKRN ++G ID S+S+++D  L    W L R YGIID+NIP +LFE D
Sbjct: 502 LLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDRKYGIIDVNIPLTLFEAD 561

Query: 560 NYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISF 619
           NYS ++TSQEVL YLWD+Y+K+F  + ++A++GIGD+YSG VHLLGHRDTR++ K  I+F
Sbjct: 562 NYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVHLLGHRDTRAVTKTVINF 621

Query: 620 TDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDG 679
              KQL+PLVPLVDE++++WYFKNSL+FT+  H CW  + N+S+KPRKKFGRVL+C++DG
Sbjct: 622 LGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCW--KENESRKPRKKFGRVLRCDTDG 679

Query: 680 MNNILEERFEEATDFILDSFEEWSDSE 706
           ++N +EERFEEATDFILDSFEEWSD E
Sbjct: 680 LSNTVEERFEEATDFILDSFEEWSDEE 706

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1086 bits (2809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/676 (73%), Positives = 588/676 (86%), Gaps = 4/676 (0%)

Query: 33  VAQQ--KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR 90
           VA Q  KRP+IVP  K +IHY PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR
Sbjct: 20  VASQDVKRPVIVPTRKAQIHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR 79

Query: 91  IYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSRE 150
           IYKILAENGLI DPTLSGV+DIG+LMLKIPIR AT +EIL VHSKEH+EF++ T  M+RE
Sbjct: 80  IYKILAENGLINDPTLSGVNDIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNRE 139

Query: 151 QLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVA 210
           +LLKETE GDSVY+NNDS  +++L CGGAIEACKAVVEGRVKN+LAVVRPPGHHAEPE A
Sbjct: 140 ELLKETEKGDSVYFNNDSYATSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAA 199

Query: 211 GGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYEL 270
           GGFCLFSNVAVAA+NILKNYPESVR+++ILDWD+HHGNGTQ+AFY+D+RVLY+SLHR+EL
Sbjct: 200 GGFCLFSNVAVAAKNILKNYPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFEL 259

Query: 271 GRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVI 330
           G+YYPGT  G Y+Q GEGKG+GFNCNI W  GGVGDAEYMWAFEQ+V+PMGREFQPDLVI
Sbjct: 260 GKYYPGTIQGQYDQIGEGKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVI 319

Query: 331 ISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVK 390
           ISSGFDAADGDTIGQCHV+P+CYGHMTHMLKSLA+GN+CVVLEGGYNLD+IA SAL V K
Sbjct: 320 ISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAK 379

Query: 391 VLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTF 450
           +LIGEPPDELPDP ++PK EA+  I+ VI  Q+KYW CF  ++GN G+  +  V   +  
Sbjct: 380 ILIGEPPDELPDPLREPKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMS 439

Query: 451 KNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHDTPEV 510
           K+FPLQ+A+RQEQF +LS+++ FVTLPLL+ME+  D++ICSPN+    T+++ VHDTPE+
Sbjct: 440 KSFPLQTAIRQEQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEI 499

Query: 511 WAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELDNYSAVLTSQEV 570
           WAKRN +TG IDPSTS++VD+      W L R YGI+DINIPQSLFE +NY+AVLTSQE+
Sbjct: 500 WAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEI 559

Query: 571 LSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVP 630
           L Y+WD+YLKFF  LT+VAF+GIGDA +G VHLLGHRDTRS+VK  +SF  KK L+PLVP
Sbjct: 560 LIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVP 619

Query: 631 LVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEE 690
           LV+ES+ DWYFKNSL+FT   HSCWG   N+++KPRKKFGRVL+C+++GMNNI+EER EE
Sbjct: 620 LVNESLGDWYFKNSLVFTDHSHSCWGD--NENRKPRKKFGRVLRCDAEGMNNIIEERLEE 677

Query: 691 ATDFILDSFEEWSDSE 706
           +TDFILDSFEEWSDSE
Sbjct: 678 STDFILDSFEEWSDSE 693

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1085 bits (2806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/680 (73%), Positives = 593/680 (87%), Gaps = 2/680 (0%)

Query: 27  AVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR 86
            + K  +  + R IIVP    +IHY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR
Sbjct: 12  TIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPR 71

Query: 87  RIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNT 146
           RIYRIYKILAENGLI+DPTLSG+DDIG+LMLKIP+REAT +EIL VHSKEH++F+++T+ 
Sbjct: 72  RIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSK 131

Query: 147 MSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAE 206
           M+REQLLK TE+GDSVY+N+DS  SAKL  GGAIEACKAVVEGRVKNALAVVRPPGHHAE
Sbjct: 132 MNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAE 191

Query: 207 PEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLH 266
           PE AGGFCLFSNVA+AA+NILKNYPESVRK++ILDWDIHHGNGTQ+AFY+D+R+LYVSLH
Sbjct: 192 PEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLH 251

Query: 267 RYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQP 326
           R+++G+YYPGT +G Y+Q+GEGKGEGFNCNI W  GGVGDAEYMWAFEQIV+PMGREFQP
Sbjct: 252 RFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQP 311

Query: 327 DLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSAL 386
           DLVIIS+GFDAADGDTIGQCHV+P+CYGHMTHMLKSLA+GNM VVLEGGYNLDSIA SAL
Sbjct: 312 DLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISAL 371

Query: 387 GVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDE 446
            V K+LIGEPPDELPD  + PKPE I  I+ V+R Q+KYW CFKSK GN G +++E ++ 
Sbjct: 372 SVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAGCDFQEQINN 431

Query: 447 SLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHD 506
           S+  KNFPLQSA+RQ+Q R LSKE+ F  LP+   EL  DTI+CS NI+E++T+IICVHD
Sbjct: 432 SIATKNFPLQSAIRQQQVRNLSKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHD 491

Query: 507 TPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFELDNYSAVLT 566
           TPE+WAKR+ + G IDPS+SIIVD++L +  WA+ R YG+IDINIPQ+L E +NY +++T
Sbjct: 492 TPEIWAKRDAIQGTIDPSSSIIVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIIT 551

Query: 567 SQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLR 626
           +QEVL  LWD+YLK+F  + ++AFVGIGDAYSG VHLLGHRDTRS+VK  I+F  +KQL+
Sbjct: 552 AQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLK 611

Query: 627 PLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEE 686
           PLVPLVDES+ +WYFKNSL+F++K H  WG + N  KKPRKK+GRVL+C++DG++NI+EE
Sbjct: 612 PLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKEN--KKPRKKYGRVLRCDTDGISNIMEE 669

Query: 687 RFEEATDFILDSFEEWSDSE 706
           RFEEATDFILDSFEEWSDSE
Sbjct: 670 RFEEATDFILDSFEEWSDSE 689

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1081 bits (2795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/689 (70%), Positives = 586/689 (85%)

Query: 18  TIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEY 77
           ++  EN  +     +    KR +IV    PK+ Y PLKTGLCYDVRMRYHAKIFTSYFEY
Sbjct: 5   SVKRENPDSQKPAESSTHSKRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEY 64

Query: 78  IDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEH 137
           IDPHPEDPRRIYRIYKILAENGLI DP LSG+DDIG+LMLKIP+REAT  E+L VHSKEH
Sbjct: 65  IDPHPEDPRRIYRIYKILAENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEH 124

Query: 138 VEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAV 197
           +EF+++   MS ++LLK TE GDSVY+NNDS  SAKLSCGGAIEACKAVVEGRVKNA AV
Sbjct: 125 LEFIESVTKMSHDELLKSTETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAV 184

Query: 198 VRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYND 257
           VRPPGHH+EPE AGGFCLFSNVAVA++NIL+NYPESVR++MILDWDIHHGNGTQ+AFY+D
Sbjct: 185 VRPPGHHSEPESAGGFCLFSNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDD 244

Query: 258 NRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIV 317
           +RVLY+SLHR+ELG+YYPGT  G+Y+++GEGKGEGFNCNI W  GGVGDAEYMWAFEQ+V
Sbjct: 245 DRVLYISLHRFELGKYYPGTAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVV 304

Query: 318 IPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYN 377
           +PM REF+PDLVIIS+GFDAADGDTIGQCHVSP+CYGHMTHMLKSLA GN+CVVLEGGYN
Sbjct: 305 MPMSREFRPDLVIISAGFDAADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYN 364

Query: 378 LDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCG 437
           LD+IA+SAL V KVLIGEPP+EL DP K PKPEAI  I  VIR Q+KYW CF+ +HGN G
Sbjct: 365 LDAIARSALSVAKVLIGEPPEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSG 424

Query: 438 VNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHET 497
             +++ + ES++  NFPLQSA+RQ+QF  LSKE+ FV  PL +M+LS DT+ICSP ++  
Sbjct: 425 CTFEKHMTESISTDNFPLQSAIRQQQFSALSKEFGFVKFPLFEMKLSDDTVICSPEVYNK 484

Query: 498 DTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLFE 557
           DT+II V DTPE+WAKR+ + G IDPS SII D  L+   WA+ R+YG+ID+NIPQSLFE
Sbjct: 485 DTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMERNYGVIDVNIPQSLFE 544

Query: 558 LDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAI 617
            DNYSA++T+QEV+S++WD+Y++FF   +++AFVG+GDA SG VHLLGHRDTRS VK  I
Sbjct: 545 QDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVHLLGHRDTRSKVKSVI 604

Query: 618 SFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNS 677
           +F  +K L+PL+PLVDE++ DWYFKNSL+F+ K H+CWG   N++KKPRKKFGRVL+CNS
Sbjct: 605 NFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENENKKPRKKFGRVLRCNS 664

Query: 678 DGMNNILEERFEEATDFILDSFEEWSDSE 706
           DG+ NI+EERFEEATDF+LDSFEEWS+S+
Sbjct: 665 DGLTNIIEERFEEATDFMLDSFEEWSESD 693

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1056 bits (2731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/674 (71%), Positives = 573/674 (85%), Gaps = 6/674 (0%)

Query: 37  KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 96
           KR +IVP  KP++HY+PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 31  KRQVIVPTKKPQVHYIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 90

Query: 97  ENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKET 156
           ENGLI D  LSGVDDIG++MLKIP+REAT DEIL VHS+EH+EFL++T TM+RE LLKET
Sbjct: 91  ENGLINDTMLSGVDDIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKET 150

Query: 157 EAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 216
           E GDSVY+NNDS +SAKLSCGGAIEACKAVVEG+VKNALAVVRPPGHH+EPE +GGFCLF
Sbjct: 151 EKGDSVYFNNDSYMSAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLF 210

Query: 217 SNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPG 276
           SNVAVAA+NILKNYPESVRK+MILDWDIHHGNGTQ+AFY D RVLYVSLHR+E G+YYPG
Sbjct: 211 SNVAVAAKNILKNYPESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPG 270

Query: 277 TEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFD 336
           T  G Y+Q GEGKGEGFNCNI W  GGVGDAEYMWAFEQIV+PMGREFQPDLVIISSGFD
Sbjct: 271 TVQGQYDQCGEGKGEGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFD 330

Query: 337 AADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEP 396
           AADGD IGQCHV+P+CYGHMTHMLKSLA+GN+ VVLEGGYNLDSIA SAL V K LIGEP
Sbjct: 331 AADGDVIGQCHVTPSCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGEP 390

Query: 397 PDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQ 456
           PDELPDP K PKPEA+  I  VI+ Q+KYW CFK +HGN  +N+ E   ++L  K FPLQ
Sbjct: 391 PDELPDPLKDPKPEALEMIYKVIKIQSKYWKCFKRRHGNYNINFSEVASDTLATKTFPLQ 450

Query: 457 SAVRQEQFRRLSKEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNP 516
           +A+RQ+Q+  L KEY FV  P  +++L  D I+CSPNIH  +T+II VHDTP++W +++ 
Sbjct: 451 TAIRQQQYYNLFKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDI 510

Query: 517 LTGYIDPSTSIIVDTTLSITNWALGRSYGIIDINIPQSLF----ELDNYSAVLTSQEVLS 572
           ++  +DP +SII+D+TL    WA  R YGIID+NIPQSL       DNYS+++ +QE+L 
Sbjct: 511 ISNTVDPCSSIIIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILL 570

Query: 573 YLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLV 632
           +LWD+++KF  ++ ++AF+G+GD+ SG VHLLGHRDT+  VK  I+F   KQL+PLVPLV
Sbjct: 571 FLWDNHIKFLNEVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLV 630

Query: 633 DESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEAT 692
           DES+SDWYFKNSL+F+++ H CWG + N  KKPRKK+GRVL+C++DG+N+ +EERF+EAT
Sbjct: 631 DESLSDWYFKNSLVFSNRTHPCWGDKEN--KKPRKKYGRVLRCDTDGLNSTIEERFDEAT 688

Query: 693 DFILDSFEEWSDSE 706
           DFILDSFEEWSDSE
Sbjct: 689 DFILDSFEEWSDSE 702

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/656 (68%), Positives = 554/656 (84%), Gaps = 2/656 (0%)

Query: 49  IHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSG 108
           + Y PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64

