Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_33232.284ON74874833280.0
ADL217W2.284ON75067114360.0
SAKL0E07722g2.284ON79140513880.0
KLTH0G10318g2.284ON79044113111e-170
Kwal_27.115422.284ON79139412941e-167
TDEL0G021502.284ON66133512821e-167
YIL095W (PRK1)2.284ON81036112751e-164
KLLA0E08405g2.284ON77750312701e-164
NCAS0G038102.284ON66133712601e-164
Suva_9.1042.284ON80531412691e-163
Smik_9.842.284ON80831412661e-163
KAFR0H033302.284ON36931212031e-159
Skud_9.782.284ON80931412411e-159
NDAI0B035602.284ON75636012231e-157
KAFR0J013702.284ON78037212221e-156
CAGL0G02607g2.284ON68831712101e-156
NCAS0B062602.284ON72334512031e-154
Kpol_1003.352.284ON71331711901e-152
TPHA0C033802.284ON69735111871e-152
TBLA0B059302.284ON71731911881e-152
NDAI0G006402.284ON62135111791e-152
YNL020C (ARK1)2.284ON63840811791e-152
ZYRO0A01848g2.284ON70431711821e-151
Skud_14.3092.284ON63930911721e-151
Smik_14.3112.284ON63730911641e-150
Suva_14.3272.284ON63230811421e-146
TBLA0B069402.284ON144331511921e-145
Kpol_1039.332.284ON70135711371e-145
KNAG0H020202.284ON59231310961e-140
CAGL0J03432g2.284ON62230310711e-136
TPHA0D015402.284ON70733010551e-132
KNAG0A054302.284ON78832110451e-130
KAFR0A010403.273ON9123257977e-93
Kpol_251.43.273ON8383137795e-91
SAKL0D03234g3.273ON8583087753e-90
KNAG0H012203.273ON9133257766e-90
Kpol_1052.223.273ON11013147848e-90
KNAG0J008203.273ON10913277812e-89
NCAS0A105903.273ON10953167768e-89
Ecym_26503.273ON8943077661e-88
CAGL0H10208g3.273ON10273207677e-88
TBLA0E025903.273ON10613237671e-87
KAFR0C004303.273ON9493237611e-87
KLTH0C07260g3.273ON9013147512e-86
ZYRO0E06864g3.273ON11153137593e-86
Smik_2.1913.273ON11083457583e-86
Kwal_27.109453.273ON9353147504e-86
TPHA0M011203.273ON7883167417e-86
TDEL0D035203.273ON10493137512e-85
TPHA0A040303.273ON10543187493e-85
Suva_4.2973.273ON11073157443e-84
NDAI0A057003.273ON11573287454e-84
KLLA0F18612g3.273ON8143107286e-84
YBR059C (AKL1)3.273ON11083647409e-84
Skud_2.1793.273ON10903647382e-83
AGR027C3.273ON9613147233e-82
TBLA0I019303.273ON13613157283e-81
CAGL0K11990g3.273ON9913177183e-81
Kwal_56.242746.262ON3463392423e-21
KLTH0H03080g6.262ON3463402317e-20
KNAG0F001701.24ON5433072377e-20
KAFR0A050906.31ON6682422342e-19
Skud_10.1191.271ON14812782362e-19
Skud_16.426.262ON3643352282e-19
Suva_16.706.262ON3643392273e-19
YJL095W (BCK1)1.271ON14782782353e-19
Suva_6.1691.271ON14842322343e-19
Kpol_1023.266.31ON7392712315e-19
KNAG0E008506.31ON7112742299e-19
CAGL0J11638g6.31ON7462752299e-19
Kpol_1037.206.31ON7042992291e-18
Smik_10.1471.271ON14782782301e-18
TDEL0G043806.31ON7222742272e-18
CAGL0L03520g1.271ON14472822282e-18
ZYRO0E07876g6.262ON3693352202e-18
TDEL0D014001.271ON14292322263e-18
NCAS0A094701.271ON15152322255e-18
Ecym_30356.31ON7402742235e-18
SAKL0H06754g8.668ON8842072245e-18
TBLA0A047207.86ON12623052246e-18
ACL006W6.31ON7082742226e-18
Smik_6.4416.262ON3643352166e-18
YPL236C (ENV7)6.262ON3643402168e-18
KNAG0B017801.271ON15802322211e-17
Kwal_26.73551.271ON14462782202e-17
NDAI0G054701.271ON15552322202e-17
TDEL0A067506.262ON3723012132e-17
KLLA0C06138g6.31ON7083122182e-17
Smik_13.1596.31ON7052742182e-17
ZYRO0D05500g7.86ON12622342192e-17
ZYRO0G15290g1.271ON14872322192e-17
Suva_13.1636.31ON7052742182e-17
YMR001C (CDC5)6.31ON7052742172e-17
Skud_13.1546.31ON7052742173e-17
Suva_7.838.140ON5693002163e-17
KAFR0A014201.271ON13982322183e-17
CAGL0K02167g8.140ON11623332174e-17
NCAS0C041008.141ON9053292155e-17
KLTH0F16676g5.406ON8782142156e-17
KLLA0E21693g5.406ON10162702157e-17
Kpol_1072.198.668ON8962012147e-17
AEL230W5.611ON6083022121e-16
TPHA0J004206.31ON7073532121e-16
Kpol_463.81.271ON14472782131e-16
ZYRO0C07480g6.31ON7742742111e-16
KNAG0F002901.52ON11252992121e-16
Suva_16.1608.668ON9182102112e-16
KLLA0F14190g1.271ON13382322112e-16
NCAS0B044906.222ON3492032042e-16
ZYRO0F07194g8.668ON9381952102e-16
KAFR0D012207.86ON10552822102e-16
Kwal_55.215455.406ON8652822102e-16
NCAS0A002801.24ON5352842082e-16
TPHA0I009201.271ON14342842102e-16
ACR133C8.668ON8511952092e-16
SAKL0E01584g6.31ON6952752093e-16
KNAG0D048107.86ON14402282103e-16
TBLA0B004906.31ON7872752093e-16
KAFR0G026906.31ON7132742093e-16
Kwal_26.87518.668ON8482002093e-16
KLTH0D03454g1.271ON14332772093e-16
TDEL0H036407.86ON12372392084e-16
TPHA0F024306.31ON7982932075e-16
NDAI0C026806.31ON7502742065e-16
NCAS0C016708.668ON8961962075e-16
NCAS0D021006.31ON7262742066e-16
TBLA0H016605.406ON9962922076e-16
CAGL0M02299g8.668ON8932092067e-16
NDAI0H024707.86ON14112842077e-16
NCAS0A080805.611ON6233132048e-16
CAGL0F00913g7.86ON12061862059e-16
KNAG0F029006.31ON6492632049e-16
TBLA0C029401.271ON16432812051e-15
TBLA0A035705.406ON9752682041e-15
ZYRO0F18062g1.24ON4712722011e-15
ZYRO0A06446g5.406ON9432842041e-15
KAFR0C014403.92ON10952702032e-15
Ecym_21536.262ON3633421972e-15
Kwal_33.131121.24ON5052892002e-15
SAKL0G06952g5.611ON5993502012e-15
KLTH0G05698g5.611ON5972922012e-15
Smik_4.7891.52ON11361992032e-15
Suva_15.2975.406ON10742822022e-15
TPHA0L005007.86ON9592722022e-15
Kwal_26.71547.86ON12132382022e-15
YDR507C (GIN4)1.52ON11421992022e-15
Kwal_56.224766.31ON6972752012e-15
Suva_2.6871.52ON11281992022e-15
Ecym_55885.611ON6132832002e-15
ZYRO0A05544g5.611ON6313012002e-15
Suva_3.1901.52ON10242392013e-15
SAKL0D05522g1.271ON14742862023e-15
ZYRO0G19052g8.140ON11313162013e-15
TPHA0D028405.611ON6342822003e-15
Suva_5.2508.140ON11392952013e-15
Skud_8.1635.406ON10762792013e-15
Skud_4.7831.52ON11351992013e-15
KLTH0C10912g6.31ON6972752003e-15
Kpol_1031.105.406ON11272752004e-15
TDEL0C067801.24ON4682751964e-15
AFL101C6.222ON3672721945e-15
KLLA0F07623g7.86ON12292841995e-15
Kpol_1065.36.222ON3762741945e-15
SAKL0A03344g6.262ON3643541936e-15
KLTH0D10714g8.654ON8722101986e-15
Smik_6.3478.668ON9172981986e-15
NCAS0B086001.52ON11172371986e-15
TDEL0A061408.668ON8612801986e-15
SAKL0H07084g8.654ON9192091987e-15
Kpol_1044.37.86ON9322771987e-15
KNAG0B032305.611ON6412811967e-15
KLLA0F11319g8.668ON8431961978e-15
Skud_16.1328.668ON9242981978e-15
YHR102W (KIC1)5.406ON10802871978e-15
NDAI0H009405.611ON6852881969e-15
KLTH0G05214g5.591ON6532521951e-14
Smik_8.1805.406ON10732861971e-14
Skud_5.2498.140ON11472701971e-14
NDAI0F045201.24ON4891951941e-14
CAGL0L11550g5.406ON10722691961e-14
Kwal_47.183075.591ON6212741951e-14
AFR092W1.271ON14232371961e-14
KLLA0A03806g5.611ON6022881941e-14
Smik_7.938.140ON5632421931e-14
KAFR0K007007.86ON13811891961e-14
TPHA0H016305.406ON10362771951e-14
SAKL0G01848g5.406ON8851971952e-14
CAGL0G04609g3.92ON9652951942e-14
NCAS0G012106.262ON3673461892e-14
NCAS0F015807.86ON13823071952e-14
Ecym_21946.222ON3662951892e-14
KLTH0D11044g8.668ON8492411942e-14
NCAS0H019405.406ON10152581942e-14
SAKL0C01716g1.52ON12152341942e-14
YPL150W8.668ON9012981942e-14
KLLA0C12485g3.92ON9252831942e-14
KLLA0C01650g1.52ON11122011942e-14
Smik_4.7545.611ON6322951932e-14
TBLA0B082503.92ON13471921942e-14
TDEL0F009308.140ON11303221932e-14
Skud_3.1656.371ON7162621922e-14
KAFR0C058605.611ON6443631922e-14
Ecym_83398.654ON9202761933e-14
YDR477W (SNF1)5.611ON6332951913e-14
KAFR0D049505.406ON10082961933e-14
NCAS0C041208.140ON9154171923e-14
TPHA0G016308.668ON8712011923e-14
Kwal_47.182335.611ON5982831913e-14
SAKL0A04246g6.222ON4002071883e-14
Skud_3.391.52ON10172001923e-14
NCAS0C049403.92ON11162931923e-14
Suva_2.6515.611ON6332951913e-14
KAFR0D041001.52ON11172971924e-14
Skud_4.7515.611ON6342951904e-14
KAFR0F011506.262ON3663391874e-14
CAGL0J03872g8.654ON6611531904e-14
NDAI0G034508.141ON9483211914e-14
Ecym_63441.271ON13972371924e-14
YAR019C (CDC15)3.177ON9742471914e-14
Smik_1.793.177ON9742481915e-14
NDAI0C017005.406ON10202661915e-14
KLTH0D02486g7.86ON12232331915e-14
KNAG0D008306.262ON3873071866e-14
Kpol_1072.298.654ON8932091906e-14
NDAI0E023908.668ON8832071906e-14
TBLA0D022308.141ON11542981906e-14
NDAI0A006601.52ON10222341906e-14
Kwal_26.87098.654ON8291811896e-14
TPHA0D011408.654ON6222461886e-14
KLTH0F00946g1.24ON5122481877e-14
Ecym_26407.86ON13252381907e-14
Kpol_495.145.611ON6242831887e-14
TBLA0B038608.668ON9881991897e-14
KLTH0F01672g1.52ON11642031898e-14
Ecym_10301.24ON4402811859e-14
CAGL0K05709g1.52ON11032021889e-14
Kpol_1040.207.86ON12972321881e-13
KAFR0B028008.279ON10952141881e-13
TDEL0E021805.406ON9872921881e-13
Skud_1.447.86ON13562281881e-13
TDEL0A047805.611ON6213061871e-13
ACR281C7.86ON12592861881e-13
KNAG0D002106.371ON8332101871e-13
TBLA0E033605.611ON6542801871e-13
Ecym_10581.52ON11642011881e-13
KLTH0C09548g3.92ON9932841871e-13
NDAI0E012908.654ON7292311871e-13
NCAS0B014708.654ON7272091871e-13
Smik_7.928.141ON8973111871e-13
TDEL0D053203.92ON10572881871e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3323
         (748 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...  1286   0.0  
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   557   0.0  
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   539   0.0  
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   509   e-170
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   503   e-167
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   498   e-167
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   495   e-164
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   493   e-164
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   489   e-164
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   493   e-163
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   492   e-163
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   468   e-159
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   482   e-159
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   475   e-157
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   475   e-156
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   470   e-156
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   468   e-154
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   462   e-152
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   461   e-152
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   462   e-152
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    458   e-152
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   458   e-152
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   459   e-151
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   456   e-151
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   452   e-150
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   444   e-146
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   463   e-145
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   442   e-145
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   426   e-140
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   417   e-136
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   410   e-132
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   407   e-130
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   311   7e-93
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   304   5e-91
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   303   3e-90
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   303   6e-90
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   306   8e-90
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   305   2e-89
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   303   8e-89
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   299   1e-88
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   300   7e-88
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   300   1e-87
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   297   1e-87
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   293   2e-86
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   296   3e-86
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   296   3e-86
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   293   4e-86
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   290   7e-86
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   293   2e-85
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   293   3e-85
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   291   3e-84
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   291   4e-84
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   285   6e-84
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   289   9e-84
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   288   2e-83
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   283   3e-82
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   285   3e-81
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   281   3e-81
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    98   3e-21
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    94   7e-20
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    96   7e-20
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             95   2e-19
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    96   2e-19
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    92   2e-19
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    92   3e-19
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    95   3e-19
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    95   3e-19
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    94   5e-19
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    93   9e-19
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    93   9e-19
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    93   1e-18
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    93   1e-18
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    92   2e-18
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    92   2e-18
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    89   2e-18
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    92   3e-18
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    91   5e-18
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    91   5e-18
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    91   5e-18
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    91   6e-18
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    90   6e-18
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    88   6e-18
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    88   8e-18
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    90   1e-17
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    89   2e-17
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    89   2e-17
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    87   2e-17
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    89   2e-17
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    89   2e-17
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    89   2e-17
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    89   2e-17
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    89   2e-17
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    88   2e-17
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    88   3e-17
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    88   3e-17
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    89   3e-17
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    88   4e-17
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     87   5e-17
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    87   6e-17
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    87   7e-17
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    87   7e-17
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    86   1e-16
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    86   1e-16
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    87   1e-16
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    86   1e-16
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    86   1e-16
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    86   2e-16
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    86   2e-16
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     83   2e-16
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    86   2e-16
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    86   2e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    86   2e-16
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        85   2e-16
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    86   2e-16
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    85   2e-16
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    85   3e-16
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    86   3e-16
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    85   3e-16
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    85   3e-16
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    85   3e-16
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    85   3e-16
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    85   4e-16
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    84   5e-16
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    84   5e-16
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    84   5e-16
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      84   6e-16
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    84   6e-16
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    84   7e-16
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    84   7e-16
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    83   8e-16
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    84   9e-16
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               83   9e-16
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    84   1e-15
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    83   1e-15
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    82   1e-15
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    83   1e-15
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    83   2e-15
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    80   2e-15
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    82   2e-15
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    82   2e-15
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    82   2e-15
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    83   2e-15
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    82   2e-15
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    82   2e-15
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    82   2e-15
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    82   2e-15
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    82   2e-15
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    82   2e-15
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    82   2e-15
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    82   2e-15
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    82   3e-15
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    82   3e-15
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    82   3e-15
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               82   3e-15
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    82   3e-15
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    82   3e-15
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    82   3e-15
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    82   3e-15
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    82   4e-15
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    80   4e-15
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    79   5e-15
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    81   5e-15
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    79   5e-15
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    79   6e-15
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    81   6e-15
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    81   6e-15
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    81   6e-15
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    81   6e-15
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    81   7e-15
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    81   7e-15
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    80   7e-15
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    80   8e-15
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    80   8e-15
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    80   8e-15
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    80   9e-15
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    80   1e-14
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    80   1e-14
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    80   1e-14
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    79   1e-14
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    80   1e-14
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    80   1e-14
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    80   1e-14
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    79   1e-14
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    79   1e-14
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    80   1e-14
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    80   1e-14
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    80   2e-14
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    79   2e-14
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    77   2e-14
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    80   2e-14
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    77   2e-14
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    79   2e-14
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    79   2e-14
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    79   2e-14
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    79   2e-14
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    79   2e-14
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    79   2e-14
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    79   2e-14
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    79   2e-14
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    79   2e-14
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    79   2e-14
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    79   2e-14
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    79   3e-14
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    78   3e-14
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    79   3e-14
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    79   3e-14
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    79   3e-14
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    78   3e-14
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    77   3e-14
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    79   3e-14
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    79   3e-14
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    78   3e-14
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    79   4e-14
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    78   4e-14
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    77   4e-14
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    78   4e-14
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     78   4e-14
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    79   4e-14
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    78   4e-14
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    78   5e-14
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    78   5e-14
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    78   5e-14
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    76   6e-14
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    78   6e-14
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    78   6e-14
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    78   6e-14
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     78   6e-14
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    77   6e-14
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    77   6e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    77   7e-14
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    78   7e-14
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    77   7e-14
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    77   7e-14
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    77   8e-14
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    76   9e-14
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    77   9e-14
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    77   1e-13
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    77   1e-13
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    77   1e-13
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    77   1e-13
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    77   1e-13
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    77   1e-13
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    77   1e-13
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    77   1e-13
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    77   1e-13
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    77   1e-13
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    77   1e-13
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     77   1e-13
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    77   1e-13
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    77   1e-13
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    76   1e-13
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    77   1e-13
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    76   2e-13
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    76   2e-13
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    76   2e-13
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    76   2e-13
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    76   2e-13
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    76   2e-13
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    75   2e-13
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    75   2e-13
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    75   2e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    74   2e-13
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    76   2e-13
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    74   2e-13
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    76   3e-13