Query: 109 VDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDS 168
           +DDIG+LM KIP+REAT +EIL VH KE +E+L+ T  ++R++LL +TE GDSVY+NNDS
Sbjct: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124

Query: 169 LVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILK 228
             SAKLSCGGAIEACKA+V+G+VKN+LA+VRPPGHH+EPEVAGGFCLFSNVAVA +NILK
Sbjct: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184

Query: 229 NYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEG 288
           NYP+ V+KVMI+DWDIHHGNGTQ+AFYND+RVLYVSLHR+ELG+YYPGT +G Y+Q GEG
Sbjct: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244

Query: 289 KGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHV 348
           KGEGFNCNIPWS GG+GDAEY+WAFEQIV+PMGREF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304

Query: 349 SPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPK 408
           +P+CYGHMTHMLKSLA G +CVVLEGGYNLD+IA+SAL V KVLIGEPPDELP P K PK
Sbjct: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364

Query: 409 PEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLS 468
           PEAI  I+ VI  ++KYW CFK +  N    +K P+ ES   K FP+Q A+R +Q + L+
Sbjct: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424

Query: 469 KEYKFVTLPLLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSII 528
            +Y  V LPL++  L  DT++CS +I +++  II VHDTPE+W+KR+ + G ID S S+ 
Sbjct: 425 NDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLY 484

Query: 529 VDTTLSITNWALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRV 588
           +D +L   +WAL R YGIID+NIPQ+L+E DNYSA LT+QEVL  LWD+ LK+F  + ++
Sbjct: 485 MDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKI 544

Query: 589 AFVGIGDAYSGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFT 648
           A++G+G+AYSG VHLLGHRDTRS+VK  I F  KK L+ LVPLV+ES++DWYFK SL+F 
Sbjct: 545 AYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFA 604

Query: 649 SKYHSCWGTEGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSD 704
            K HSCWG   NDSKKPRK++GRVL+C+SDG+ +++EERFEEATDFI+DS +EW++
Sbjct: 605 DKNHSCWGE--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/709 (63%), Positives = 564/709 (79%), Gaps = 13/709 (1%)

Query: 1   MNQESKQKRKLEIDG---NDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTG 57
           M+++   KRKL+ +    + +IG E       K+     KRP+IVP  KP +HY PLKTG
Sbjct: 1   MSEQIGDKRKLKDESEFPSVSIGDE------GKVIQVLPKRPVIVPTQKPNLHYTPLKTG 54

Query: 58  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLML 117
           +CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+GV DIG+LML
Sbjct: 55  ICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVSDIGDLML 114

Query: 118 KIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCG 177
           KIP+REAT++EIL VH++EH++FL++T  M+RE+LL +TE GDSVY NNDS +SA+LSCG
Sbjct: 115 KIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYISARLSCG 174

Query: 178 GAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKV 237
           GAIEACKAVVEGRVKNALA+VRPPGHHAEP+ AGGFCLFSNV+VAA++ILK YPESVRK+
Sbjct: 175 GAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTYPESVRKI 234

Query: 238 MILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNI 297
           +I+DWDIHHGNGTQ+AFY D+ VLY+SLHR+ELG++YPG   GNY++ G+GKG+GFNCNI
Sbjct: 235 LIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKGKGFNCNI 294

Query: 298 PWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMT 357
            W   GVGD EY+WAFEQIVIPM REF+PDLVI+SSGFDAA GDTIGQCHV+P CYG+MT
Sbjct: 295 TWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTPNCYGYMT 354

Query: 358 HMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIET 417
           HMLKSLA+GN+CVVLEGGYNLDSI+ SAL V K+LIGEPPDE+P+  + PKP  +  I  
Sbjct: 355 HMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPGVLEMINK 414

Query: 418 VIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLP 477
           VIR Q+KYW CF+ K GN G  ++  + ES   K FPLQ A+R  Q      ++  ++L 
Sbjct: 415 VIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQDAIRNAQLSHYYDDFGMISLS 473

Query: 478 LLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITN 537
           L ++ L  ++IICS N  +  +L + +HDTPEVW  R+ +TG IDPSTSII D++L   N
Sbjct: 474 LPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFIN 533

Query: 538 WALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAY 597
           WA+ R   +IDINIP+S FE DNYS+ L SQ+V+  LWD++ K+   L ++ F+GIG+A 
Sbjct: 534 WAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEAT 593

Query: 598 SGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGT 657
           SG VHLLG RDTR++ K AI+F     L+P+VP +DES+ DWYFKNSL+FT  +H CW  
Sbjct: 594 SGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCW-- 651

Query: 658 EGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706
              + KKPRKK+GRVL+C++DG++NI+EERFEEATDFILD+F+EWSD+E
Sbjct: 652 -SENDKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/446 (78%), Positives = 396/446 (88%)

Query: 37  KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 96
           K+ IIVPV  PKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 40  KKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99

Query: 97  ENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKET 156
           ENGLI DPTLSGVD+IG+LMLK+PIREAT +EIL VHS EH ++L+ T+  +REQLLKET
Sbjct: 100 ENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET 159

Query: 157 EAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 216
           E GDSVY+NNDS  SAKLSCGGAIEACKAVVEGRVKNA+AVVRPPGHH+EPE AGGFCLF
Sbjct: 160 ENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLF 219

Query: 217 SNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPG 276
           SNVAVA +NILKNYPESVRKV+ILDWDIHHGNGTQ+AFYND+ VLY+SLHR+ELG+YYPG
Sbjct: 220 SNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPG 279

Query: 277 TEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFD 336
           T  G Y+Q+GEGKGEGFNCNI W  G VGDAEYMWAFEQ+V+PM REFQPDLVIISSGFD
Sbjct: 280 TIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFD 339

Query: 337 AADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEP 396
           AADGDTIGQCHVSP+CYGHMTHMLKSLA+GN+CVVLEGGYNLD+IA+SAL V K+LIGEP
Sbjct: 340 AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGEP 399

Query: 397 PDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQ 456
           PDELPDP K PKPE I  I+ +IR Q+KYW CF+ +HGN G N+KE +++SL  KNFPLQ
Sbjct: 400 PDELPDPLKDPKPEVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQ 459

Query: 457 SAVRQEQFRRLSKEYKFVTLPLLDME 482
           +A+R  Q ++L  E  F+TLP+ + +
Sbjct: 460 TAIRNFQSKKLFDELNFLTLPIKNFQ 485

 Score =  298 bits (764), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 134/224 (59%), Positives = 177/224 (79%), Gaps = 2/224 (0%)

Query: 483 LSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGR 542
           L+ +TI+CSP I  + TL++ VHD+P++W KR+  TG +D S++II+D+TL    W+L R
Sbjct: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633

Query: 543 SYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVH 602
           +YG+IDINIPQ+LFE DNYS++L +QE L   WD+YLK+F  + ++ F+G GDA++G VH
Sbjct: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693

Query: 603 LLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDS 662
           LLGHRDTRS+VK  I+F  KK L+ LVPLVDE++SDWYFKNSL+FT K H  W    N++
Sbjct: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWA--DNEN 751

Query: 663 KKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706
           KKPRKKFGRVL+   DG+ N++EERF+EATDFILDSFEEWSD E
Sbjct: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  507 bits (1305), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 226/298 (75%), Positives = 265/298 (88%)

Query: 37  KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 96
           KR +IVP+ +PK+HY PLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILA
Sbjct: 52  KRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILA 111

Query: 97  ENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKET 156
           ENGLI+D  LSG+DDIG++MLKIP+R ATE+EIL VH++EH++F++   + SRE+L+K T
Sbjct: 112 ENGLIKDENLSGLDDIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLT 171

Query: 157 EAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 216
           E  DSVYYNNDS  SAKLSCGG IEAC+AVVEGRVKN+LA+VRPPGHHAEP+ AGGFCLF
Sbjct: 172 EKADSVYYNNDSYYSAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLF 231

Query: 217 SNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPG 276
           SNV+VAAR+IL+ YPESVRK++ILDWDIHHGNGTQ+AFY D  VLY+SLHRYE   +YPG
Sbjct: 232 SNVSVAARSILRTYPESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPG 291

Query: 277 TEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSG 334
           T +G Y+Q GEGKGEGFNCNI W  GGVGDAEYMWAFE +V+P+GREF+PDLVI+SSG
Sbjct: 292 TIHGRYDQVGEGKGEGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  245 bits (625), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 160/219 (73%), Gaps = 2/219 (0%)

Query: 488 IICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGRSYGII 547
           ++ S  I + +TL+I VHDTPE+W  R+ +TG +DPSTS+++DT++    WA  R+Y I+
Sbjct: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419

Query: 548 DINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVHLLGHR 607
           DINIP+S  E + +S+   + E++  LWD++L++ + LT++ F+GIG++Y G VHL+G R
Sbjct: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479

Query: 608 DTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDSKKPRK 667
           D R + K  I+F     L+ L    DE++ DWYFKNSL+FT+  H+CW  + ++ K+PRK
Sbjct: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCW--KESEEKRPRK 537

Query: 668 KFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706
           KFGRVLK +SDG+ +I+ ERF+EATDFILD+FEEWSD E
Sbjct: 538 KFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 108/372 (29%), Positives = 186/372 (50%), Gaps = 37/372 (9%)

Query: 45  VKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDP 104
           VK K  Y+P + G  Y   + YH     S + Y   HP  P R+     +++  GL    
Sbjct: 8   VKTKETYLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGL---- 63

Query: 105 TLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLK--TTNTMSR--EQLLKETEAGD 160
                     +M     REAT DE+L  HS +++EFL   + +T+S+     L++   GD
Sbjct: 64  --------HKIMDLYETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGD 115

Query: 161 SVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNV 219
                      + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++
Sbjct: 116 DCPIFQGIFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDI 173

Query: 220 AVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEY 279
            +A  N+L+ +P    +V+ +D D+HHG+G Q AFY  +RV  VS H+Y  G ++PGT  
Sbjct: 174 VLAILNLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT-- 226

Query: 280 GNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAAD 339
           G++++ G  +G+ F  N+P    G+ D  Y+  F+ I+ P+   ++P ++I   G D+  
Sbjct: 227 GDFDEIGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLG 285

Query: 340 GDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVK-VLIGE 395
            D +G  +++   +G     +KS     M VV  GGY   N+  +     G++  VL+  
Sbjct: 286 HDRLGCFNLNIRAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWTYETGLLNDVLL-- 342

Query: 396 PPDELPD--PFK 405
            P E+P+  PF+
Sbjct: 343 -PQEIPENIPFR 353

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  141 bits (356), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 101/355 (28%), Positives = 176/355 (49%), Gaps = 33/355 (9%)

Query: 57  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLM 116
           G  Y  R+ YH     S + Y   HP  P R      +++  GL             N+M
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGL------------HNIM 69

Query: 117 LKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKET----EAGDSVYYNNDSLVSA 172
                REAT++E+L  HS+++VEFL   +  +  ++ + T      GD      +     
Sbjct: 70  DLYETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQNIYEYC 129

Query: 173 KLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYP 231
           KL  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 130 KLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRYHP 187

Query: 232 ESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGE 291
               +V+ +D D+HHG+G Q AFY  +RV  VS H+Y  G ++PGT  GNY++ G  +G+
Sbjct: 188 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCAEGK 240

Query: 292 GFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPA 351
            F  N+P +  G+ D  Y+  F+ ++ P+   F+P  +I   G D+   D +G  +++  
Sbjct: 241 HFAMNVPLN-DGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNLNIK 299

Query: 352 CYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVK--VLIGEPPDELP 401
            +G     ++S     M VV  GGY   N+  +     G++   +L  E P+++P
Sbjct: 300 AHGECVKFIRSFGIP-MVVVGGGGYTPRNVSRLYAYETGILNNVLLQSELPEDMP 353

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  139 bits (350), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 103/367 (28%), Positives = 183/367 (49%), Gaps = 38/367 (10%)

Query: 46  KPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPT 105
           +P+ +Y   + G  Y  R+ YH     S + +   HP  P R+           ++ D  
Sbjct: 15  QPQFNY---EFGSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHL 60

Query: 106 LSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLK-----TTNTMSREQLLKETEAGD 160
           +SG   +  +M     R+A++DE+L  H+ +++ FLK       N M R  L K     D
Sbjct: 61  VSGYG-LHKIMDLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDD 119

Query: 161 SVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNV 219
              ++N    S+ L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++
Sbjct: 120 CPIFHNLYEYSS-LYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDI 176

Query: 220 AVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEY 279
            ++  N+L+ +P    +V+ +D D+HHG+G Q AFY  +RV  VS H+Y  G ++PGT  
Sbjct: 177 VLSILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT-- 229

Query: 280 GNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAAD 339
           GNY+++G   G+ F  N+P    G+ D  Y+  F+ I+ P+   + P ++I   G D+  
Sbjct: 230 GNYDETGCSNGKHFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLG 288

Query: 340 GDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVKVLIGEP 396
            D +G  +++   +G     +KS     M VV  GGY   N+  +     G++  ++  P
Sbjct: 289 HDRLGCFNLNIKAHGECVKFVKSFGIP-MLVVGGGGYTPKNVSRLWTYETGILNNVLLSP 347

Query: 397 --PDELP 401
             P ++P
Sbjct: 348 ELPSDIP 354

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  139 bits (349), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 103/356 (28%), Positives = 176/356 (49%), Gaps = 35/356 (9%)

Query: 57  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLM 116
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGLHK------------IM 70

Query: 117 LKIPIREATEDEILLVHSKEHVEFLK-----TTNTMSREQLLKETEAGDSVYYNNDSLVS 171
                REAT++E+   HS ++++FL+     T N + R  L K     D   + N    S
Sbjct: 71  DLYETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFENIYDYS 130

Query: 172 AKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNY 230
             L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 131 T-LYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 231 PESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKG 290
           P    +V+ +D D+HHG+G Q AFY  +RV  +S H+Y  G ++PGT  GNY++ G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 291 EGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 350
           + F  N+P +  G+ D  Y+  F+ I+ P+   +QP ++I   G D+   D +G  +++ 
Sbjct: 241 KHFAMNVPLN-DGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 351 ACYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVK--VLIGEPPDELP 401
             +G     + S     M VV  GGY   N+  +     G++   +L  E P+ELP
Sbjct: 300 KAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEELP 354

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  137 bits (346), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 103/356 (28%), Positives = 174/356 (48%), Gaps = 35/356 (9%)

Query: 57  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLM 116
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL              +M
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIM 72

Query: 117 LKIPIREATEDEILLVHSKEHVEFLKTT-----NTMSREQLLKETEAGDSVYYNNDSLVS 171
                R AT+DE+L  HS ++V FL+       + M R  L K     D   + N    S
Sbjct: 73  DLYETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQNLYDYS 132

Query: 172 AKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNY 230
           A L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 133 A-LYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYH 189

Query: 231 PESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKG 290
           P    +V+ +D D+HHG+G Q AFY  +RV  +S H+Y  G ++PGT  GNY++ G  +G
Sbjct: 190 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCAQG 242

Query: 291 EGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 350
           + F  N+P    G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  +++ 
Sbjct: 243 KHFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLNI 301

Query: 351 ACYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVK--VLIGEPPDELP 401
             +G     ++S     M VV  GGY   N+  +     GV+   +L  E P+++P
Sbjct: 302 KAHGECVKFIRSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLPAELPEDIP 356

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  136 bits (343), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 100/369 (27%), Positives = 179/369 (48%), Gaps = 36/369 (9%)

Query: 45  VKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDP 104
           +KP+  +     G  Y+  + YH     S F Y   HP  P R+     +++  GL    
Sbjct: 14  LKPRFEF-----GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGL---- 64

Query: 105 TLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQL----LKETEAGD 160
                     +M     R AT +E+   H+ ++VEFL   +  +  +L    L++   GD
Sbjct: 65  --------HKIMDLYETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGD 116

Query: 161 SVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNV 219
                      + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++
Sbjct: 117 DCPIFQGLYQYSTLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDI 174

Query: 220 AVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEY 279
            ++  N+L+ +P    +V+ +D D+HHG+G Q AFY  +RV  VS H+Y  G ++PGT  
Sbjct: 175 VLSVLNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT-- 227

Query: 280 GNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAAD 339
           GN +++G  +G+ F  N+P    G+ D  Y+  F+ I+ P+   F+P ++I   G D+  
Sbjct: 228 GNLDETGCSRGKHFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLG 286

Query: 340 GDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIG-EPPD 398
            D +G  +++   +G     +KS     M V+  GGY   ++++       +L G   P 
Sbjct: 287 HDRLGCFNLNVKAHGECVRFVKSFGIP-MLVLGGGGYTPRNVSRLWTYETALLNGVSVPQ 345

Query: 399 ELPD--PFK 405
           E+P+  PF+
Sbjct: 346 EIPEDIPFR 354

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  136 bits (342), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 104/360 (28%), Positives = 176/360 (48%), Gaps = 37/360 (10%)

Query: 57  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLM 116
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL +            +M
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRLMLTDHLVSAYGLHK------------VM 71

Query: 117 LKIPIREATEDEILLVHSKEHVEFLK-----TTNTMSREQLLKETEAGDSVYYNNDSLVS 171
                R AT+DE+   HS+++V FL      T N + R  L K    GD           
Sbjct: 72  DLYETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEK-FNIGDDCPIFQGMFDY 130

Query: 172 AKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNY 230
           A L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 131 AALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYH 188

Query: 231 PESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKG 290
           P    +V+ +D D+HHG+G Q AFY  +RV  VS H+Y  G ++PGT  G+ ++ G  +G
Sbjct: 189 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRG 241

Query: 291 EGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 350
           + F  N+P    G+ D  Y+  F+ I+ P+   F+P ++I   G D+   D +G  +++ 
Sbjct: 242 KHFALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNI 300

Query: 351 ACYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVKVLIGEPPDELPD--PFK 405
             +G     +KS     M VV  GGY   N+  +     G++  ++ +P  +LP+  PF+
Sbjct: 301 KAHGECVRFVKSFGV-PMLVVGGGGYTPRNVSRLWTYETGLLNGVLLQP--KLPEGIPFR 357

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  135 bits (339), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 180/361 (49%), Gaps = 37/361 (10%)

Query: 57  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLM 116
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL              +M
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGL------------HKVM 68

Query: 117 LKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQL----LKETEAGDSVYYNNDSLVSA 172
                R AT++E+L  H++++V+FL      +  +L    L++   GD           +
Sbjct: 69  DLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLFEYS 128

Query: 173 KLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYP 231
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 129 MLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYHP 186

Query: 232 ESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGE 291
               +V+ +D D+HHG+G Q AFY  +RV  VS H+Y  G ++PGT  G+ ++ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 239

Query: 292 GFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPA 351
            F+ N+P +  G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  +++  
Sbjct: 240 HFSLNVPLN-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNIR 298

Query: 352 CYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVK-VLIGEPPDELPD--PFK 405
            +G     +KS     +CV   GGY   N+  +     G++  VL+   P ++P+  PF+
Sbjct: 299 AHGECVKFVKSFGIPMLCVG-GGGYTPRNVSRLWTYETGILNDVLL---PSDIPEDIPFR 354

Query: 406 Q 406
           +
Sbjct: 355 E 355

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  134 bits (337), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 102/367 (27%), Positives = 179/367 (48%), Gaps = 38/367 (10%)

Query: 46  KPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPT 105
           +P+  Y   + G  Y  R+ YH     S + Y   HP  P R+     +++  GL     
Sbjct: 15  QPQFEY---EFGSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGL----- 66

Query: 106 LSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFL-----KTTNTMSREQLLKETEAGD 160
                    +M     REAT +E+   HS++++EFL     +  + M R  L K     D
Sbjct: 67  -------HKIMDLYETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGDD 119

Query: 161 SVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNV 219
              + N    S  L  G +++A + ++    ++ +A+    G HHA+     GFC  +++
Sbjct: 120 CPIFQNIYDYST-LYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDI 176

Query: 220 AVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEY 279
            ++  N+L+ +P    +V+ +D D+HHG+G Q AFY  +RV  +S H++  G ++PGT  
Sbjct: 177 VLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT-- 229

Query: 280 GNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAAD 339
           G++++ G  KG+ F  N+P    G+ D  Y+  F+ I+ P+   ++P ++I   G D+  
Sbjct: 230 GDFDEIGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLG 288

Query: 340 GDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVK--VLIG 394
            D +G  +++   +G     +KS     M VV  GGY   N+  +     GV+   +L  
Sbjct: 289 HDRLGCFNLNIKAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLPS 347

Query: 395 EPPDELP 401
           E P+E+P
Sbjct: 348 EIPEEIP 354

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  134 bits (336), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 99/358 (27%), Positives = 174/358 (48%), Gaps = 37/358 (10%)

Query: 59  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLK 118
            Y  R+ YH     S++ Y   HP  P R+     +++  GL              +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDL 70

Query: 119 IPIREATEDEILLVHSKEHVEFLKTTNTMSREQL----LKETEAGDSVYYNNDSLVSAKL 174
              R AT DE+L  HS+++V FL   +  +  +L    L+    GD      +      L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 175 SCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPES 233
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 234 VRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGF 293
             +++ +D D+HHG+G Q AFY  +RV  +S H+Y  G ++PGT  G+  + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 294 NCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACY 353
             N+P    G+ D  Y+  F+ IV P+   F+P L++   G D+   D +G  +++   +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 354 GHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVK-VLIGEPPDELPD--PFK 405
           G     +KS     M VV  GGY   N+  +     G++  VL+   P+++P+  PF+
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGYTPRNVSRLWTYETGILNDVLL---PEDIPEDIPFR 354

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  133 bits (335), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 101/372 (27%), Positives = 180/372 (48%), Gaps = 37/372 (9%)

Query: 45  VKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDP 104
           VK K +    +    Y  R+ YH     S++ Y   HP  P R+     +++  GL +  
Sbjct: 9   VKTKENQSSFEFNSAYSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK-- 66

Query: 105 TLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQL----LKETEAGD 160
                     +M     R AT DE+L  HS++++ FL   +  +  +L    L+    GD
Sbjct: 67  ----------IMDLYETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGD 116

Query: 161 SVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNV 219
                 +      L  G +++A + ++    ++ +A+    G HHA+     GFC  +++
Sbjct: 117 DCPIFQNLYDYTTLYTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDI 174

Query: 220 AVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEY 279
            ++  N+L+ +P    +++ +D D+HHG+G Q AFY  +RV  +S H+Y  G ++PGT  
Sbjct: 175 VLSILNLLRYHP----RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT-- 227

Query: 280 GNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAAD 339
           G+  + G  KG+ F  N+P    G+ D  Y+  F+ IV P+   F+P L++   G D+  
Sbjct: 228 GDLTEIGCDKGKHFALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLG 286

Query: 340 GDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVK-VLIGE 395
            D +G  +++   +G     +KS     M VV  GGY   N+  +     G++  VL+  
Sbjct: 287 HDRLGCFNLNIKAHGECVKFVKSFGLP-MLVVGGGGYTPRNVSRLWTYETGILNDVLL-- 343

Query: 396 PPDELPD--PFK 405
            P+++P+  PF+
Sbjct: 344 -PEDIPENIPFR 354

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 101/361 (27%), Positives = 179/361 (49%), Gaps = 37/361 (10%)

Query: 57  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLM 116
           G  Y  R+ YH     S++ Y   HP  P R+           ++ D  +SG   +  +M
Sbjct: 21  GSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGYG-LHKIM 68

Query: 117 LKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQL----LKETEAGDSVYYNNDSLVSA 172
                R+AT +E+   HS+++V FL      +  +L    L++   GD      +    +
Sbjct: 69  DLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIFPNIFQYS 128

Query: 173 KLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYP 231
            L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 129 SLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAILNLLRYHP 186

Query: 232 ESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGE 291
               +V+ +D D+HHG+G Q AFY  +RV  +S H+Y  G ++PGT  G  +++G   G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDETGCADGK 239

Query: 292 GFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPA 351
            F  N+P    G+ D  Y+  F+ I+ P+   F+P +++   G D+   D +G  +++  
Sbjct: 240 HFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLGCFNLNIK 298

Query: 352 CYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVV-KVLIGEPPDELPD--PFK 405
            +G     ++S     M VV  GGY   N+  +     G++  VL+   P+ELPD  PFK
Sbjct: 299 AHGECVKFVRSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVLL---PEELPDNLPFK 354

Query: 406 Q 406
           +
Sbjct: 355 E 355

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/330 (27%), Positives = 161/330 (48%), Gaps = 28/330 (8%)

Query: 59  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLK 118
            Y  R+ YH     S++ Y   HP  P R+     +++  GL +            +M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IMDL 70

Query: 119 IPIREATEDEILLVHSKEHVEFLKTTNTMSREQL----LKETEAGDSVYYNNDSLVSAKL 174
              R AT DE+L  HS+++V FL   +  +  +L    L+    GD      +      L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 175 SCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPES 233
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 234 VRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGF 293
             +++ +D D+HHG+G Q AFY  +RV  +S H+Y  G ++PGT  G+  + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 294 NCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACY 353
             N+P    G+ D  Y+  F+ IV P+   F+P L++   G D+   D +G  +++   +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 354 GHMTHMLKSLAKGNMCVVLEGGYNLDSIAK 383
           G     +KS     M VV  GGY   ++++
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGYTPRNVSR 329

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 101/367 (27%), Positives = 176/367 (47%), Gaps = 33/367 (8%)

Query: 45  VKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDP 104
           VK K      + G  Y  R+ YH     S + Y   HP  P R+     +++  GL    
Sbjct: 9   VKTKSEQPLFEFGSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRLLLTDHLVSSYGL---- 64

Query: 105 TLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQL----LKETEAGD 160
                     +M     R AT +EI   H++++++FL      +  ++    L++   GD
Sbjct: 65  --------HKIMDLYETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGD 116