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    74   3e-13
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    75   3e-13
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    75   3e-13
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    75   3e-13
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    75   3e-13
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    75   3e-13
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    75   3e-13
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    75   3e-13
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    75   3e-13
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    75   3e-13
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    75   3e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    75   3e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    75   4e-13
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    75   4e-13
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    75   4e-13
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    75   4e-13
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    75   4e-13
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    75   4e-13
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    74   5e-13
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    75   5e-13
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    74   5e-13
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    74   5e-13
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    75   5e-13
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    75   5e-13
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    75   6e-13
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    74   6e-13
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    74   6e-13
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    74   6e-13
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    74   6e-13
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    74   6e-13
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    73   7e-13
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    74   7e-13
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       74   7e-13
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    74   7e-13
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    74   7e-13
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    74   7e-13
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    73   7e-13
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    74   8e-13
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    74   8e-13
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    74   8e-13
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    74   9e-13
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    74   9e-13
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    74   9e-13
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    74   9e-13
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    74   1e-12
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    74   1e-12
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    73   1e-12
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    74   1e-12
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    72   1e-12
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    74   1e-12
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    74   1e-12
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    74   1e-12
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    73   1e-12
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    74   1e-12
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    73   1e-12
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    72   2e-12
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    73   2e-12
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    73   2e-12
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    73   2e-12
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    72   2e-12
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    72   2e-12
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    73   2e-12
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    73   2e-12
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    73   2e-12
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     73   2e-12
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    73   2e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    72   2e-12
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    72   2e-12
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    72   2e-12
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    71   2e-12
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    72   2e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    72   2e-12
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    73   2e-12
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    72   2e-12
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    72   3e-12
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    72   3e-12
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    72   3e-12
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     72   3e-12
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               72   3e-12
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    72   3e-12
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    72   3e-12
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    72   3e-12
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    72   4e-12
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    72   4e-12
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    72   4e-12
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    72   4e-12
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    72   4e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    72   4e-12
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    72   4e-12
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    72   4e-12
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    71   4e-12
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    72   5e-12
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    72   5e-12
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    72   5e-12
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    71   5e-12
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    72   5e-12
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    72   5e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    70   5e-12
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    72   5e-12
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    71   5e-12
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     71   6e-12
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    70   6e-12
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    71   6e-12
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    71   6e-12
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    70   6e-12
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    71   6e-12
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    71   6e-12
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    71   6e-12
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    71   7e-12
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    71   7e-12
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    71   7e-12
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    71   7e-12
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    71   7e-12
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    71   7e-12
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    70   7e-12
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    70   7e-12
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    71   8e-12
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    71   8e-12
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    71   8e-12
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    71   8e-12
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    70   8e-12
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    70   8e-12
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    70   8e-12
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    70   9e-12
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    71   9e-12
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    70   1e-11
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    69   1e-11
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    70   1e-11
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    70   1e-11
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    70   1e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    70   1e-11
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    69   1e-11
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    70   1e-11
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    70   1e-11
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    70   1e-11
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    69   1e-11
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    70   1e-11
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               70   1e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    70   1e-11
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    70   1e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    70   2e-11
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              70   2e-11
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    70   2e-11
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    70   2e-11
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    70   2e-11
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    69   2e-11
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    70   2e-11
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    70   2e-11
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    69   2e-11
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    70   2e-11
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    69   2e-11
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    70   2e-11
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    68   2e-11
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    69   2e-11
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    70   2e-11
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    70   2e-11
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    69   2e-11
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    69   2e-11
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    69   2e-11
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    70   2e-11
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    69   2e-11
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    68   2e-11
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    69   2e-11
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    69   3e-11
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    69   3e-11
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    69   3e-11
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    69   3e-11
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    69   3e-11
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    69   3e-11
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    69   3e-11
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    69   3e-11
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    69   3e-11
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    68   3e-11
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    69   3e-11
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    69   3e-11
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    69   3e-11
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    69   3e-11
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    69   3e-11
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    68   4e-11
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    67   5e-11
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    67   5e-11
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    68   5e-11
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    68   5e-11
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    68   5e-11
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    68   5e-11
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    68   5e-11
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    68   6e-11
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    67   6e-11
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    68   6e-11
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    68   6e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    67   6e-11
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    67   6e-11
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    68   6e-11
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    67   6e-11
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    68   6e-11
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    67   6e-11
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    68   6e-11
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    68   6e-11
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    67   7e-11
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    67   7e-11
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    68   7e-11
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    68   7e-11
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    68   7e-11
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    68   7e-11
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    67   8e-11
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    68   8e-11
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    67   8e-11
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    67   8e-11
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    68   8e-11
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    67   8e-11
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    66   8e-11
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    67   9e-11
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    67   9e-11
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    67   9e-11
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     66   9e-11
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    68   9e-11
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    67   9e-11
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    67   1e-10
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    67   1e-10
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    67   1e-10
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    67   1e-10
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    67   1e-10
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    67   1e-10
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    66   1e-10
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    67   1e-10
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    67   1e-10
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    67   1e-10
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    67   1e-10
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    67   1e-10
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    67   1e-10
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    66   1e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    67   1e-10
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    67   1e-10
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    66   1e-10
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    66   1e-10
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     66   1e-10
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    67   1e-10
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    67   1e-10
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    67   1e-10
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    66   1e-10
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    66   1e-10
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    67   1e-10
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    66   1e-10
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    67   2e-10
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    67   2e-10
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    65   2e-10
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     66   2e-10
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    67   2e-10
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    65   2e-10
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               65   2e-10
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    67   2e-10
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    66   2e-10
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    65   2e-10
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    66   2e-10
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    66   2e-10
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    66   2e-10
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    67   2e-10
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    65   2e-10
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    65   2e-10
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    67   2e-10
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    66   2e-10
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    65   2e-10
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    66   2e-10
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    66   2e-10
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    66   2e-10
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    66   2e-10
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    66   2e-10
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    66   2e-10
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    66   3e-10
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    66   3e-10
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    65   3e-10
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    66   3e-10
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    65   3e-10
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    66   3e-10
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    65   3e-10
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    66   3e-10
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    65   3e-10
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    65   3e-10
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    65   3e-10
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    66   3e-10
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    64   3e-10
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    65   3e-10
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    64   3e-10
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    66   3e-10
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              65   3e-10
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    65   3e-10
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    64   3e-10
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    64   4e-10
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    65   4e-10
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    65   4e-10
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    64   4e-10
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    65   4e-10
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    64   4e-10
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    65   4e-10
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    65   4e-10
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    65   4e-10
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    65   4e-10
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     64   4e-10
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    64   4e-10
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    65   5e-10
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    65   5e-10
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    64   5e-10
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    65   5e-10
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     65   5e-10
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    64   5e-10
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    64   5e-10
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    65   5e-10
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    64   6e-10
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    65   6e-10
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    65   6e-10
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    65   6e-10
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    65   6e-10
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    65   6e-10
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    65   6e-10
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    64   7e-10
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    64   7e-10
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    64   7e-10
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    64   7e-10
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    64   8e-10
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    63   8e-10
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    64   9e-10
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    64   9e-10
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    64   9e-10
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    64   9e-10
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    64   9e-10
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    64   9e-10
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    64   1e-09
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    64   1e-09
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    64   1e-09
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    64   1e-09
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    63   1e-09
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    64   1e-09
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    63   1e-09
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    64   1e-09
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    64   1e-09
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    64   1e-09
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    64   1e-09
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    63   1e-09
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    63   1e-09
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    64   1e-09
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    64   1e-09
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    62   2e-09
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    64   2e-09
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    63   2e-09
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    64   2e-09
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    62   2e-09
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    63   2e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    63   2e-09
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    62   2e-09
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    63   2e-09
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    64   2e-09
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    62   2e-09
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    62   2e-09
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    62   2e-09
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    62   2e-09
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    62   2e-09
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    62   2e-09
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    63   2e-09
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    62   2e-09
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    62   2e-09
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    63   2e-09
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    63   2e-09
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    63   2e-09
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    63   3e-09
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     63   3e-09
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    63   3e-09
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    63   3e-09
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    62   3e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    62   3e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    62   3e-09
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    62   3e-09
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    62   3e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    62   3e-09
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    62   3e-09
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    62   3e-09
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    62   3e-09
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    62   3e-09
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    62   4e-09
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    62   4e-09
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    61   4e-09
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     61   4e-09
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    62   4e-09
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    62   4e-09
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    61   4e-09
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    62   4e-09
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    62   4e-09
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    62   4e-09
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    62   4e-09
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    62   4e-09
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    62   4e-09