Query: 161 SVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNV 219
                 +     KL  G +++A + ++    ++ +A+    G HHA+     GFC  +++
Sbjct: 117 DCPIFQNLFNYCKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDI 174

Query: 220 AVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEY 279
            +A  N+L+ +P    +V+ +D D+HHG+G Q AFY  +RV  VS H+Y  G ++PGT  
Sbjct: 175 VLAILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT-- 227

Query: 280 GNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAAD 339
           GN+++ G   G+ F  N+P    G+ D  Y+  F+ I+ P+   ++P ++I   G D+  
Sbjct: 228 GNHDEVGCANGKHFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLG 286

Query: 340 GDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVK--VLIG 394
            D IG  +++   +G     ++S     M VV  GGY   N+  +     GV+   +L  
Sbjct: 287 HDRIGCFNLTIKGHGECVKFIRSFGIP-MLVVGGGGYTPRNVSRLWAYETGVLNNVLLSK 345

Query: 395 EPPDELP 401
           E P+E+P
Sbjct: 346 ELPEEIP 352

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  132 bits (331), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 99/357 (27%), Positives = 175/357 (49%), Gaps = 31/357 (8%)

Query: 57  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLM 116
           G  +   + YH     S F Y   HP  P R+     +++  GL +            +M
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGLHK------------IM 68

Query: 117 LKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQL----LKETEAGDSVYYNNDSLVSA 172
                R AT +E+   HS+++VEFL   +  +  +L    L++   GD           +
Sbjct: 69  DLYETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQYS 128

Query: 173 KLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYP 231
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYHP 186

Query: 232 ESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGE 291
               +V+ +D D+HHG+G Q AFY  +RV  VS H+Y  G ++PGT  GN ++ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRGK 239

Query: 292 GFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPA 351
            F  N+P    G+ D  Y+  F+ I+ P+   F+P ++I   G D+   D +G  +++  
Sbjct: 240 HFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 352 CYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGE-PPDELPD--PFK 405
            +G     +KS     M VV  GGY   ++++       +L G   P+E+P+  PF+
Sbjct: 299 AHGECVKYVKSFGL-PMLVVGGGGYTPRNVSRLWAYETGLLNGVLLPEEIPEGIPFR 354

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  131 bits (330), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 102/364 (28%), Positives = 180/364 (49%), Gaps = 39/364 (10%)

Query: 54  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIG 113
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL +           
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGLHK----------- 65

Query: 114 NLMLKIPIREATEDEILLVHSKEHVEFLK-----TTNTMSREQLLKETEAGDSVYYNNDS 168
            +M     R AT +E+   HS+E+V+F+K       N + R  L K     D   + N  
Sbjct: 66  -IMDLYETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLY 124

Query: 169 LVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNIL 227
             S+ L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L
Sbjct: 125 DYSS-LYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLL 181

Query: 228 KNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGE 287
           + +P    +V+ +D D+HHG+G Q AFY  +RV  VS H+Y  G ++PGT  GN+++ G 
Sbjct: 182 RYHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGC 234

Query: 288 GKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCH 347
            +G+ F  N+P    G+ D  Y+  F+ I+ P+   ++P +++   G D+   D +G  +
Sbjct: 235 ARGKHFALNVPLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFN 293

Query: 348 VSPACYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVV-KVLIGEPPDELPD- 402
           ++   +G   + ++S     M VV  GGY   N+  +     G++  VL+   P +LP+ 
Sbjct: 294 LNVKAHGECVNFVRSFGLP-MLVVGGGGYTPRNVSRLWTYETGILNNVLL---PKDLPEG 349

Query: 403 -PFK 405
            PF+
Sbjct: 350 IPFR 353

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  132 bits (331), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 90/337 (26%), Positives = 167/337 (49%), Gaps = 28/337 (8%)

Query: 52  VPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDD 111
           +P + G  Y  ++ YH     S + Y   HP  P R+     +++  GL           
Sbjct: 52  LPFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKPFRLMLTDHLVSCYGL----------- 100

Query: 112 IGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQL----LKETEAGDSVYYNND 167
              +M     REAT++E+L  H+ +++EFL      +  +L    L++   GD       
Sbjct: 101 -HKIMDLYETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIFQG 159

Query: 168 SLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNI 226
               + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  ++
Sbjct: 160 MFDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISL 217

Query: 227 LKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSG 286
           L+ +P    +V+ +D D+HHG+G Q AFY  +RV  VS H+Y  G ++PGT  G+ ++ G
Sbjct: 218 LRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIG 270

Query: 287 EGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQC 346
             KG+ F+ N+P    G+ D  Y+  F+ I+ P+   ++P ++I   G D+   D +G  
Sbjct: 271 CSKGKKFSLNVPLQ-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCF 329

Query: 347 HVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAK 383
           +++   +G     +KS     +CV   GGY   ++++
Sbjct: 330 NLNIKAHGECVKFVKSFGIPILCVG-GGGYTPRNVSR 365

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  130 bits (328), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 104/394 (26%), Positives = 188/394 (47%), Gaps = 48/394 (12%)

Query: 24  MKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPE 83
           M    +  T+   K+P+          Y P         R+ YH     S + Y   HP 
Sbjct: 1   MSATFAYDTLTAAKQPLFEESFDNSSSYTP---------RVSYHFNPKVSNYHYGVKHPM 51

Query: 84  DPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFL-- 141
            P R+     +++  GL +            +M     R AT +E++  HS+++++FL  
Sbjct: 52  KPFRLMLTDHLVSSYGLHK------------IMDLYETRPATNEEMVQFHSEDYLDFLSK 99

Query: 142 ---KTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVV 198
              +  + M R  L K     D   + N    S  L  G +++A + ++    ++ +A+ 
Sbjct: 100 VTPENLSKMPRGTLEKFNIGDDCPIFQNLYDYST-LYTGASLDATRKLIND--QSDIAIN 156

Query: 199 RPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYND 257
              G HHA+     GFC  +++ ++  N+L+ +P    +V+ +D D+HHG+G Q AFY  
Sbjct: 157 WSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP----RVLYIDIDLHHGDGVQEAFYTT 212

Query: 258 NRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIV 317
           +RV  +S H++  G ++PGT  G+Y+++G  KG+ F  N+P    G+ D  Y+  F+ I+
Sbjct: 213 DRVFTISFHKFN-GEFFPGT--GDYDETGCAKGKHFAMNVPLE-DGIDDDSYINLFKSIM 268

Query: 318 IPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGY- 376
            P+   ++P +++   G D+   D +G  +++   +G     +KS     M VV  GGY 
Sbjct: 269 DPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKGHGECVKFIKSFGIP-MLVVGGGGYT 327

Query: 377 --NLDSIAKSALGVV-KVLIGEPPDELPD--PFK 405
             N+  +     G++  VL+   P+ELP+  PF+
Sbjct: 328 PRNVSRLWTYETGILNNVLL---PNELPEGIPFR 358

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  129 bits (325), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 97/357 (27%), Positives = 173/357 (48%), Gaps = 37/357 (10%)

Query: 60  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKI 119
           Y  R+ YH     S++ Y   HP  P R+     +++  GL              +M   
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGL------------HKIMDLY 71

Query: 120 PIREATEDEILLVHSKEHVEFLKTTNTMSREQL----LKETEAGDSVYYNNDSLVSAKLS 175
             R AT+DE+   H++++V FL   +  +  +L    L+    GD      +      L 
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 176 CGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESV 234
            G  ++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 235 RKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFN 294
            +V+ +D D+HHG+G Q AFY  +RV  +S H+Y  G ++PGT  G+  + G  KG+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 295 CNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYG 354
            N+P    G+ D  Y+  F+ IV P+   F+P +++   G D+   D +G  +++   +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 355 HMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVK-VLIGEPPDELPD--PFK 405
                +KS     M VV  GGY   N+  +     G++  VL+   P+++P+  PF+
Sbjct: 302 ECVKFVKSFGLP-MLVVGGGGYTPKNVSRLWAYETGILNDVLL---PEDIPENIPFR 354

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  129 bits (325), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 97/357 (27%), Positives = 176/357 (49%), Gaps = 33/357 (9%)

Query: 54  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIG 113
            + G    +R+ YH     S++ Y   HP  P R+           ++ D  +SG   + 
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGYG-MH 66

Query: 114 NLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQL----LKETEAGDSVYYNNDSL 169
            +M     R AT DE+   H++++V FL+  +  +  +L    L++   GD      +  
Sbjct: 67  KVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 170 VSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILK 228
             A L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+
Sbjct: 127 DYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 229 NYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEG 288
            +P    +V+ +D D+HHG+G Q AFY  +RV  +S H+Y  G ++PGT  G+ +++G  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCD 237

Query: 289 KGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHV 348
            GE F  N+P    G+ D  Y+  F+ ++ P+   + P ++I   G D+   D +G  ++
Sbjct: 238 AGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNL 296

Query: 349 SPACYGHMTHMLKSLAKGNMCVVLEGGY---NLDSIAKSALGVVKVLIGEPPDELPD 402
           +   +G     +KS     M VV  GGY   N+  +     GV+  +I   P +LP+
Sbjct: 297 NIKAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWAYETGVLNDVI--LPKDLPE 350

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  128 bits (322), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y      S + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   HS E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G    +G GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ D  Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMLVVGGGGYTMRNVART 321

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  127 bits (319), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL ++            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G    +G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  127 bits (319), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G     G GKG+ ++ N+P
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE +V  +   +QP  V++ +G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 129 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G    +G GKG+ +  N+P
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 239 LR-DGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 298 YVKSFGI-PMMVVGGGGYTMRNVART 322

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y      S + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G    +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ D+ Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMLVVGGGGYTMRNVART 321

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G    +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 FVKSFGIPLM-VVGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  126 bits (317), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G    +G GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  126 bits (317), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/325 (26%), Positives = 154/325 (47%), Gaps = 26/325 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMI 239
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    +V+ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 240 LDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPW 299
           +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G    +G GKG+ ++ N+P 
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 300 SCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHM 359
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  + 
Sbjct: 239 R-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNY 297

Query: 360 LKSLAKGNMCVVLEGGYNLDSIAKS 384
           +KS     M VV  GGY + ++A++
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  126 bits (316), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G    +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M +V  GGY + ++A++
Sbjct: 297 FVKSFGL-PMMIVGGGGYTMRNVART 321

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  126 bits (316), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 154/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E+   +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  ++S   +    +
Sbjct: 238 LR-DGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  126 bits (316), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY+ +RV+  S H+Y  G ++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE +V  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  126 bits (316), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY+ +RV+  S H+Y  G ++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   +G+  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  126 bits (316), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/325 (26%), Positives = 153/325 (47%), Gaps = 26/325 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      +     KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMI 239
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    +V+ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 240 LDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPW 299
           +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G    +G GKG+ ++ N+P 
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVPL 238

Query: 300 SCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHM 359
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  + 
Sbjct: 239 R-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVNY 297

Query: 360 LKSLAKGNMCVVLEGGYNLDSIAKS 384
           +KS     M VV  GGY + ++A++
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  125 bits (314), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 154/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  125 bits (314), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 88/325 (27%), Positives = 152/325 (46%), Gaps = 26/325 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMI 239
           +E    +  G+   A+       HHA+   A GFC  +++ +    +L+ +P    +V+ 
Sbjct: 128 MEGAARLNRGKCDVAINYAGGL-HHAKKSEASGFCYLNDIVLGIIELLRYHP----RVLY 182

Query: 240 LDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPW 299
           +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G     G GKG+ +  N+P 
Sbjct: 183 IDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVPL 238

Query: 300 SCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHM 359
              G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  + 
Sbjct: 239 R-DGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVNY 297

Query: 360 LKSLAKGNMCVVLEGGYNLDSIAKS 384
           +KS     M VV  GGY + ++A++
Sbjct: 298 VKSFGI-PMMVVGGGGYTMRNVART 321

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  125 bits (313), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 154/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  124 bits (312), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 87/326 (26%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G    +G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M +V  GGY + ++A++
Sbjct: 297 YMKSFGVPLM-IVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  124 bits (310), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 153/326 (46%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  124 bits (310), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 153/326 (46%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        + Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA Y   FE ++  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  122 bits (306), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 153/326 (46%), Gaps = 28/326 (8%)

Query: 63  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIPIR 122
           R+ Y        F Y   HP  P RI   + ++   GL +             M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 123 EATEDEILLVHSKEHVEFLKTTNTMSREQLLKET---EAGDSVYYNNDSLVSAKLSCGGA 179
            AT+ E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 180 IEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVM 238
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    +V+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 239 ILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIP 298
            +D D+HHG+G + AFY  +RV+  S H+Y  G ++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 299 WSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTH 358
               G+ DA +   FE +V  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 359 MLKSLAKGNMCVVLEGGYNLDSIAKS 384
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 97/182 (53%), Gaps = 11/182 (6%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HHA  + A GFC  +++ +  + + +   +  +K+  +D+D+HHG+G ++AF   + V  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGR 322
           +SLH +E+G ++PGT  GN ++S + +      NIP    G+ D       EQIV P+  
Sbjct: 263 ISLHLFEVG-FFPGT--GNLSESDKRRNV---VNIPL-LHGLDDTSLEQLIEQIVKPVIE 315

Query: 323 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGH-MTHMLKSLAKGNMCVVLEGGYNLDSI 381
             +PD+++I  G D   GD   +  +S       +T ++ +     + ++  GGYN+  +
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNVTLM 375

Query: 382 AK 383
           ++
Sbjct: 376 SR 377

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 91/176 (51%), Gaps = 11/176 (6%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HHA  + A GFC  ++V +  + + K     + KV  LD+D+HHG+G ++AF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGR 322
           +S+H YE G ++PGT  G+ N S  GK      NIP    G  D        +I+ P+ +
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI---VNIPLK-HGCDDNYLNLVASKIIHPLIK 321

Query: 323 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGH-MTHMLKSLAKGNMCVVLEGGYN 377
              P+++I+  G D   GD   +  ++       + +++KS  + ++ ++  GGYN
Sbjct: 322 RHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 92/176 (52%), Gaps = 11/176 (6%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HHA  + A GFC  ++V +  + + K     + K+  +D+D+HHG+G +RAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGR 322
           +S+H YE G ++PGT  G+ N + +GK      NIP    G  D+       +I+ P+ +
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV---VNIPLK-HGCDDSYLDLVASKIISPLIK 321

Query: 323 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGH-MTHMLKSLAKGNMCVVLEGGYN 377
              PD++II  G D   GD   +  ++       + +++K   + ++ ++  GGYN
Sbjct: 322 RHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN 377

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 121/257 (47%), Gaps = 19/257 (7%)

Query: 170 VSAKLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILK 228
           V  ++  G  +   K +     +  +AV    G HHA    A GFC  +++ +  + +  
Sbjct: 199 VYCQVIVGATLSLAKHITAVANERTIAVNWDGGRHHALRNKASGFCYINDIVLLIQQLRS 258

Query: 229 NYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEG 288
           N     +++  +D+D+HHG+G QR+F     V  +S H +E G ++P T  G+  +S  G
Sbjct: 259 N---GYKRITYIDFDLHHGDGVQRSFQYSTSVQTISAHMFEPG-FFPCT--GSLKESKMG 312

Query: 289 KGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHV 348
           K      NIP    GV D       E+++IP  + + P++++I  G D   GD   +  +
Sbjct: 313 KNI---VNIPL-LHGVDDMLMNEIVEKVMIPCVKRYDPEILVIQCGGDGLIGDGYAEWQL 368

Query: 349 SPACYGHMTHMLKSLAKGNMCVVL---EGGYNLDSIAKSALGVVKVLIGEPPDE--LPDP 403
           +   +G + ++LK L     C V+    GGYN   +++    +   ++ E  ++  L  P
Sbjct: 369 T--IHGLVNNILKLLRIFPGCPVVLLGGGGYNETVMSRFYTYLTWKIVDEYSNKKSLKKP 426

Query: 404 FKQPKPEAIATIETVIR 420
           F Q K E I   +  I+
Sbjct: 427 F-QAKEERIHDKDRSIK 442

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 94/202 (46%), Gaps = 12/202 (5%)

Query: 178 GAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRK 236
           GA          R +  ++V    G HHA    A GFC  +++A+  + + +     + K
Sbjct: 198 GATIKLARYASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIAILIQKLRR---RGIHK 254

Query: 237 VMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCN 296
           +  LD+D+HHG+G +RAF +   V  +S+H YE G ++PGT  G    +  G+      N
Sbjct: 255 ISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT--GTLKDASSGRNI---VN 308

Query: 297 IPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVS-PACYGH 355
           IP    G+ D        ++VIP      P++VII  G D   GD   +  ++       
Sbjct: 309 IP-VLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTDT 367

Query: 356 MTHMLKSLAKGNMCVVLEGGYN 377
           +  +++     N+ ++  GGYN
Sbjct: 368 IMKVVEDFPSSNIVLLGGGGYN 389

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 99/207 (47%), Gaps = 16/207 (7%)

Query: 174 LSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPES 233
           +S G  +   + ++EG  +          HH+    A GFC  +++A+    + +     
Sbjct: 174 VSTGATLSLAQYILEGSERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG---G 230

Query: 234 VRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGF 293
           V ++  +D+D+HHG+G ++AF    +V  +SLH YE G ++P +     N SG+      
Sbjct: 231 VDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCSGSLEDNSSGKSI---- 285

Query: 294 NCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACY 353
             NIP    G+ D+      ++I++P   + QP++++I  G D   GD   +  +S    
Sbjct: 286 -VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQLSIK-- 341

Query: 354 GHMTHMLKSLAKGNMCVVL---EGGYN 377
             +T  + SL +   C ++    GGYN
Sbjct: 342 -GLTSTITSLIEQFNCHIVLLGGGGYN 367

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 88/176 (50%), Gaps = 12/176 (6%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HH+    A GFC  +++ +A + + +N+      +  +D+D+HHG+G +RAF     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFS----NISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGR 322
           +SLH +E G ++PGT  G+   S +G       NIP   G   D   M   E +VIP  +
Sbjct: 298 ISLHNHEPG-FFPGT--GSMESSQDGHS---IINIPLRHGADDDC-LMKITESVVIPCIQ 350

Query: 323 EFQPDLVIISSGFDAADGDTIGQCHVS-PACYGHMTHMLKSLAKGNMCVVLEGGYN 377
           +  P +++I  G D   GD   +  ++       +  +L SL   ++ ++  GGYN
Sbjct: 351 KHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYN 406

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 104/204 (50%), Gaps = 12/204 (5%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HHA    A GFC  +++A+  + + +     +R++  +D+D+HH +G +RAF +   V  
Sbjct: 221 HHASRSRASGFCYINDIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQT 277

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGR 322
           +S+H +E G ++PGT  G+  ++  GK      NIP    G+ D       +++++P  R
Sbjct: 278 ISVHLHEPG-FFPGT--GSLKEASVGKNV---VNIPVQ-HGMDDTFLNQIVQRVIMPCIR 330

Query: 323 EFQPDLVIISSGFDAADGDTIGQCHVS-PACYGHMTHMLKSLAKGNMCVVLEGGYNLDSI 381
              P++++I  G D   GD   +  ++      ++ ++++     N+ ++  GGYN   +
Sbjct: 331 SHNPEVLVIQCGGDGLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYNERLM 390

Query: 382 AKSALGVV-KVLIGEPPDELPDPF 404
           ++    +  KV+     + L DPF
Sbjct: 391 SRFYTYLTWKVVEFSRGEGLKDPF 414

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 110/231 (47%), Gaps = 24/231 (10%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HHA    A GFC  +++ +  + + K   +   KV  LD+D+HHG+G +RAF    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGR 322
           +SLH YE G ++P T       S EG       N+P    G+ D+      +Q+V P+ +
Sbjct: 263 ISLHLYEPG-FFPCT------GSLEGSSGFDTVNLPLQ-HGLTDSFLQGLVDQVVNPLIQ 314

Query: 323 EFQPDLVIISSGFDAADGDTIGQCHVS----PACYGHMTHMLKSLAKGNMCVVLEGGYNL 378
              P++++I  G D   GDT  +  +S      C   +  ++    + ++ ++  GGYN 
Sbjct: 315 RHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKC---ILDVMSHSTQAHVILLGGGGYNP 371

Query: 379 DSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCF 429
             +++    +   ++ +  +  P P      E     E++IR+  KY +C+
Sbjct: 372 TLMSRFYTYLTGRILHQFKNTDPFPGMNGAQE-----ESLIRDH-KYIECY 416

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 98/210 (46%), Gaps = 19/210 (9%)

Query: 173 KLSCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYP 231
           +++ G  +   K +V       + +    G HHA  + A GFC  +++ +  + + KN  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 232 ESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGE 291
              +K+  LD+D+HHG+G ++AF     +  +SLH +E G ++PGT           KG 
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPGT------GGLSNKGS 297

Query: 292 GFNCNIPWSCGGVGDAEYMWAF-EQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 350
               +IP S G   D  Y++   +QI+IP       + +++  G D   GD   +  ++ 
Sbjct: 298 RDLIDIPLSHGLTDD--YLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTI 355

Query: 351 ACYGHMTHMLKSLAKGNMCVVL---EGGYN 377
              G    ++  + K + C ++    GGYN
Sbjct: 356 K--GLTQCIIDVIGKFSDCQIVLLGGGGYN 383

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 93/177 (52%), Gaps = 13/177 (7%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HH+  + A GFC  +++ +    I K   +  RK+  LD+D+HHG+G +++F     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFN-CNIPWSCGGVGDAEYMWAFEQIVIPMG 321
           +S+H +E G ++P T       S E    GFN  NIP +  G+ D    +   +++IP+ 
Sbjct: 356 ISVHLFEPG-FFPCT------GSLEETKHGFNIVNIP-TLHGLDDNYLTYLLNRVIIPLI 407

Query: 322 REFQPDLVIISSGFDAADGDTIGQCHVS-PACYGHMTHMLKSLAKGNMCVVLEGGYN 377
           ++ +P+ +++  G D   GD   +  ++      ++  +L++  + ++ ++  GGYN
Sbjct: 408 KKHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYN 464

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 91/176 (51%), Gaps = 11/176 (6%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HHA  + A GFC  ++V +  + + K     + K+  LD+D+HHG+G ++AF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGR 322
           +S+H YE G ++PGT  G+ + S  GK      NIP    G  D+       +I+ P+  
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV---VNIPLK-HGCDDSYLNLIASKIINPLID 319

Query: 323 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGH-MTHMLKSLAKGNMCVVLEGGYN 377
           +  P+++II  G D   GD   +  ++       + + +K  ++ ++ ++  GGYN
Sbjct: 320 KHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 90/176 (51%), Gaps = 11/176 (6%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HHA  + A GFC  ++V +  + + K     + K+  +D+D+HHG+G ++AF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGR 322
           +S+H YE G ++PGT  G+ + S + K      NIP    G  D        +IV P+  
Sbjct: 267 ISVHLYEPG-FFPGT--GSLSDSRKDKNV---VNIPLK-HGCDDNYLELIASKIVNPLIE 319

Query: 323 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGH-MTHMLKSLAKGNMCVVLEGGYN 377
             +P+ +II  G D   GD   +  ++       + +++KS  + ++ ++  GGYN
Sbjct: 320 RHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 116/243 (47%), Gaps = 15/243 (6%)

Query: 139 EFLKTTNTMSREQLL--KETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALA 196
           E+ +  N+  R+Q +  K    GD   ++   L    +S G ++     + +   +  +A
Sbjct: 157 EYFQINNSRERQQDVYKKFNLEGDCPLFSFLPLYCEVIS-GASLMLSDFIEKSSSQRTIA 215

Query: 197 VVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFY 255
           +    G HHA    A GFC  +++ +  + + K   + + KV  +D+D+HHG+G ++AF 
Sbjct: 216 INWDGGRHHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFR 272

Query: 256 NDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQ 315
             + +  +S+H YE G ++P T  G+   +  GK      N+P    GV D        +
Sbjct: 273 YSSNIQTISMHMYEPG-FFPCT--GSLEDTLNGKNI---VNVPLY-HGVDDNYMTEIVNE 325

Query: 316 IVIPMGREFQPDLVIISSGFDAADGDTIGQCHVS-PACYGHMTHMLKSLAKGNMCVVLEG 374
           ++ P+     P++++I  G D   GD   +  ++      ++ ++++   K ++ ++  G
Sbjct: 326 LIKPLIERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGG 385

Query: 375 GYN 377
           GYN
Sbjct: 386 GYN 388

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 97/203 (47%), Gaps = 14/203 (6%)

Query: 178 GAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRK 236
           GA  +    ++   + ++A+    G HHA    A GFC  +++ +  + I KN     + 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 237 VMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCN 296
           +  +D+D+HHG+G Q+AF     V  VSLH +E G ++P T         E K      N
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCT-----GSLQEAKAGSSIVN 299

Query: 297 IPWSCGGVGDAEYMWAF-EQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVS-PACYG 354
           IP   G   D  ++    + I+IP+  + +P++++I  G D   GD   +  ++     G
Sbjct: 300 IPLLHG--LDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSG 357

Query: 355 HMTHMLKSLAKGNMCVVLEGGYN 377
            +  ++ +    ++ ++  GGYN
Sbjct: 358 AIMKLINTFPSCSVVLLGGGGYN 380

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 90/178 (50%), Gaps = 15/178 (8%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HHA  + A GFC  +++ +    I K   +  +++  +D+D+HHG+G +RAF   + V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGR 322
           +S+H +E G ++P +  G+   + +GK      NIP +  G+ D        Q+VIP+  
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NIPLA-HGLNDEYLNEIVTQVVIPLTD 304

Query: 323 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVL---EGGYN 377
              P ++II  G D   GD   +  ++    G   ++LK + +   C ++    GGYN
Sbjct: 305 RHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYN 360

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 116/272 (42%), Gaps = 47/272 (17%)