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    61   5e-09
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    62   5e-09
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    61   5e-09
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    62   5e-09
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    62   5e-09
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    61   5e-09
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    61   5e-09
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    62   6e-09
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    62   6e-09
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    62   6e-09
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    60   6e-09
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    62   6e-09
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    61   6e-09
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    61   6e-09
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    61   6e-09
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    60   6e-09
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    62   6e-09
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    62   7e-09
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    60   7e-09
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    61   7e-09
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    60   7e-09
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    61   7e-09
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       60   7e-09
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    60   7e-09
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    61   7e-09
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    60   7e-09
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               60   8e-09
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    61   8e-09
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    61   8e-09
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    60   9e-09
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    60   9e-09
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    61   1e-08
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    60   1e-08
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    61   1e-08
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    61   1e-08
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    61   1e-08
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    61   1e-08
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    61   1e-08
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    60   1e-08
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    61   1e-08
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    60   1e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    60   1e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              60   1e-08
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    61   1e-08
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    60   1e-08
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    60   1e-08
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    60   1e-08
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    59   1e-08
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    60   1e-08
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    60   1e-08
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    60   1e-08
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    60   1e-08
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    59   1e-08
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    60   1e-08
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      60   1e-08
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    59   1e-08
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    60   1e-08
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    60   1e-08
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    60   2e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    60   2e-08
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    60   2e-08
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    59   2e-08
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    60   2e-08
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    60   2e-08
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    60   2e-08
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    60   2e-08
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    59   2e-08
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    59   2e-08
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    59   2e-08
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    60   2e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    60   2e-08
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    60   2e-08
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    60   2e-08
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    60   2e-08
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    60   2e-08
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    59   2e-08
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    60   2e-08
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    60   2e-08
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    59   2e-08
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    60   2e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    59   2e-08
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    59   2e-08
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    60   2e-08
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    59   2e-08
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    59   2e-08
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    59   2e-08
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    59   2e-08
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    60   2e-08
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    59   2e-08
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    60   3e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    59   3e-08
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    60   3e-08
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    59   3e-08
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    59   3e-08
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    59   3e-08
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              60   3e-08
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    59   3e-08
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    59   3e-08
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    59   3e-08
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    59   3e-08
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    59   3e-08
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    59   3e-08
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    59   3e-08
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    59   3e-08
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    59   3e-08
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    59   3e-08
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    59   3e-08
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    59   3e-08
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    59   3e-08
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    59   3e-08
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    58   4e-08
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    59   4e-08
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    58   4e-08
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    59   4e-08
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    59   4e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    59   4e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    59   4e-08
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    58   4e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    59   4e-08
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    58   4e-08
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    59   4e-08
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    58   4e-08
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    58   4e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    59   4e-08
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    59   4e-08
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    59   4e-08
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    59   4e-08
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    58   5e-08
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    58   5e-08
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    59   5e-08
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    59   5e-08
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    57   5e-08
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    58   5e-08
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    57   5e-08
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    58   5e-08
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    58   5e-08
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    57   5e-08
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    59   5e-08
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    58   6e-08
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              58   6e-08
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    58   6e-08
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    59   6e-08
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    59   6e-08
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    58   6e-08
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    58   6e-08
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    58   6e-08
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    58   6e-08
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    58   6e-08
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    57   6e-08
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    57   6e-08
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    58   7e-08
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    57   7e-08
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    58   7e-08
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    57   7e-08
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              58   7e-08
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    57   7e-08
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    57   7e-08
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    58   7e-08
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    57   7e-08
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    57   7e-08
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    58   7e-08
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    58   7e-08
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    58   7e-08
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    57   7e-08
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    57   8e-08
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    57   8e-08
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    58   8e-08
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    57   8e-08
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    57   8e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    57   8e-08
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    58   8e-08
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    57   8e-08
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    58   8e-08
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    58   8e-08
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    58   8e-08
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    57   8e-08
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    57   9e-08
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    57   9e-08
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              58   9e-08
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    58   9e-08
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    57   9e-08
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    57   9e-08
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    58   9e-08
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    57   1e-07
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    57   1e-07
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    57   1e-07
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    57   1e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    57   1e-07
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    58   1e-07
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    57   1e-07
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    57   1e-07
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    57   1e-07
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    57   1e-07
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               57   1e-07
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    57   1e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    57   1e-07
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               57   1e-07
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    57   1e-07
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    57   1e-07
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    56   1e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    57   1e-07
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    57   1e-07
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    57   1e-07
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    57   1e-07
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    57   1e-07
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    57   1e-07
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    57   1e-07
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    57   1e-07
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    57   1e-07
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    57   1e-07
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    57   1e-07
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    57   1e-07
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    57   1e-07
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    57   1e-07
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    57   1e-07
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     56   1e-07
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    56   2e-07
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    57   2e-07
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    57   2e-07
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    57   2e-07
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    57   2e-07
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    57   2e-07
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    56   2e-07
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    57   2e-07
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    56   2e-07
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     57   2e-07
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    57   2e-07
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    57   2e-07
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    56   2e-07
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    57   2e-07
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    56   2e-07
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    57   2e-07
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    56   2e-07
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    56   2e-07
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    55   2e-07
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    56   2e-07
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    56   2e-07
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    56   2e-07
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     56   2e-07
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    56   2e-07
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    57   2e-07
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    57   2e-07
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    57   2e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    56   2e-07
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    56   2e-07
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    55   2e-07
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    56   2e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    55   2e-07
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    56   2e-07
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    55   2e-07
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    55   2e-07
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    56   2e-07
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    56   2e-07
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    56   3e-07
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    55   3e-07
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    56   3e-07
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    55   3e-07
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    56   3e-07
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    56   3e-07
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    55   3e-07
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    56   3e-07
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    56   3e-07
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    56   3e-07
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    56   3e-07
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    55   3e-07
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     56   3e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    56   3e-07
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    56   3e-07
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    56   3e-07
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    56   3e-07
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    56   3e-07
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    55   3e-07
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    56   3e-07
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    56   3e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    55   3e-07
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    55   3e-07
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    55   3e-07
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    54   3e-07
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    55   4e-07
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    56   4e-07
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    56   4e-07
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    55   4e-07
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    55   4e-07
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    55   4e-07
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    55   4e-07
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    55   4e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    55   4e-07
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    55   4e-07
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    55   4e-07
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    56   4e-07
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    55   4e-07
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    55   4e-07
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    55   4e-07
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    55   4e-07
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    55   4e-07
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    55   5e-07
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    55   5e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    55   5e-07
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    55   5e-07
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    55   5e-07
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    54   5e-07
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               55   5e-07
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    55   5e-07
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    55   5e-07
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    55   5e-07
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    55   5e-07
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    55   5e-07
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    55   5e-07
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    55   5e-07
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    54   6e-07
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    55   6e-07
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    55   6e-07
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    55   6e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    55   6e-07
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    55   6e-07
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    55   6e-07
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    55   6e-07
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    55   6e-07
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    55   6e-07
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    54   6e-07
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    55   6e-07
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    55   6e-07
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    55   6e-07
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    55   6e-07
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    55   6e-07
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    55   6e-07
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    55   6e-07
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    55   6e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    55   7e-07
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     54   7e-07
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    54   7e-07
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    54   7e-07
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    55   7e-07
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    54   7e-07
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    54   7e-07
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    55   7e-07
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    55   7e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    54   7e-07
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    55   7e-07
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    55   7e-07
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    54   8e-07
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    55   8e-07
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    54   8e-07
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    54   8e-07
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    54   8e-07
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    54   8e-07
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    54   8e-07
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    54   8e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    55   9e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    54   9e-07
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    54   9e-07
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    54   9e-07
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    54   9e-07
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    54   9e-07
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    54   9e-07
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    54   1e-06
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    54   1e-06
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    54   1e-06
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    54   1e-06
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    54   1e-06
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    54   1e-06
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    52   1e-06
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              54   1e-06
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    54   1e-06
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    54   1e-06
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    54   1e-06
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    54   1e-06
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    53   1e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    54   1e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    54   1e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    54   1e-06
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    53   1e-06
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    54   1e-06
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    54   1e-06
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    54   1e-06
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    54   1e-06
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    54   1e-06
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    53   1e-06
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    53   1e-06
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    53   1e-06
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    54   1e-06
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    54   1e-06
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    54   1e-06
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              53   1e-06
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    54   1e-06
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    54   1e-06
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    54   1e-06
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    54   1e-06
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    53   1e-06
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    54   1e-06
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    53   1e-06
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    54   1e-06
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    54   1e-06
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    54   1e-06
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    54   1e-06
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    53   1e-06
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    53   2e-06
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    53   2e-06
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    53   2e-06
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    53   2e-06
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    53   2e-06
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    53   2e-06
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    54   2e-06
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    54   2e-06
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    52   2e-06
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    53   2e-06
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    54   2e-06
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    53   2e-06
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    53   2e-06
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    53   2e-06
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    54   2e-06
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    54   2e-06
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    53   2e-06
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    52   2e-06
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    53   2e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    53   2e-06
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    53   2e-06
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    54   2e-06
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    53   2e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    53   2e-06
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    53   2e-06
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    53   2e-06
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    53   2e-06
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    53   2e-06
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    54   2e-06
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    53   2e-06
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    53   2e-06
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       53   2e-06
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    53   2e-06
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    52   2e-06
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    53   2e-06
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    53   2e-06
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    53   2e-06
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    53   2e-06
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    52   2e-06
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    53   2e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    53   2e-06
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    52   2e-06
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    53   2e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    53   2e-06
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    53   2e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    52   2e-06
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    52   2e-06
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    53   3e-06
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    52   3e-06
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    52   3e-06
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    52   3e-06
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    52   3e-06
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    53   3e-06
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    52   3e-06
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    52   3e-06
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    52   3e-06
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    52   3e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    53   3e-06
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    53   3e-06
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    53   3e-06
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    52   3e-06
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    53   3e-06
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    52   3e-06
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    52   3e-06
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    52   3e-06
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    52   3e-06
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    52   3e-06
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    52   3e-06
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    52   3e-06
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    52   3e-06
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    52   3e-06
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    52   3e-06
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    52   3e-06
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    52   3e-06
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    52   3e-06
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    52   3e-06
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    52   3e-06
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    52   4e-06
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              52   4e-06
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    52   4e-06
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    51   4e-06
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    51   4e-06
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       52   4e-06
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     52   4e-06
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    52   4e-06
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     52   4e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    52   4e-06
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    52   4e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    52   4e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    52   4e-06
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    52   4e-06
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    52   4e-06
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    52   4e-06
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    51   4e-06
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    52   4e-06
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    52   4e-06
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    51   4e-06
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    52   4e-06
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    52   4e-06
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    52   4e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    52   4e-06
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    52   4e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    52   5e-06
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    52   5e-06
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    52   5e-06
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    51   5e-06
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    52   5e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    52   5e-06
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    52   5e-06
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     52   5e-06
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    52   5e-06
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    51   5e-06
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    52   5e-06
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    52   5e-06
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    51   5e-06
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    52   5e-06
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    52   5e-06
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      52   5e-06
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    52   5e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    52   5e-06
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    52   5e-06
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    52   6e-06
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    51   6e-06
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    51   6e-06
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    52   6e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    52   6e-06
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    51   6e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    52   6e-06
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    51   6e-06
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    52   6e-06
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    52   6e-06
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    52   6e-06
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    51   6e-06
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    52   6e-06
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    51   7e-06
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    50   7e-06
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    52   7e-06
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    50   7e-06
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    52   7e-06
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    52   7e-06
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    52   7e-06
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    51   7e-06
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    51   7e-06
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    51   7e-06
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    51   7e-06
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    51   7e-06
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    48   7e-06
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    51   8e-06
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    50   8e-06
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     51   8e-06
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    51   8e-06
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    51   8e-06
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    51   8e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    51   8e-06
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    51   8e-06
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    50   8e-06
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    51   8e-06
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    50   9e-06
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    51   9e-06
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    51   9e-06
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    50   9e-06
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    51   9e-06
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    51   9e-06
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    51   9e-06
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    51   9e-06
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    51   9e-06
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    50   1e-05
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    50   1e-05
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    51   1e-05
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    50   1e-05
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    50   1e-05
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    51   1e-05
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    50   1e-05
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    51   1e-05
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    51   1e-05
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    50   1e-05
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    50   1e-05
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    50   1e-05
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    51   1e-05
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    50   1e-05
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    50   1e-05
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    51   1e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    50   1e-05
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    51   1e-05
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    50   1e-05
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    50   1e-05
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    50   1e-05
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    50   1e-05
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    50   1e-05
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    50   1e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    51   1e-05
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    50   1e-05
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    50   1e-05
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    50   1e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    51   1e-05
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               50   1e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    50   1e-05
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    50   1e-05
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     50   1e-05
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    50   1e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    50   1e-05
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    50   1e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    50   1e-05
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    50   1e-05
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    50   1e-05
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    50   2e-05
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    50   2e-05
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    50   2e-05
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    50   2e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    50   2e-05
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    50   2e-05
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     50   2e-05
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    50   2e-05
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    50   2e-05
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    50   2e-05
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    49   2e-05
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    50   2e-05
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    50   2e-05
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    50   2e-05
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    50   2e-05
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    49   2e-05
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    50   2e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    50   2e-05
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    49   2e-05
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    49   2e-05
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    50   2e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    50   2e-05
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    49   2e-05
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    50   2e-05
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    50   2e-05
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    50   2e-05
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    50   2e-05
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    50   2e-05
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    50   2e-05
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    50   2e-05
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    49   2e-05
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    49   2e-05
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    50   2e-05
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    50   2e-05
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    49   2e-05
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    50   2e-05
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    50   2e-05
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    49   2e-05
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    49   2e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    49   2e-05
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    49   3e-05
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    50   3e-05
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    50   3e-05
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    50   3e-05
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    49   3e-05
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    49   3e-05
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    49   3e-05
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    49   3e-05
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    50   3e-05
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    49   3e-05
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    49   3e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    49   3e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    49   3e-05
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    49   3e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    50   3e-05
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    49   3e-05
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    49   3e-05
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    49   3e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    49   3e-05
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    49   3e-05
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    49   3e-05
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    49   3e-05
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    49   3e-05
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    49   3e-05
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    49   3e-05
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    49   3e-05
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    49   4e-05
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    49   4e-05
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    49   4e-05
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    49   4e-05
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    49   4e-05
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    49   4e-05
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    49   4e-05
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    49   4e-05
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    49   4e-05
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    49   4e-05
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    49   4e-05
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    49   4e-05
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    49   4e-05
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    49   4e-05
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    49   4e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    49   4e-05
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    49   4e-05
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    49   4e-05
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    49   4e-05
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    49   4e-05
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    49   4e-05
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    49   4e-05
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 49   4e-05
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    49   4e-05
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    49   4e-05
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    49   5e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    49   5e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    49   5e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    49   5e-05
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    49   5e-05
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    49   5e-05
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    49   5e-05
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    49   5e-05
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    49   5e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    49   5e-05
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    49   5e-05
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    49   5e-05
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    49   5e-05
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    49   5e-05
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    49   5e-05
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    48   5e-05
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    49   6e-05
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    49   6e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    49   6e-05
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     48   6e-05
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    48   6e-05
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    49   6e-05
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    49   6e-05
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    48   6e-05
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    49   6e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    49   6e-05
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    49   6e-05
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    49   6e-05
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    49   6e-05
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    49   6e-05
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    48   6e-05
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    48   6e-05
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    48   6e-05
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    48   6e-05
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    49   6e-05
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    49   6e-05
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    48   7e-05
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    48   7e-05
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    48   7e-05
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    48   7e-05
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    48   7e-05
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    48   7e-05
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    47   7e-05
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    48   7e-05
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    48   7e-05
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    48   8e-05
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    48   8e-05
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    48   8e-05
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    48   8e-05
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    48   8e-05
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    48   8e-05
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    48   8e-05
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    48   8e-05
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    48   9e-05
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    47   9e-05
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     48   9e-05
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    48   9e-05
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      48   9e-05
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    48   9e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    48   9e-05
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    48   9e-05
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    48   9e-05
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    48   1e-04
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    47   1e-04
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    47   1e-04
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    47   1e-04
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    47   1e-04
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    47   1e-04
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    48   1e-04
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    48   1e-04
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    47   1e-04
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    47   1e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    48   1e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    47   1e-04
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    47   1e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    48   1e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    48   1e-04
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    47   1e-04
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    47   1e-04
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    47   1e-04
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    47   1e-04
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    47   1e-04
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    47   1e-04
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    47   1e-04
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    47   1e-04
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    47   1e-04
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    47   1e-04
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    47   1e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    47   1e-04
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    47   1e-04