Query: 175 SCGGAIEACKAVVEGRVKNALAVVRPPG-HHAEPEVAGGFCLFSNVAVAARNILKNYPES 233
           +  GA  A    +     +ALAV    G HHA    A GFC  +++A+  + + +   + 
Sbjct: 164 TVAGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QG 220

Query: 234 VRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGF 293
             +V  +D+D+HHG+G + AF     V   SLH +E G ++PGT            G   
Sbjct: 221 FLRVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPGT------------GACK 267

Query: 294 NC------NIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCH 347
           NC      N+P    GV D+      + IV P  +   P+++II  G D   GD  G+  
Sbjct: 268 NCTDNSVLNVPL-LHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQ 326

Query: 348 VSPACYGHMTHMLKSLAK---GNMCVVLEGGYN----------LDSIAKSALGVVKVLIG 394
           +S   +G   ++LK +       + ++  GGYN          L S+  +    +   IG
Sbjct: 327 LS--IHGLTRNILKLVQAHKFKKIALLGGGGYNGRLQSRFYAYLTSMLLAQCKGIPTEIG 384

Query: 395 EPPDELPDPFKQPKPEAIATIETVIREQAKYW 426
           +  DEL    +         IE   +E  K+W
Sbjct: 385 DDEDELIRDHE--------LIEMYEQEDYKFW 408

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 115/298 (38%), Gaps = 70/298 (23%)

Query: 158 AGDSVYYNNDSLVSAKLSCGGAIEACKAVVEG----RVKN-ALAVVRPPGHHAEPEVAGG 212
           AGD +Y ++ ++ + + S G       ++  G     + N A   +RPPGHH   +   G
Sbjct: 145 AGD-IYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAFVAIRPPGHHCHVDTPSG 203

Query: 213 FCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQ--------------------- 251
           FCL +N  +A       Y   +   +ILD+D+HHG+GTQ                     
Sbjct: 204 FCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDICWKRAGFRTEAEPETTEGY 261

Query: 252 ----RAFYNDNRVLYVSLHRYELGRYYPGTEYG---NYNQSGEGKGEGFNCNI------P 298
               + F    +V Y S+H  ++  +   ++Y    N   +        + NI      P
Sbjct: 262 DEFGKKFAEFPKVGYFSMH--DINSFPTESQYATKENIRNASTCVMNAHDVNIWNIHLSP 319

Query: 299 WSCGGVGDAEYMWAFEQIVI--------------PMGREFQPDLVIISSGFDAADGDTIG 344
           W      D  Y   +  +                 +G+ FQ  LV+IS+GFDA++ +   
Sbjct: 320 WETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQ-GLVVISAGFDASEFEQTS 378

Query: 345 QCHVSPACYGHMTHMLKSLA--------KGNMCVVLEGGYNLDSIAKSALGVVKVLIG 394
               S     H   M    A         G +  ++EGGY+  +IA    GV   LIG
Sbjct: 379 MQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDKAIAS---GVFSHLIG 433

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 89/333 (26%), Positives = 137/333 (41%), Gaps = 75/333 (22%)

Query: 129 ILLVHSKEHVEFLKTTNTMSREQLLK-ETEAGDS-----VYYNNDSLVSAKLSCGGAIEA 182
           +L VH ++    L      + E+L K E E  DS     +Y ++ ++ + + S G     
Sbjct: 108 VLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDSWNSGDIYLSSKTIEALQGSIGALETG 167

Query: 183 CKAVVEG----RVKN-ALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKV 237
             ++ EG     V N A  V+RPPGHH       GFCL +N  V+       Y   +   
Sbjct: 168 VDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITHA 225

Query: 238 MILDWDIHHGNGTQ-------------------------RAFYNDNRVLYVSLHRYELGR 272
           ++LD+D+HHG+GTQ                         + F    RV Y S+H  ++  
Sbjct: 226 VVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMH--DINS 283

Query: 273 YYPGTEYG---NYNQSGEGKGEGFNCNI------PWSCGGVGDAEY------MWA----- 312
           +   + Y    N   +      G + NI       W      +  Y      ++A     
Sbjct: 284 FPTESGYATKDNIKSASTCIMNGHDLNIWNVHLSAWETEEDFNKLYQSKYRTLFAKADEF 343

Query: 313 FEQIVIPM---GREFQPDLVIISSGFDAADGDTIG-QCH---VSPACYGHMTHMLKSLAK 365
           F+   I M   G++F+  LV+IS+GFDA++ + +  Q H   V    Y   T     LA+
Sbjct: 344 FKNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKLAQ 402

Query: 366 ----GNMCVVLEGGYNLDSIAKSALGVVKVLIG 394
               G +  VLEGGY+  +I     GV   LIG
Sbjct: 403 MHSEGKVLSVLEGGYSDKAITS---GVFAHLIG 432

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 83/176 (47%), Gaps = 11/176 (6%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HHA    A GFC  +++ +  +++ +   +  ++V  +D+D+H+G+G  +AF     V  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGR 322
           +S+H YE G ++PGT  G+  ++   K      N+P    G+ D   +     ++ P+  
Sbjct: 250 ISVHLYEPG-FFPGT--GSLEETRNSKQM---VNLP-VLHGMDDKYLLELISSVITPLIE 302

Query: 323 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVL-EGGYN 377
            F  + ++I  G D   GD   +  +S     H    +  + +     +L  GGYN
Sbjct: 303 TFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGGGYN 358

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 127/300 (42%), Gaps = 68/300 (22%)

Query: 155 ETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKN-----ALAVVRPPGHHAEPEV 209
           E   GD +Y   +++ + + S G       ++ +G V       A   +RPPGHH+    
Sbjct: 141 EWNVGD-IYLCEETVYALRGSIGAVEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAAT 199

Query: 210 AGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQ-----------------R 252
             GFCL +N  +A       Y   V   +ILD+D+HHG+GTQ                 +
Sbjct: 200 PSGFCLLNNAHIAVEYAADTY--GVTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAK 257

Query: 253 AFYND--------NRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKG---EGFNCNI---- 297
             YN+         +V Y S+H  ++  +     Y + ++  +      +  + NI    
Sbjct: 258 GEYNEFDKKFAEFPKVGYFSMH--DINSFPTELNYASKDKVKDASTCIMDAHDVNIWNIH 315

Query: 298 --PWSCGGVGDAEY------MWA-----FEQIVIPMGREFQP--DLVIISSGFDAADGDT 342
             P+      +  Y      ++A     F+   + M ++ +P   LV++S+GFDA++ + 
Sbjct: 316 LLPYETEEEFNKLYQTRYRTLFAKADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQ 375

Query: 343 IG-QCH---VSPACYGHMTHMLKSLAK----GNMCVVLEGGYNLDSIAKSALGVVKVLIG 394
           +  Q H   V  + Y   T     LA+    G +  +LEGGY+  +IA    GV   LIG
Sbjct: 376 VSMQRHGVNVPTSFYSTFTKDALKLAQMHTNGKIISLLEGGYSDAAIAS---GVFSHLIG 432

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 120/310 (38%), Gaps = 74/310 (23%)

Query: 194 ALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQ-- 251
           A   +RPPGHH+      GFCL +N  +A       Y   V    ILD+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 252 ---------------RAFYND--------NRVLYVSLHRYELGRYYPGTEYG-------- 280
                           A Y+D         +V Y SLH       +P TE G        
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDIN---SFP-TEQGYAHKTSIK 297

Query: 281 ---------------NYNQSGEGKGEGFN--CNIPWSCGGVGDAEYMWAFEQIVIPMGRE 323
                          N + +     E FN      +        E++   ++ +   G+ 
Sbjct: 298 DASVCIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKN 357

Query: 324 FQPDLVIISSGFDAADGDTIGQ----CHVSPACYGHMTHMLKSLA----KGNMCVVLEGG 375
           ++  L+IIS+GFDA++ + +       HV  + Y   T     LA    +G +  +LEGG
Sbjct: 358 YK-GLIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGG 416

Query: 376 YNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGN 435
           Y   S A    GV   LIG     + +    P+  +   I+ V R     W  +K+K   
Sbjct: 417 Y---SDAALVSGVFSHLIG-----MQNQNWIPEWGSAQVIKEVCRGCRPNWKAYKTKRSR 468

Query: 436 CGV-NWKEPV 444
             + NW E V
Sbjct: 469 DVIRNWAEEV 478

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 86/333 (25%), Positives = 131/333 (39%), Gaps = 75/333 (22%)

Query: 129 ILLVHSKE-HVEFLKTTNTMSREQLLKETE------AGDSVYYNNDSLVSAKLSCGGAIE 181
           +L VH K+   + L+       +   KE E      AGD +Y ++ ++ + + S G    
Sbjct: 106 VLKVHGKDWPPQLLRLCKEADAKLAAKEVEVPASWNAGD-IYLSSKTVEALQGSIGALET 164

Query: 182 ACKAVVEG----RVKN-ALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRK 236
           A  ++ +G     + N A   +RPPGHH       GFCL +N  VA       +   V  
Sbjct: 165 AVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRF--GVTH 222

Query: 237 VMILDWDIHHGNGTQ-------------------------RAFYNDNRVLYVSLHRYELG 271
             ILD+D+HHG+GTQ                         + F    RV Y S+H  ++ 
Sbjct: 223 AAILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYDSFGKKFAEYPRVGYFSMH--DIN 280

Query: 272 RYYPGTEYG---NYNQSGEGKGEGFNCNI------PWSC----GGVGDAEYMWA------ 312
            +   + Y    N   +        + NI      PW        +   +Y         
Sbjct: 281 SFPTESGYATKENVKNASTCIMNAHDVNIWNIHLSPWETEEDFAKLYHTKYRSLFVKADE 340

Query: 313 -FEQIVIPMGREFQP--DLVIISSGFDAADGD-TIGQCHVSPACYGHMTHMLKSLAK--- 365
            F+Q  I M  + +P   LV+ISSGFDA++ + T  Q H +       T   K   K   
Sbjct: 341 FFKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQRHGTNVPTYFYTAFTKDALKLSQ 400

Query: 366 ----GNMCVVLEGGYNLDSIAKSALGVVKVLIG 394
               G +  ++EGGY+  +I     GV   LIG
Sbjct: 401 MHCHGKVLSIMEGGYSDKAIVS---GVFAHLIG 430

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 100/229 (43%), Gaps = 18/229 (7%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLY 262
           HHA    A GFC  +++ +  + + KN      +V  +D+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 263 VSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGR 322
            SLH +E G ++PGT  G++    E        NIP    G+ D       + I+IP   
Sbjct: 252 CSLHLFEAG-FFPGT--GSFKNCRETNV----VNIPL-FHGLDDESLDEIVDNILIPCVN 303

Query: 323 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLK--SLAKGNMCVVLEGGYNLDS 380
           +  P++++I  G D   GD   +  ++   +G   ++LK   +      V+L GG    +
Sbjct: 304 KHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGGGYNPT 361

Query: 381 IAKSALGVVKVLIGEPPDELPDPFKQPKPEAIA---TIETVIREQAKYW 426
           +       V V + +    +P      + E I     I+   +E  K+W
Sbjct: 362 LQSRFYTYVTVCLLKYHKGIPSLISDSEDEHIIEHHLIDFYRKEAYKFW 410

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 87/336 (25%), Positives = 137/336 (40%), Gaps = 82/336 (24%)

Query: 129 ILLVHSKEHVEFLKTTNTMSREQLL-KETEAGDS-----VYYNNDSLVSAKLSCGGAIEA 182
           +L VH  +  + L      S E+L  K+ E  D      +Y +  ++ + + S G     
Sbjct: 109 VLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGDIYLSQQTIAALEGSIGALETG 168

Query: 183 CKAVVEGR-----VKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKV 237
             ++ +G         A   VRPPGHH+      GFCL +N  +A       +  +V   
Sbjct: 169 IDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--NVTHA 226

Query: 238 MILDWDIHHGNGTQ-----RAFYNDN-------------------RVLYVSLHRY----- 268
           ++LD+D+HHG+GTQ     RA +N +                   +V Y S+H       
Sbjct: 227 VVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDEFGKKFAEFPKVGYFSMHDINSFPT 286

Query: 269 ELGRYYPGTEYGNYNQSGEGKGEGFNCNIPW----------------------SCGGVGD 306
           ELG  Y   E  N   +        + NI W                      S     D
Sbjct: 287 ELG--YATKE--NIKNASTCIMNAHDLNI-WNVHLSHYETEEDFVKLYQSKYRSLFAKAD 341

Query: 307 AEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIG-QCH--VSPACYGHM-THMLKS 362
            E+    ++ +   G++F+  LV+IS+GFDA++ +    Q H    P C+ +M T     
Sbjct: 342 -EFFKNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKDALK 399

Query: 363 LAK----GNMCVVLEGGYNLDSIAKSALGVVKVLIG 394
           LA+    G +  V+EGGY+  +I+    GV   LIG
Sbjct: 400 LAQMHTSGKVLSVMEGGYSDGAISS---GVFSHLIG 432

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (51%), Gaps = 8/99 (8%)