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    47   1e-04
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    47   1e-04
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    47   1e-04
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    47   1e-04
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    47   1e-04
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    47   1e-04
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    47   1e-04
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    47   2e-04
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    47   2e-04
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    46   2e-04
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    47   2e-04
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    47   2e-04
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    47   2e-04
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    46   2e-04
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    47   2e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               47   2e-04
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    47   2e-04
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    47   2e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    47   2e-04
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    47   2e-04
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    47   2e-04
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    46   2e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    47   2e-04
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    47   2e-04
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    47   2e-04
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    47   2e-04
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    46   2e-04
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    46   2e-04
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    46   2e-04
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    46   2e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    46   2e-04
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    46   3e-04
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      47   3e-04
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    47   3e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    46   3e-04
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    46   3e-04
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    46   3e-04
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    46   3e-04
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    46   3e-04
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    46   3e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    46   3e-04
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    46   3e-04
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    46   3e-04
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    46   3e-04
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    46   3e-04
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    46   3e-04
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    46   3e-04
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    46   3e-04
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    46   3e-04
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    46   3e-04
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    46   3e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    46   3e-04
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    46   3e-04
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    46   4e-04
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    45   4e-04
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    46   4e-04
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    45   4e-04
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    46   4e-04
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    45   4e-04
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    45   4e-04
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    46   4e-04
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    46   4e-04
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    45   4e-04
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    46   4e-04
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    46   4e-04
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               46   4e-04
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    45   4e-04
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    45   4e-04
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               45   5e-04
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    45   5e-04
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    45   5e-04
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    45   5e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    45   5e-04
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    45   5e-04
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    46   5e-04
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    45   5e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    45   5e-04
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    45   5e-04
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     45   5e-04
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    45   6e-04
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    45   6e-04
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    45   6e-04
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             45   6e-04
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    45   6e-04
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    45   6e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    44   6e-04
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    45   6e-04
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    45   6e-04
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    45   6e-04
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    45   6e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    45   6e-04
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    45   7e-04
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    45   7e-04
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    45   7e-04
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    45   7e-04
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    45   7e-04
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    45   8e-04
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    45   8e-04
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    45   8e-04
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    45   8e-04
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    44   8e-04
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    45   9e-04
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    45   0.001
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    45   0.001
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    45   0.001
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    44   0.001
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    44   0.001
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    45   0.001
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    44   0.001
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    44   0.001
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    44   0.001
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    44   0.001
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    44   0.001
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    44   0.001
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    44   0.001
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    44   0.001
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    44   0.001
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    44   0.001
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              44   0.001
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    44   0.001
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    44   0.001
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    44   0.001
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    44   0.001
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    44   0.001
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    44   0.001
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    44   0.001
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    44   0.001
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    44   0.001
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    44   0.001
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    44   0.001
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    44   0.001
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    43   0.002
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               44   0.002
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    43   0.002
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    44   0.002
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    44   0.002
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    44   0.002
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    44   0.002
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               44   0.002
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    44   0.002
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    44   0.002
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    44   0.002
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      44   0.002
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    43   0.002
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    44   0.002
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    43   0.002
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    43   0.002
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    43   0.002
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    43   0.002
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    44   0.002
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    43   0.002
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    43   0.002
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    43   0.002
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    43   0.002
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    43   0.002
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    43   0.003
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    43   0.003
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    43   0.003
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    43   0.003
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    43   0.003
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    43   0.003
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    43   0.003
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    43   0.003
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    43   0.003
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    43   0.003
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    42   0.003
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    43   0.003
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    43   0.003
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    43   0.004
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    42   0.004
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    42   0.004
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    42   0.004
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    42   0.004
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    42   0.004
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    43   0.004
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    43   0.004
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    42   0.004
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    42   0.004
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    42   0.004
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    42   0.005
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    42   0.005
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    42   0.005
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    42   0.005
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    42   0.005
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    42   0.005
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    42   0.005
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    42   0.005
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    42   0.005
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    42   0.005
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    42   0.006
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    42   0.006
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    42   0.006
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    42   0.006
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    42   0.006
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    42   0.006
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    42   0.006
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    42   0.006
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    42   0.006
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    42   0.006
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    42   0.006
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    42   0.006
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    42   0.006
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    42   0.007
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    41   0.007
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    42   0.007
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    42   0.007
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    42   0.007
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    42   0.008
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    42   0.008
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    41   0.008
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    41   0.009
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    42   0.009
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    41   0.009
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    41   0.009
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    41   0.009
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               41   0.009
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    41   0.010
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    41   0.010
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    41   0.010
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    41   0.011
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    41   0.012
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    41   0.012
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    41   0.012
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    41   0.012
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               41   0.012
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    41   0.013
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    41   0.013
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    40   0.013
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    40   0.014
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    40   0.014
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    41   0.015
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    41   0.015
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    40   0.015
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    40   0.016
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    40   0.016
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    40   0.016
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    40   0.017
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    40   0.018
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    40   0.018
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    40   0.018
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      40   0.019
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    40   0.020
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    40   0.020
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    40   0.020
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    40   0.021
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    40   0.021
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    40   0.021
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    40   0.021
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    40   0.023
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    40   0.023
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    40   0.025
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    40   0.026
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    40   0.027
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    40   0.027
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.027
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    40   0.030
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    40   0.031
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    39   0.031
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    40   0.031
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    39   0.032
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    39   0.034
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    39   0.038
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    39   0.041
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    39   0.047
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    39   0.048
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    39   0.051
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    39   0.056
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    39   0.061
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    39   0.061
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    39   0.062
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    39   0.063
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    39   0.063
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    39   0.064
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    39   0.064
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    39   0.065
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    39   0.069
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    38   0.071
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    38   0.071
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    38   0.072
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    38   0.075
SAKL0A05038g Chr1 complement(458190..460628) [2439 bp, 812 aa] {...    39   0.076
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    38   0.078
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    38   0.082
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    38   0.083
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    38   0.086
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    38   0.087
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    38   0.090
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    38   0.092
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    38   0.094
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    38   0.095
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    38   0.096
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    38   0.10 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    38   0.11 
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    37   0.11 
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    38   0.12 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    37   0.12 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    38   0.12 
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    38   0.12 
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    38   0.12 
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    38   0.13 
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    37   0.13 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    37   0.13 
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    37   0.13 
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    37   0.14 
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    37   0.14 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    38   0.14 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    37   0.15 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    37   0.16 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    37   0.16 
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    37   0.16 
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    37   0.21 
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    37   0.22 
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    37   0.23 
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    37   0.23 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    37   0.23 
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    37   0.26 
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    37   0.26 
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    36   0.30 
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    36   0.30 
Kwal_47.17314 s47 complement(347091..348356) [1266 bp, 421 aa] {...    36   0.31 
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    36   0.32 
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    36   0.33 
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    36   0.35 
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    36   0.35 
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    36   0.36 
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    36   0.42 
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               35   0.43 
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    36   0.43 
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    36   0.44 
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             35   0.44 
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     36   0.46 
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    36   0.50 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    35   0.51 
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    35   0.51 
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    35   0.53 
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    36   0.54 
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    35   0.54 
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    35   0.55 
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    36   0.55 
AFL068C Chr6 complement(306410..308752) [2343 bp, 780 aa] {ON} S...    35   0.56 
YGL083W Chr7 (353058..355472) [2415 bp, 804 aa] {ON}  SCY1Putati...    35   0.64 
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    35   0.64 
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    35   0.65 
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    35   0.66 
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    35   0.66 
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    35   0.67 
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    35   0.67 
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    35   0.68 
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    35   0.69 
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    35   0.71 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    35   0.76 
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    35   0.76 
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    35   0.78 
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    35   0.79 
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    35   0.81 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    35   0.87 
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    35   0.87 
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    34   0.96 
KLTH0E06952g Chr5 complement(639783..641045) [1263 bp, 420 aa] {...    35   0.97 
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    35   0.99 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    34   0.99 
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    35   1.0  
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    35   1.0  
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    34   1.2  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    35   1.2  
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    34   1.3  
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    34   1.3  
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    34   1.3  
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    34   1.5  
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    34   1.5  
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    34   1.7  
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    34   1.7  
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    34   1.8  
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               34   1.9  
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    33   2.0  
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    33   2.0  
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    33   2.1  
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    33   2.2  
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    33   2.5  
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    33   2.8  
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    33   3.2  
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    33   3.3  
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    33   3.4  
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    33   3.4  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    33   3.5  
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    33   3.7  
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    33   3.7  
NCAS0D03690 Chr4 (688360..690804) [2445 bp, 814 aa] {ON} Anc_6.1...    33   4.3  

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score = 1286 bits (3328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/748 (86%), Positives = 649/748 (86%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVP 60
           MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVP
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVP 60

Query: 61  DKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM 120
           DKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM
Sbjct: 61  DKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM 120

Query: 121 NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV 180
           NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV
Sbjct: 121 NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV 180

Query: 181 CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCY 240
           CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCY
Sbjct: 181 CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCY 240

Query: 241 YTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQG 300
           YTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQG
Sbjct: 241 YTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQG 300

Query: 301 QPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNTMNMG 360
           QPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNTMNMG
Sbjct: 301 QPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNTMNMG 360

Query: 361 YVTGAFQPASQPNEVRGDTALRVSKAKLLSTACDWDKTQNFVPGSNYNSKASVESGHXXX 420
           YVTGAFQPASQPNEVRGDTALRVSKAKLLSTACDWDKTQNFVPGSNYNSKASVESGH   
Sbjct: 361 YVTGAFQPASQPNEVRGDTALRVSKAKLLSTACDWDKTQNFVPGSNYNSKASVESGHLPT 420

Query: 421 XXXXXXXXXXXXXXXGRGXXXXXXXXXXXXXXRPVYVDSEMQTTDLASLKKANXXXXXXX 480
                          GRG              RPVYVDSEMQTTDLASLKKAN       
Sbjct: 421 SSLPTPRSSVSPVRSGRGNINKIIAANPINIKRPVYVDSEMQTTDLASLKKANSRPLSLS 480

Query: 481 XXXXXXXXXXXXHYTGISAVESSQQFQGPVTFDKNNLLVXXXXXXXXXXXXXPELINRTL 540
                       HYTGISAVESSQQFQGPVTFDKNNLLV             PELINRTL
Sbjct: 481 LSSLPSQESFSLHYTGISAVESSQQFQGPVTFDKNNLLVNSKSNTGDSKSSSPELINRTL 540

Query: 541 RYSYHAPEPASWESSEMSSKKLPYLNAILKTPKXXXXXXXXXXXXXXXXXXXXXNVPINN 600
           RYSYHAPEPASWESSEMSSKKLPYLNAILKTPK                     NVPINN
Sbjct: 541 RYSYHAPEPASWESSEMSSKKLPYLNAILKTPKSLSAAEVSESRRSELERDSLANVPINN 600

Query: 601 EYAVDPDSGGYHPSSGGLVSLLSTKNGQVSIQKRVHLLLANSDAQELYSSTNSEAVNSGN 660
           EYAVDPDSGGYHPSSGGLVSLLSTKNGQVSIQKRVHLLLANSDAQELYSSTNSEAVNSGN
Sbjct: 601 EYAVDPDSGGYHPSSGGLVSLLSTKNGQVSIQKRVHLLLANSDAQELYSSTNSEAVNSGN 660

Query: 661 ISVGNEELNSDDNIKPEKPPVMPVSRSKSQFNTPSVVKFSTKNQKKPPEKPFKPVHLRXX 720
           ISVGNEELNSDDNIKPEKPPVMPVSRSKSQFNTPSVVKFSTKNQKKPPEKPFKPVHLR  
Sbjct: 661 ISVGNEELNSDDNIKPEKPPVMPVSRSKSQFNTPSVVKFSTKNQKKPPEKPFKPVHLRPT 720

Query: 721 XXXXXXXXXXXXVNKKRMPKDTKSAIEC 748
                       VNKKRMPKDTKSAIEC
Sbjct: 721 PPPKPAHLKSPPVNKKRMPKDTKSAIEC 748

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/671 (47%), Positives = 398/671 (59%), Gaps = 21/671 (3%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVP 60
           MNQ+PQD  QPG +LTVGSH+VK+++YLTSGGFAQIY CEV+SP      +ACLKRVHVP
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVP 60

Query: 61  DKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM 120
           DK SLNTLRAEVDAMK+L+G++H+VSYIDSHA+KS  ++G+YEV LLMEYC RGGLI FM
Sbjct: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120

Query: 121 NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV 180
           N+RLQ RL EFEVL+IM+ V QGI+AMHAL PPLIHRDIKIENVLI+ +GD KVCDFGSV
Sbjct: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180

Query: 181 CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCY 240
            GVIRPPKN YE +YVQHDILKNTTAQYRAPEMIDLYR   VDEKSDIWALGVFLYK+CY
Sbjct: 181 SGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCY 240

Query: 241 YTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQG 300
           +TTPFEK GE AIL+A FQFPSYPQY++RLKNLI+VML+E+P+ RPN CQVLEEV RIQG
Sbjct: 241 FTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQG 300

Query: 301 QPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQQ--AKIPIVI----PQVQNSVLPS 354
            PCP+ NFYLER +K    + + HS SQP + +   Q     P+V     P  Q S LP 
Sbjct: 301 VPCPLPNFYLER-MKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPANQMSPLPH 359

Query: 355 N----TMNMGYVTGAFQPASQPNEVRGDTALRVSKAKLLSTACDWDKTQNFVPGSNYNSK 410
                T NM Y+     P  + +  R + A  + K  L S +    +  + +    + ++
Sbjct: 360 GIQPITSNMVYMMHNTTPNIK-DIPRENPAATIQKNALYSMS--GSEHLSALSSDMHFNR 416

Query: 411 ASVESGHXXXXXXXXXXXXXXXXXXGRGXXXXXXXXXXXXXXRPVYVDSEMQTTDLASLK 470
             +E+ H                                   +P YVDSE QT D+ +  
Sbjct: 417 PQLENSHTFSGVGPRSSSNPIKIPRNE-IQKFLSGTPPTSAKKPTYVDSETQTGDIITSN 475

Query: 471 KANXXXXXXXXXXXXXXXXXXXHYTGISAVE--SSQQFQGPVTFDKNNLLVXXXXXXXXX 528
           K+                      TG S +   S +  + P T DK +  +         
Sbjct: 476 KSGSRPFAMSLSPLSSPELFSEQSTGNSLLGRLSRKTIRSP-TSDKGSNPLKSKSSVGDD 534

Query: 529 XXXXPELINRTLRYSYHAPEPASWESSEMSSKKLPYLNAILKTPKXXXXXXXXXXXXXXX 588
                   +R L +   + + +   S+++SS+K P LN   K+                 
Sbjct: 535 LASLLSSPSRNLSFPAQSSKSSKRNSADLSSRKSPVLN---KSRIAMSYSGPEKSSATGL 591

Query: 589 XXXXXXNVPINNEYAVDPDSGGYHPSSGGLVSLLSTKNGQVSIQKRVHLLLANSDAQELY 648
                      N     P S   H S+     L+ TK GQ SIQ+RVH LLA S  +++ 
Sbjct: 592 ESSSSSLFGSQNGEHRPPSSTDRHKSNSTSFRLVPTKKGQTSIQERVHKLLATSAQEDVS 651

Query: 649 SSTNSEAVNSG 659
              + +  NS 
Sbjct: 652 KKASKKTTNSA 662

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/405 (65%), Positives = 307/405 (75%), Gaps = 20/405 (4%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVP 60
           M+Q P +++  GTVLTVGSHK +++KYLTSGGFA IY  E+  PD     +ACLKRV VP
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVP 60

Query: 61  DKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM 120
           DK SLN+LRAEVDAMKLL+ +K +VSYIDSHA+KS LNNGSYEV LLMEYC+RGGLI FM
Sbjct: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120

Query: 121 NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV 180
           NTRLQ+RLKEFEVL+IM+QV QG+ AMHALQPPLIHRDIKIENVLI+E+G+ KVCDFGSV
Sbjct: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180

Query: 181 CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCY 240
           CGVIRPPKN  EL+YVQHDILKNTTAQYR+PEMIDLYRG  VDEKSDIWALGVFLYKLCY
Sbjct: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240

Query: 241 YTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQG 300
           YTTPFEK GEVAIL + FQFP+YPQYS++LKNLI+ +L ENP+ RPN CQ+L EV RIQG
Sbjct: 241 YTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQG 300

Query: 301 QPCPVKNFYLERSLKQQIPSQ-------LRHSVSQPMIAMNPQQAKIPIVIPQVQNSVLP 353
            PCPVKNFYLER +  Q   Q       LRHSVSQP +    +   +PI +      VL 
Sbjct: 301 VPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQM----EAITLPITLQPHPQKVLA 356

Query: 354 SNTMNMGYVTGAFQPA---------SQPNEVRGDTALRVSKAKLL 389
           S  ++         P          SQP   R D  L + K+ LL
Sbjct: 357 SAQVSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNLDKSNLL 401