Query: 158 AGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGR-----VKNALAVVRPPGHHAEPEVAGG 212
           AGD +Y N+D++++ K S G       ++  G         A   +RPPGHH    +  G
Sbjct: 145 AGD-IYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAFVAIRPPGHHCHVGMPSG 203

Query: 213 FCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQ 251
           FCL +N  +        Y   V  V++LD+D+HHG+GTQ
Sbjct: 204 FCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 18/146 (12%)

Query: 308 EYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIG----QCHVSPACYGHMTHMLKSL 363
           E+  A +  +  MG+ ++  LV+ISSGFDA++ + +       +V    Y   T     L
Sbjct: 346 EFFKAAKLEMASMGKPYK-GLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKL 404

Query: 364 AK----GNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVI 419
           A+    G +  ++EGGY+  +I     GV   LIG    +  D  K+   E +  ++ ++
Sbjct: 405 AQMHCHGKVISIMEGGYSDKAITS---GVFAHLIGL---QNQDWIKEWGSEQV--VKEIV 456

Query: 420 REQAKYWDCFKSKHGNCGVN-WKEPV 444
           R     W  +K+K  +  +  W E V
Sbjct: 457 RGCKPTWKPYKTKRNDDVIRVWAEEV 482

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 108/256 (42%), Gaps = 62/256 (24%)

Query: 194 ALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQ-- 251
           A   +RPPGHH +     GFCL +N  ++      +Y   +   +ILD+D+HHG+GTQ  
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 252 -----------------------RAFYNDNRVLYVSLHRYELGRYYPGTEYG---NYNQS 285
                                  + F    +V Y S+H  ++  +   T Y    N   +
Sbjct: 245 CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMH--DINSFPTETGYATKVNIRNA 302

Query: 286 GEGKGEGFNCNI------PWSC----GGVGDAEY--MWA-----FEQIVIPMGREFQP-- 326
                +G + NI      PW+       +  ++Y  ++A     F      M +E +P  
Sbjct: 303 STCIMDGHDLNIWNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFK 362

Query: 327 DLVIISSGFDAADGD-TIGQCH---VSPACYGHMTHMLKSLA----KGNMCVVLEGGYNL 378
            LV+IS+GFDA++ + T  Q H   V    Y   T     LA    +G +  +LEGGY+ 
Sbjct: 363 GLVVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSD 422

Query: 379 DSIAKSALGVVKVLIG 394
            ++     GV   LIG
Sbjct: 423 KALTS---GVFAHLIG 435

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 106/267 (39%), Gaps = 70/267 (26%)

Query: 187 VEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHH 246
           VE     A   +RPPGHH+      GFCL +N  +A       Y   V   ++LD+D+HH
Sbjct: 178 VEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVTHAVVLDFDLHH 235

Query: 247 GNGTQ-------------------------RAFYNDNRVLYVSLHRY-----ELGRYYPG 276
           G+GTQ                         + F    +V Y SLH       ELG  Y  
Sbjct: 236 GDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDINSFPTELG--YAT 293

Query: 277 TEYGNYNQSGEGKGEGFNCNIPWSC-----------GGVGDAEYMWAF----------EQ 315
            E  N   +     +  + NI W+              +   +Y   F          +Q
Sbjct: 294 KE--NVRNAATCIMDAHDVNI-WNVHLQSYDSDEAFTKLYQTKYRTLFAKADEYFRTAKQ 350

Query: 316 IVIPMGREFQPDLVIISSGFDAADGDTIG-QCH---VSPACYGHMTHMLKSLAK----GN 367
            +  +G+ F+  LV+IS+GFDA++ +    Q H   V    Y   T     LA+    G 
Sbjct: 351 NMRALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLAQMHSHGK 409

Query: 368 MCVVLEGGYNLDSIAKSALGVVKVLIG 394
           +  VLEGGY+  +I+    GV   LIG
Sbjct: 410 LLSVLEGGYSDGAISS---GVFAHLIG 433

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 129/306 (42%), Gaps = 70/306 (22%)

Query: 151 QLLKETEAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEG----RVKN-ALAVVRPPGHHA 205
           ++ KE  AGD +Y ++ +L + + + G        +  G     + N    VVRPPGHH 
Sbjct: 136 EVPKEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVVRPPGHHC 194

Query: 206 EPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQ-----RAFYNDN-- 258
                 GFCL +N  ++       Y   V    ILD+D+HHG+GTQ     RA +  +  
Sbjct: 195 HVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQDICWKRAGFKPDGA 252

Query: 259 --------------------RVLYVSLHRYELGRYYPGTEYG---NYNQSGEGKGEGFNC 295
                               +V Y S+H  ++  +   + Y    N   +     +  + 
Sbjct: 253 TREENEEPYDDFGKRTAAFPKVGYFSMH--DINSFPTESGYATSENIRNASTCIMDSHDL 310

Query: 296 NI------PWSCG----GVGDAEY--MWA-----FEQIVIPMGREFQP--DLVIISSGFD 336
           NI      PW+       +  ++Y  ++A     F+   + M ++  P   LV+IS+GFD
Sbjct: 311 NIWNVHLAPWATEEDFMKLYRSKYRTLFAKADEYFKTARLEMQKQGTPFKGLVVISAGFD 370

Query: 337 AADGD-TIGQCH---VSPACYGHMTHMLKSLA----KGNMCVVLEGGYNLDSIAKSALGV 388
           A++ + T  Q H   V    Y   T  +  LA    +G +  V+EGGY+  +I     GV
Sbjct: 371 ASEFEQTSMQRHSVNVPTEFYTLFTKDVLKLAQMHTQGKVLSVMEGGYSDKAITS---GV 427

Query: 389 VKVLIG 394
              LIG
Sbjct: 428 FAHLIG 433

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 83/336 (24%), Positives = 128/336 (38%), Gaps = 78/336 (23%)

Query: 127 DEILLVHSKEHV-EFLKTTNTMSREQLLKETEAGDS-----VYYNNDSLVSAKLSCGGAI 180
           D +L VH  +   E LK      +     E E  +S     +Y +  ++ + + S G   
Sbjct: 109 DHVLKVHGADWPHELLKLCQQSQKALDRGEVEVPESWNVGDIYLSQQTIGALEGSIGALE 168

Query: 181 EACKAVVEGRV-----KNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVR 235
               ++  G         A   +RPPGHH+      GFCL +N  +A       Y  +V 
Sbjct: 169 TGIDSIFAGPTPEETSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVT 226

Query: 236 KVMILDWDIHHGNGTQ------------------------RAFYNDNRVLYVSLHRY--- 268
             ++LD+D+HHG+GTQ                        + F    +V Y S+H     
Sbjct: 227 HAVVLDFDLHHGDGTQDICWKRAGFKPDECADSGEFDEFGKKFAEYPKVGYFSVHDINSF 286

Query: 269 --ELGRYYPGTEYGNYNQSGEGKGEGFNCNI------PWSCGGVGDAEYMWAF------- 313
             ELG  Y   E  N   +     +  + NI      P+         Y   +       
Sbjct: 287 PTELG--YATKE--NIRNAATCIMDAHDVNIWNVHLQPYDSEEAFTKLYQTKYRTLFAKA 342

Query: 314 -------EQIVIPMGREFQPDLVIISSGFDAADGDTIG-QCH---VSPACYGHMTHMLKS 362
                  +Q +  +G+ F+  LV+IS+GFDA++ +    Q H   V    Y   T     
Sbjct: 343 DEFFRISKQTMKALGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDALK 401

Query: 363 LAK----GNMCVVLEGGYNLDSIAKSALGVVKVLIG 394
           LA+    G +  V+EGGY+  +I     GV   LIG
Sbjct: 402 LAQMHSHGKVLSVMEGGYSDGAITS---GVFAHLIG 434

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 94/384 (24%), Positives = 154/384 (40%), Gaps = 82/384 (21%)

Query: 129 ILLVHSKEHVEFLKTTNTMSREQLLK-ETEAGDS-----VYYNNDSLVSAKLSCGGAIEA 182
           +L VH       L     M+  +LLK E E  D+     +Y ++ ++ + + + G     
Sbjct: 110 VLKVHGSSWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 183 CKAVVEG----RVKN-ALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKV 237
             ++ +G     + N A   +RPPGHH       GFCL +N  VA       Y  +V  V
Sbjct: 170 VDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 238 MILDWDIHHGNGTQ------------------------RAFYNDNRVLYVSLHRYELGRY 273
           ++LD+D+HHG+GTQ                        + F    +V Y S+H       
Sbjct: 228 VVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMHDIN---S 284

Query: 274 YPGTEYG-----NYNQSGEGKGEGFNCNI------PWSCGGVGDAEYMWAFEQIV----- 317
           +P TE G     N   +        + NI       W+     +  Y   +  +      
Sbjct: 285 FP-TESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADE 343

Query: 318 ------IPMGREFQP--DLVIISSGFDAADGD-TIGQCH---VSPACYGHMTHMLKSLAK 365
                 + M ++ +P   LV+IS+GFDA++ + T  Q H   V  + Y   T     LA+
Sbjct: 344 FFRSAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQ 403

Query: 366 ----GNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIRE 421
               G +  ++EGGY+  +I     GV   LIG    +  D  K+   E +  ++ ++R 
Sbjct: 404 MHCHGKVLSLMEGGYSDKAICS---GVFAHLIGL---QNQDWVKEWGSEQV--VKEIVRG 455

Query: 422 QAKYWDCFKSKHGNCGVN-WKEPV 444
               W  +K+K     +  W E V
Sbjct: 456 CKPAWKPYKTKRAKDVIRIWAEEV 479

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (48%), Gaps = 13/134 (9%)

Query: 129 ILLVHSKEHVEFLKTTNTMSREQLLK-ETEAGDS-----VYYNNDSLVSAKLSCGGAIEA 182
           +L VH       L     M+  +LLK E E  D+     +Y ++ ++ + + + G     
Sbjct: 110 VLKVHGSHWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 183 CKAVVEG----RVKN-ALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKV 237
             ++ EG     + N A   +RPPGHH       GFCL +N  VA       Y  +V  V
Sbjct: 170 VDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 238 MILDWDIHHGNGTQ 251
           ++LD+D+HHG+GTQ
Sbjct: 228 VVLDFDLHHGDGTQ 241

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 187 VEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHH 246
           VE     A   +RPPGHH+      GFCL +N  +A     + Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 247 GNGTQ 251
           G+GTQ
Sbjct: 234 GDGTQ 238

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 59/116 (50%), Gaps = 13/116 (11%)

Query: 147 MSREQLLK-ETEAGDS-----VYYNNDSLVSAKLSCGGAIEACKAVVEG----RVKN-AL 195
           M+  +LLK E E  D+     +Y ++ ++ + + + G       ++ +G     + N A 
Sbjct: 128 MADAKLLKGEIEVPDTWNSGDIYLSSKTIQALQGTIGAIETGVDSIFKGPSPEHISNRAF 187

Query: 196 AVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQ 251
             +RPPGHH       GFCL +N  VA       Y   V  V++LD+D+HHG+GTQ
Sbjct: 188 VAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTHVVVLDFDLHHGDGTQ 241

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 144/351 (41%), Gaps = 80/351 (22%)

Query: 158 AGDSVYYNNDSLVSAKLSCGGAIEACKAVVEG----RVKN-ALAVVRPPGHHAEPEVAGG 212
           +GD +Y ++ ++ + + S G    A  ++ +G     + N A   +RPPGHH       G
Sbjct: 144 SGD-IYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSG 202

Query: 213 FCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQ-----RAFYNDN--------- 258
           FC+ +N  VA      +Y   V  V +LD+D+HHG+GTQ     RA +  +         
Sbjct: 203 FCVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQDICWKRAGFKPDEETKENEEY 260

Query: 259 -----------RVLYVSLHRYELGRYYPGTEYG-----NYNQSGEGKGEGFNCNI----- 297
                      RV Y S+H       +P TE G     N   +        + NI     
Sbjct: 261 DGFGKKLAEFPRVGYFSMHDI---NSFP-TESGFATKENIKNASTCIMNSHDLNIWNIHL 316

Query: 298 -PWS----CGGVGDAEYMWAFEQI----------VIPMGREFQPDLVIISSGFDAADGDT 342
             WS       +  ++Y   F +           +  MG+ F+  L+++S+GFDA++ + 
Sbjct: 317 SSWSNEEEFSKLYRSKYRLLFAKADEFFKTAKSEMADMGKPFK-GLILLSAGFDASEFEQ 375

Query: 343 -IGQCH---VSPACYGHMTHMLKSLA----KGNMCVVLEGGYNLDSIAKSALGVVKVLIG 394
              Q H   V    Y   T     LA    +G +  ++EGGY+  +I     GV   LIG
Sbjct: 376 KTMQRHSVNVPTEFYTMFTKDALKLAQMHCQGKVLSLMEGGYSDKAITS---GVFAHLIG 432

Query: 395 EPPDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVN-WKEPV 444
               +  D  K+   E +  ++ ++R     W  +K+K     +  W E V
Sbjct: 433 L---QNQDWIKEWGSEHV--VKEIVRGCKPAWKPYKTKRSKDVIRVWAEEV 478