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  509 bits (1311), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 259/441 (58%), Positives = 310/441 (70%), Gaps = 28/441 (6%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPD-SKVKDVACLKRVHV 59
           MNQ   D +QPGT LTVGSH+ +++KYLTSGGFA IY  E+   D S    +ACLKRV V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLN LRAEVDAMKLLRGN+H+VSYIDSHA+KS +++GSYEV LLMEYCS GGLI F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL+E EVL+I + + QGI AMHALQPPLIHRDIKIENVLI+++   KVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCGVIRPPKN  E +YVQHDILKNTTAQYRAPEMIDLYRG+ ++EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK GE AIL + FQFPSYPQYS+ LK+LI+ ML+ENP  RPN CQVLEEV RIQ
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 300 GQPCPVKNFYLERSLKQQIPS-----QLRHSVSQPMIAMNPQQAKIPIVIPQVQ------ 348
           G PCP++NFY+ R+++QQ        +  HS SQP +        +P  +   Q      
Sbjct: 301 GTPCPLRNFYVTRAMQQQQQHQQPKIKFDHSASQPKLDSANNIINVPFKMSHNQPLRSTQ 360

Query: 349 -NSVLPSNTMNMGYVTG----AFQPASQP------NEVRGDTALRVSKAKLLSTACDWD- 396
             +  P N  + GY+        QP S          + G+ AL+  +          D 
Sbjct: 361 TFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQPPISHDF 420

Query: 397 ----KTQNFVPGSNYNSKASV 413
               ++Q F P S   S++SV
Sbjct: 421 NRLGRSQTFTPTSTLASRSSV 441

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  503 bits (1294), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 251/394 (63%), Positives = 300/394 (76%), Gaps = 22/394 (5%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPD-SKVKDVACLKRVHV 59
           MNQ     +  GT LTVGSH+ +++KYLTSGGFA IY  E+   D + + +VACLKRV V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDKQSLN LRAEVDAMKLLRGNKH+VSYIDSHA+KS   +GSYEV LLMEYCS GGLI F
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL E EVL+IM+ + QGI AMHAL PPLIHRDIKIENVLI+++   KVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCGVIRPPKN  E SYVQ+DILKNTTAQYR+PEMIDLYRG  ++EKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK G+ AIL + FQFP+YPQYS+RLKNLI+VML+ENP  RPN CQVLEEV RIQ
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 300 GQPCPVKNFYLERSLKQQ----------IPS-QLRHSVSQPMIAMNPQQAKIPIVIP--Q 346
             PCP++NFYL RS++QQ           PS ++ HS+SQP + +       P++ P   
Sbjct: 301 NVPCPLRNFYLLRSMQQQQQQHQQQQQTFPSVEVHHSLSQPRMDLK----NGPVLTPFKH 356

Query: 347 VQNSVL-PSNTMNMGYVTGA---FQPASQPNEVR 376
            Q+S L  S T +   + G+   + P  +P++ +
Sbjct: 357 AQSSALRTSKTFDGAAMNGSINNYVPVLKPHQAQ 390

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  498 bits (1282), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 239/335 (71%), Positives = 275/335 (82%), Gaps = 4/335 (1%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKV-KDVACLKRVHV 59
           MNQ    ++ PGTVLTVGSH  KV+ YLTSGGFAQ+Y  E+   D+ +  +VACLKRV V
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLNTLRAEVDAMKLLR NKH+VSYIDSHA+KS   NGSYEV LLMEYC+ GGLI F
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL+EFE+L IM+QV QGI AMHALQPPLIHRDIKIENVLI+  G  KVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCGVIRPP+N  E +YVQHD+LKNTTAQYR+PEMIDLYRG  +DEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK GE+AIL + FQFP+ P YS+RLK LI  ML ENP  RPN CQVLE+V R+Q
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 300 GQPCPVKNFYLERSLK---QQIPSQLRHSVSQPMI 331
           G  CPV+NFYL R+++   Q   +QLR+S +QP++
Sbjct: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVL 335

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  495 bits (1275), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 239/361 (66%), Positives = 282/361 (78%), Gaps = 7/361 (1%)

Query: 5   PQDS-FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHVPDK 62
           PQ S ++PGT+LTVGSH  K++KYLTSGGFAQ+Y  E+  PD     ++ACLKRV VP K
Sbjct: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIVPHK 63

Query: 63  QSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNT 122
           Q LNTLRAEVDAMKLLR NKH+VSYIDSHA++SV N  +YEV +LME+C RGGLI FMNT
Sbjct: 64  QGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSV-NGIAYEVFVLMEFCERGGLIDFMNT 122

Query: 123 RLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCG 182
           RLQ+RL+E E+L IM+Q VQGI AMHALQPPLIHRDIKIENVLI+ +G  KVCDFGSV G
Sbjct: 123 RLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGSVSG 182

Query: 183 VIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYT 242
           VIRPP+NT E +YVQHDIL NTTAQYR+PEMIDLYRG  +DEKSDIWALGVFLYK+CYYT
Sbjct: 183 VIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICYYT 242

Query: 243 TPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQP 302
           TPFEK+GE  IL A +Q+PS+PQYS+RLKNLI +ML E P  RPN CQVLEEV R+Q +P
Sbjct: 243 TPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQNKP 302

Query: 303 CPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNTMNMGYV 362
           CP++NFYL R++ Q   +QL    S       P Q  IP+   Q  N   P N M + +V
Sbjct: 303 CPIRNFYLLRAMNQNANTQLAGEPSSTTYV--PTQKFIPVQSLQSINQ--PPNMMPVTHV 358

Query: 363 T 363
           +
Sbjct: 359 S 359

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  493 bits (1270), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 261/503 (51%), Positives = 318/503 (63%), Gaps = 51/503 (10%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKD-VACLKRVHV 59
           MNQ   + +  GT+L VGSH+VKV+KYL SGGFA +Y  E+  PD    D VACLKRV V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLNTLRAEVD+MK LRGNK IVSYIDSHA+KS +N G YEV LLMEYCS GGLI F
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL+EFE+L IM+QV QG+ AMHALQPPLIHRDIKIENVL+++N + K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           V GVIR P+NT E +YVQ+DI+KNTTAQYR PEMIDLYRG  +DEKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK GE AIL + F+FP+YP+YS+R+KNLI+VML  +P+ RPN CQV+EEV RIQ
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 300 GQPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQ--QAKIPIVIPQ----------- 346
           G PCP+KNFYL R + +Q          QP ++  P   Q  +P  +P            
Sbjct: 301 GIPCPIKNFYLLRMMDKQ---------EQPRVSPPPHVPQMTVPATVPTSVSTQHLPPQV 351

Query: 347 VQNSVLPSNTMNMGYV-----------------------TGAFQPASQPNEVRGDTALRV 383
           V N   PS T ++ ++                        G   P +  N    D   ++
Sbjct: 352 VSNVQTPSKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTSSDPFSKI 411

Query: 384 SKAKLLSTACDWDKTQNFVPGSNYNSKASVESGHXXXXXXXXXXXXXXX-XXXGRGXXXX 442
            ++ LLST+     T   +P +    +   +  H                   GRG    
Sbjct: 412 DRSALLSTSA----TMESLPRAMRIPQLEYQQPHLLTRSQSVVPRASVSPVRNGRGAISS 467

Query: 443 XXXXXXXXXXRPVYVDSEMQTTD 465
                     RP YVDSE QT+D
Sbjct: 468 ILASNRTSLDRPKYVDSETQTSD 490

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  489 bits (1260), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 235/337 (69%), Positives = 263/337 (78%), Gaps = 12/337 (3%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59
           MNQ     +QPGT+LTVGSHKV+VVKYLTSGGFAQIY  ++  PD     +VACLKRV V
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLNTLRAEVD MKLLR N H+VSYIDSHA+K   N GSYEV LLMEYC  GGLI F
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL+E E+L IM+QV QGI AMHAL PPL+HRDIKIENVL+   G+ KVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCG+IRPP N  E+SYVQHDI+KNTTAQYRAPEMIDLYRG  +DEKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK GE AIL A FQFP+YPQYS+RLK LIT ML E P  RPNS QVLEEV  +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 300 GQPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQ 336
              CP+ NFYL           + ++V+Q  +AM  Q
Sbjct: 301 NVQCPIPNFYL-----------MNNNVTQGQMAMQTQ 326

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  493 bits (1269), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 229/314 (72%), Positives = 263/314 (83%), Gaps = 3/314 (0%)

Query: 5   PQDS-FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDS-KVKDVACLKRVHVPDK 62
           PQ S ++PGT+LTVGSH  K++KYLTSGGFAQ+Y  E+  PD     ++ACLKRV VPDK
Sbjct: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIVPDK 63

Query: 63  QSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNT 122
           Q LNTLRAEVDAMKLL+ NKH+VSYIDSHA+KSV N  +YEV +LMEYC RGGLI FMNT
Sbjct: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEYCERGGLIDFMNT 122

Query: 123 RLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCG 182
           RL++RL+E E+L IM Q VQGI AMHALQPPLIHRDIKIENVLI+  G  KVCDFGSV G
Sbjct: 123 RLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGSVSG 182

Query: 183 VIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYT 242
           VIRPPKN  E +YVQHDIL NTTAQYR+PEMIDLYRG  +DEKSDIWALGVFLYK+CYYT
Sbjct: 183 VIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICYYT 242

Query: 243 TPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQP 302
           TPFEKTGE AIL A +Q+PS+PQYS+RLKNLI +ML E P  RPN CQVLEEV R+Q +P
Sbjct: 243 TPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQNRP 302

Query: 303 CPVKNFYLERSLKQ 316
           CP++NFYL R++ Q
Sbjct: 303 CPIRNFYLLRAMNQ 316

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  492 bits (1266), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 226/314 (71%), Positives = 264/314 (84%), Gaps = 3/314 (0%)

Query: 5   PQDS-FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHVPDK 62
           PQ S ++PGT+LTVGSH  K++KYLTSGGFAQ+Y  E+  PD     ++ACLKRV VPDK
Sbjct: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDK 63

Query: 63  QSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNT 122
           Q LNTLRAEVDAMKLL+ NKH+VSYIDSHA+KSV N  +YEV +LME+C RGGLI FMNT
Sbjct: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEFCERGGLIDFMNT 122