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 77/299 (25%), Positives = 120/299 (40%), Gaps = 73/299 (24%)

Query: 158 AGDSVYYNNDSLVSAKLSCGGAIEACKAVVEG----RVKNALAV-VRPPGHHAEPEVAGG 212
           AGD +Y  + ++ + + + G       ++  G     + N + V +RPPGHH       G
Sbjct: 142 AGD-IYLTSRTIEALQGTIGAVETGVDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSG 200

Query: 213 FCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQ--------------------- 251
           FCL +N  +        Y   V   +ILD+D+HHG+GTQ                     
Sbjct: 201 FCLLNNAHIGIEYAADKY--GVTHAVILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYD 258

Query: 252 ---RAFYNDNRVLYVSLHRYELGRYYPGTEYG-----NYNQSGEGKGEGFNCNI------ 297
              + F    +V Y S+H       +P TE G     N   +        + NI      
Sbjct: 259 EFGKKFAEFPKVGYFSMHDI---NSFP-TESGFATKENIKNASTCIMNSHDLNIWNVHLS 314

Query: 298 PWSC----GGVGDAEYMWAFEQI----------VIPMGREFQPDLVIISSGFDAADGD-T 342
            WS       +  ++Y   F +           +  +G+ F+  LV+IS+GFDA++ + T
Sbjct: 315 RWSTEEEFAKIYKSKYRTLFAKADEFFKNSKNEMNELGKPFK-GLVVISAGFDASEFEQT 373

Query: 343 IGQCH---VSPACYGHMTHMLKSLA----KGNMCVVLEGGYNLDSIAKSALGVVKVLIG 394
             Q H   V  + Y   T     LA    +G +  +LEGGY+  +I     GV   LIG
Sbjct: 374 SMQRHSVNVPTSFYTMFTKDALKLAQMHCQGKVLSLLEGGYSDKAITS---GVFSHLIG 429

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 8/99 (8%)

Query: 158 AGDSVYYNNDSLVSAKLSCGGAIEACKAVVEG----RVKN-ALAVVRPPGHHAEPEVAGG 212
           AGD +Y ++ ++ + + + G       ++ +G     + N A   +RPPGHH       G
Sbjct: 144 AGD-IYLSSKTIQALQGTIGALETGVDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSG 202

Query: 213 FCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQ 251
           FCL +N  VA       Y   V  V +LD+D+HHG+GTQ
Sbjct: 203 FCLLNNAHVAIEYAADTY--GVTHVAVLDFDLHHGDGTQ 239

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 67/146 (45%), Gaps = 18/146 (12%)

Query: 308 EYMWAFEQIVIPMGREFQPDLVIISSGFDAADGD-TIGQCH---VSPACYGHMTHMLKSL 363
           EY    +  +  +GR F+  +V+IS+GFDA++ + T  Q H   V    Y   T     L
Sbjct: 343 EYFKTAKLEMAALGRPFK-GMVLISAGFDASEFEQTTMQRHGSNVPTEFYTMFTKDALKL 401

Query: 364 A----KGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVI 419
           A    +G +  ++EGGY+  +I     GV   LIG    +  D  K+   E +  I+ ++
Sbjct: 402 AQMHCQGKVLSLMEGGYSDKAITS---GVFAHLIGL---QNQDWIKEWGSEHV--IKEIV 453

Query: 420 REQAKYWDCFKSKHGNCGVN-WKEPV 444
           R     W  +K+K     +  W E V
Sbjct: 454 RGCKPAWKPYKTKRSKDVIRIWAEEV 479

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 52/99 (52%), Gaps = 8/99 (8%)

Query: 158 AGDSVYYNNDSLVSAKLSCGGAIEACKAVVEG----RVKN-ALAVVRPPGHHAEPEVAGG 212
           +GD +Y +++++ + + S G       ++  G     + N A   +RPPGHH       G
Sbjct: 146 SGD-IYLSSETIKAIEGSIGALELGLDSIFHGPSAEHISNRAFVAIRPPGHHCHVSTPSG 204

Query: 213 FCLFSNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQ 251
           FCL +N  +A     + Y   V   +ILD+D+HHG+GTQ
Sbjct: 205 FCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQ 241

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 44/83 (53%), Gaps = 12/83 (14%)

Query: 320 MGREFQPDLVIISSGFDAADGD-TIGQCH---VSPACYGHMTHMLKSLAK----GNMCVV 371
           M + F+  LV+IS+GFDA++ + T  Q H   V  + Y   T     LA+    G +  V
Sbjct: 360 MNKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSV 418

Query: 372 LEGGYNLDSIAKSALGVVKVLIG 394
           LEGGY+  +IA    GV   LIG
Sbjct: 419 LEGGYSDKAIAS---GVFSHLIG 438

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (47%), Gaps = 12/124 (9%)

Query: 138 VEFLKTTNTMSREQLLKETEAGDS-----VYYNNDSLVSAKLSCGGAIEACKAVVEG--- 189
            E +K       + L  E E  D+     +Y ++ ++ + + + G       ++ +G   
Sbjct: 120 AELIKLCQEADSKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETGVDSIFKGPSP 179

Query: 190 -RVKN-ALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMILDWDIHHG 247
             + N A   +RPPGHH       GFCL +N  VA       Y  +V  V++LD+D+HHG
Sbjct: 180 EHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHG 237

Query: 248 NGTQ 251
           +GTQ
Sbjct: 238 DGTQ 241

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 117/272 (43%), Gaps = 40/272 (14%)

Query: 203 HHAEPEVAGGFCLFSNVAVAARNILKNYPESV---RKVMILDWDIHHGNGTQRAFYNDNR 259
           HHA    A GFC  +++ V+  N L+  P      RK+  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 260 VLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFN-CNIPWSCGGVGDAEYMWAFEQIVI 318
           +  +S+H +E G +YP T    +     GK +  N  N+P    G+ ++        I+I
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNIINLPVK-HGLSNSNMFELVTNIII 317

Query: 319 PMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHMLKSLAK----------GNM 368
           P+    Q D ++I  G D  + D   +  ++    G    ++K +A            N+
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLT--IIGLTRCIIKIIAAFVGPHQPGSCKNV 375

Query: 369 CVVLEGGYN--------------LDSIAKSALGVVKVLIGE-PPDELPDPFKQPKPEAIA 413
            ++  GGYN              +  +A         L  E P   + D  K+   +   
Sbjct: 376 VLLGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHE 435

Query: 414 TIETVIREQAKYWDCFKSKHGNCGVNWKEPVD 445
            I+   +E  KYW C++ ++G  G+++K  ++
Sbjct: 436 HIDEYEKEYYKYW-CYEIENGLDGLSFKRQIN 466

>Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL012W
           (REAL)
          Length = 1226

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 53/133 (39%), Gaps = 30/133 (22%)

Query: 300 SCGGVGDAEYMWAFEQIVIPMGREF-QPDLVIISS---GFDAADGDTIGQCH-----VSP 350
           S   V +     AF+ + I MGR+  +P+ +I  S   G+D A  D +         +S 
Sbjct: 833 STKDVNEKSRETAFDTL-INMGRKMNEPNSIIKLSQIPGYDPATPDQLSSISEFFKIISA 891

Query: 351 ACYGHMTHMLKSLAKGNMCVVLEGGYNLDS--------------------IAKSALGVVK 390
              G   HM+ S   G  C+V E    +DS                    I KSA+G  K
Sbjct: 892 GLIGESQHMVSSSITGYACLVFEFKNEIDSGILMDIYDTIELYLTSNSREIVKSAIGFTK 951

Query: 391 VLIGEPPDELPDP 403
           V +   P+EL  P
Sbjct: 952 VCVLGLPEELMRP 964

>KAFR0E02320 Chr5 (466643..467944) [1302 bp, 433 aa] {ON} Anc_5.60
           YHR176W
          Length = 433

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 57/134 (42%), Gaps = 19/134 (14%)

Query: 544 YGIIDINIPQSL-------FELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAF------ 590
           Y I++ NIP++L       FE D +    T Q+V  YL  +Y++F  +  +V F      
Sbjct: 57  YDILETNIPKNLMQFSGFPFESDTFKYP-TRQDVWRYLKRYYIEFIDRQAQVHFHTEVVK 115

Query: 591 -VGIGDAYS--GFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIF 647
               G+ +       L GH ++       ++    K   P +P     + +W+  N+ + 
Sbjct: 116 LTKNGEHWEMETVNRLTGHAESHFFDNVVVATGHFKT--PFIPEDVPGLQEWFSNNAAMH 173

Query: 648 TSKYHSCWGTEGND 661
           +  Y +C   EG +
Sbjct: 174 SKNYQNCLFAEGKN 187

>YPL095C Chr16 complement(368071..369441) [1371 bp, 456 aa] {ON}
           EEB1Acyl-coenzymeA:ethanol O-acyltransferase responsible
           for the major part of medium-chain fatty acid ethyl
           ester biosynthesis during fermentation; possesses
           short-chain esterase activity; may be involved in lipid
           metabolism and detoxification
          Length = 456

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 46/90 (51%), Gaps = 11/90 (12%)

Query: 596 AYSGFV-HLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDW-----YFKNSLIFTS 649
            Y+G V H+LG + T+S+     +F D K+  PL   V + +        +  NSL+FT 
Sbjct: 16  GYNGTVKHVLGEKGTKSL-----AFRDSKRQIPLHEFVTKHVPTLKDGANFRLNSLLFTG 70

Query: 650 KYHSCWGTEGNDSKKPRKKFGRVLKCNSDG 679
              + + + G+ SKK +  +GR +   SDG
Sbjct: 71  YLQTLYLSAGDFSKKFQVFYGREIIKFSDG 100

>Smik_16.142 Chr16 complement(251287..252657) [1371 bp, 456 aa] {ON}
           YPL095C (REAL)
          Length = 456

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 11/90 (12%)

Query: 596 AYSGFV-HLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDW-----YFKNSLIFTS 649
            Y+G V H+LG + T+     A++F D K   PL   V + +        +  NSL+FT 
Sbjct: 16  GYNGTVKHVLGEKGTK-----ALAFRDSKCQIPLHEFVTKHVPTLKDGANFRLNSLLFTG 70

Query: 650 KYHSCWGTEGNDSKKPRKKFGRVLKCNSDG 679
              + + + G+ SKK +  +GR +   SDG
Sbjct: 71  YLQTLYMSGGDFSKKFQVFYGREIVKFSDG 100

>KNAG0E02200 Chr5 complement(442946..447022) [4077 bp, 1358 aa] {ON}
            Anc_2.406 YMR129W
          Length = 1358

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 2/75 (2%)

Query: 438  VNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLDMELSGDTI-ICSPNIH- 495
            +N + P      F   PL+S  R  QF RL+ E   +T+  L+  +S   +    PN+  
Sbjct: 1189 LNGRPPFTIRYEFNGMPLKSTERTSQFVRLASEPGKITINQLEDSVSQCIVDFTKPNMQD 1248

Query: 496  ETDTLIICVHDTPEV 510
            E + L + +H  P V
Sbjct: 1249 ELEKLSLVIHPIPSV 1263

>NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa]
           {ON} Anc_8.162
          Length = 352

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 551 IPQSLFELDNYSAVLTSQEVLSYLWD 576
           IP+S FE D+Y  VLT++++   LW+
Sbjct: 323 IPKSFFEFDSYKDVLTTKDLKKLLWN 348

>SAKL0D05060g Chr4 complement(392306..397624) [5319 bp, 1772 aa] {ON}
            similar to uniprot|P42945 Saccharomyces cerevisiae
            YJL109C UTP10 Nucleolar protein component of the small
            subunit (SSU) processome containing the U3 snoRNA that is
            involved in processing of pre-18S rRNA
          Length = 1772

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 33/71 (46%), Gaps = 10/71 (14%)

Query: 614  KCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDS--KKPRKKFGR 671
            K +  F DK        LV E+ SD+Y     +      + W +E N S  +  R KFG 
Sbjct: 1139 KNSFDFIDK--------LVAENESDYYNTKGSLRLRVLGALWDSESNKSFVESIRFKFGE 1190

Query: 672  VLKCNSDGMNN 682
            +LK N + +NN
Sbjct: 1191 ILKANLEFINN 1201

>NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {ON}
           Anc_8.482 YPL031C
          Length = 352

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 551 IPQSLFELDNYSAVLTSQEVLSYLWD 576
           IP S FE D+Y  VLT++++   LW+
Sbjct: 323 IPSSFFEFDHYKDVLTTKDLKKLLWN 348

>Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W
           (REAL)
          Length = 353

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 550 NIPQSLFELDNYSAVLTSQEVLSYLWD 576
           +IP S FE DNY   LT++++   +W+
Sbjct: 323 SIPPSFFEFDNYKEALTTKDLKKLIWN 349

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,869,900
Number of extensions: 3744772
Number of successful extensions: 9496
Number of sequences better than 10.0: 117
Number of HSP's gapped: 9477
Number of HSP's successfully gapped: 128
Length of query: 706
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 589
Effective length of database: 40,065,477
Effective search space: 23598565953
Effective search space used: 23598565953
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)