Query: 123 RLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCG 182
           RLQ+RL+E E+L IM+Q VQGI AMHALQPPLIHRDIKIENVLI+ NG  KVCDFGSV G
Sbjct: 123 RLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSG 182

Query: 183 VIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYT 242
           VIRPP+NT E +YVQHDIL NTTAQYR+PEMIDLYRG  +DEKSDIWALG+FLYK+CYYT
Sbjct: 183 VIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYT 242

Query: 243 TPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQP 302
           TPFEK+GE  IL A +Q+P +PQYS+RLKNLI +ML E P  RPN CQVLEEV R+Q +P
Sbjct: 243 TPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKP 302

Query: 303 CPVKNFYLERSLKQ 316
           CP++NFYL R++ Q
Sbjct: 303 CPIRNFYLLRAMSQ 316

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  468 bits (1203), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 221/312 (70%), Positives = 256/312 (82%), Gaps = 2/312 (0%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKV-KDVACLKRVHV 59
           MNQ   D++ PGT+L VGSH+V+++KY+TSGGFAQIY  E+  PDS    ++ACLKRV V
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLNTLRAEVDAMKLLR NKH+VSYIDSHASKS  NNGSYEV LLMEYC RGGLI F
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL E EVL I +QV QGI AMHALQPPL+HRDIKIENVLI+++   K+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           V G+IRPP N  EL YVQHD+LKNTTAQYR+PEMID YRG  +DEKSDIWA+GVFLYKLC
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 240 YYTTPFEKT-GEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRI 298
           YYTTPFEK  GE AIL A +++P++P YS RLK+LI  ML ENP  RPN  QV+EE+ ++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 299 QGQPCPVKNFYL 310
           Q  PCP+ NFYL
Sbjct: 301 QNVPCPIVNFYL 312

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  482 bits (1241), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 224/314 (71%), Positives = 260/314 (82%), Gaps = 3/314 (0%)

Query: 5   PQDS-FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDS-KVKDVACLKRVHVPDK 62
           PQ S + PGTVLTVGSH  K++KYLTSGGFAQ+Y  E+  PD     + ACLKRV VPDK
Sbjct: 4   PQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDK 63

Query: 63  QSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNT 122
           Q LNTLRAEVDAMKLL+ NKH+VSYIDSHA+KSV N  +YEV +LME+C RGGLI FMNT
Sbjct: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGIAYEVFVLMEFCERGGLIDFMNT 122

Query: 123 RLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCG 182
           RLQ RL+E E+L IM+Q VQGI AMH LQPPLIHRDIKIENVLI+ +G  KVCDFGSV G
Sbjct: 123 RLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSG 182

Query: 183 VIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYT 242
           VIRPP+N+ E +YVQHDIL NTTAQYR+PEMIDLYR   +DEKSDIWALGVFLYK+CYYT
Sbjct: 183 VIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYT 242

Query: 243 TPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQP 302
           TPFEK+GE AIL + +Q+PS+PQYS+RLK LI +ML E P  RPN CQVLEEV R+Q +P
Sbjct: 243 TPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEP 302

Query: 303 CPVKNFYLERSLKQ 316
           CP++NFYL R++ Q
Sbjct: 303 CPIRNFYLLRAMGQ 316

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  475 bits (1223), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 229/360 (63%), Positives = 278/360 (77%), Gaps = 8/360 (2%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59
           MNQ     +  GT+LTVG+H+  + KYLTSGGFAQIY  E+   D+  K +VACLKRV V
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           P K  LNTLRAEVDAMKLL+ N+H+VSYIDS+A KS  NNGSYEV+LLMEYC  GGLI F
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MN+RLQ+RL E E+L I++Q  QG+  MHALQP L+HRDIKIENVL + NG+ K+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCG IRPP+N  ELSYVQHDILKNTTAQYR PEM+DLYRG  +DEKSDIWALGVFLYKLC
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEKTGE AIL + FQ+P++P YS+RLKNLI VML+ENP  RPN C++LEE+  IQ
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 300 GQPCPVKNFYLERS--LKQQIPSQLRHSV-----SQPMIAMNPQQAKIPIVIPQVQNSVL 352
           G PCP++NFYL R+  L  QI  Q + +V     +QP+  +N +   +PI+  +   S++
Sbjct: 301 GVPCPIQNFYLIRAQQLANQIQLQRQTTVPKIATAQPIQQLNARTQTMPIINTKANTSLV 360

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  475 bits (1222), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 225/372 (60%), Positives = 279/372 (75%), Gaps = 18/372 (4%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59
           MN    ++F  G +LTVGSH  KV+KYLTSGG+AQ+Y  E+   D  +  ++ACLKRV V
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLNTLRAEVDAMKLL+ N+H+VSYIDSHASKS + NG+YEV +LME+C RGGLI F
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MN+RLQ RL E E+L IM+   QGI AMH LQP L+HRDIKIENVLI++N + KVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCG++RPPKN  E ++V HDI+KNTTAQYR+PEM+DL +G  ++EKSDIWALGVFLYKLC
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKT-GEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRI 298
           YYTTPFEK  GE AIL+A FQ+PSYP YS+RLKNLI VML++NP  RPN CQVLEEV R+
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 299 QGQPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNTMN 358
           QG PCP++NFYL R+++       + ++ QP+     Q   +P  + Q      PS  MN
Sbjct: 301 QGIPCPIRNFYLLRAMENN-----KRTIEQPV-----QNVYMPTTLSQ------PSTQMN 344

Query: 359 MGYVTGAFQPAS 370
           +  +      A+
Sbjct: 345 LASLNDTLPTAA 356

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  470 bits (1210), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 222/317 (70%), Positives = 255/317 (80%), Gaps = 1/317 (0%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPD-SKVKDVACLKRVHV 59
           MNQ   D    GT LTVG+H VK++KYLTSGGFAQIY  E++S       +VACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLN LRAEVDAMKLL  NKH+VSYIDSHA++S  N+G+YEV LLMEYC  GGLI F
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL E E+L IM+Q  QGI  MHAL PPL+HRDIKIENVL+++ G  KVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           V GVIRPP+N  EL YVQHDI+KNTTAQYR PEM+DLYRG  +DEK+DIWALGVFLYKLC
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK GE AIL A FQFPS+P YS+RLKNLI  ML E+P  RPN CQVLEEV R+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 300 GQPCPVKNFYLERSLKQ 316
             PCP++NFYL R++++
Sbjct: 301 NVPCPIRNFYLLRAMEK 317

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  468 bits (1203), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 222/345 (64%), Positives = 269/345 (77%), Gaps = 14/345 (4%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEV--ISPDSKVKDVACLKRVH 58
           MNQ    ++ PGT+LTVGSH  K++KYLTSGGFAQIY  E+  I+P +  +  ACLKRV 
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQ-TACLKRVI 59

Query: 59  VPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLIS 118
           VPDK  LNTLRAEVDAMKLL+ N+H+VSYIDSHA++S +  G+YEV LLMEYC  GGLI 
Sbjct: 60  VPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLID 119

Query: 119 FMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFG 178
           FMNTRLQ+RL E E+L I++Q VQG+ AMHALQP LIHRDIKIENVLI+  G+ K+CDFG
Sbjct: 120 FMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFG 179

Query: 179 SVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKL 238
           SVC  IRPP+N  EL+YVQHD+LKNTTAQYRAPEM+DLYRG  ++EKSDIWALGVFLYKL
Sbjct: 180 SVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKL 239

Query: 239 CYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRI 298
           CYYTTPFEK GE AIL + +Q+P++P Y+++LKNLI   L E+P  RPN CQ+LEE+ RI
Sbjct: 240 CYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRI 299

Query: 299 QGQPCPVKNFYLERSLKQQ--------IPSQ---LRHSVSQPMIA 332
           QG PCP+ NFYL R++  Q         P+Q   L+HS S   I+
Sbjct: 300 QGIPCPINNFYLSRTINVQASLMNPIITPTQQTALKHSQSSATIS 344

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  462 bits (1190), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 211/317 (66%), Positives = 258/317 (81%), Gaps = 1/317 (0%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKV-KDVACLKRVHV 59
           MNQ    ++  G  L VG H   ++KYLTSGG+AQ+Y  ++  PDS+   D+ CLKR+ V
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLNT RAEVDAMKLLR   H+VSYIDS+A+KS L+NG+YEV+LLME+C+ GGLI F
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL+EFE+L IM+QV QG+ AMH+L+PPL+HRDIKIENVLI+ +G+ K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCGVIRPP +  E ++VQHDILKNTTAQYRAPEMIDL R   +DEKSDIWALGVFLYKLC
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK GE AIL + +++ +YP YS+ LKNLI +MLA  P  RPN CQVLEEV R+Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 300 GQPCPVKNFYLERSLKQ 316
           G PCP+KNFYLER++ +
Sbjct: 301 GIPCPIKNFYLERAIHR 317

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  461 bits (1187), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 222/351 (63%), Positives = 267/351 (76%), Gaps = 19/351 (5%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPD-SKVKDVACLKRVHV 59
           MNQ     + PG +L VGSH+ K++KYLTSGGFAQ+Y  E+   D     ++ACLKRV V
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSV----LNNGSYEVVLLMEYCSRGG 115
           PDK SLN  RAEV+AMKLLR NK++VSYIDSHA+KS     + NGSYEV LLMEYCS  G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 116 LISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVC 175
           LI FMNTRLQ+RLKEFE+L IM+ V QG+ AMHALQPPL+HRDIKIENVLI+   + K+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 176 DFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFL 235
           DFGSVCGVIRPP N  EL +VQHDILKNTTAQYR+PEM+ L +   ++EKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 236 YKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
           YK+CYYTTPFEK GE AIL + +Q+P+YPQYS+ LKNLI VML  +P  RPN CQV+EEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 296 CRIQGQPCPVKNFYLERSLKQQI--------------PSQLRHSVSQPMIA 332
            R+QG PCP+KNFYLER+++Q                P  L+HS+S P ++
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALS 351

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  462 bits (1188), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 257/319 (80%), Gaps = 1/319 (0%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDS-KVKDVACLKRVHV 59
           MNQ    ++ PGT L VG H+V ++KYLTSGGFAQIY  +V  P+     ++ACLKRV V
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           P+K  LNTLRAEV+AM+LL+G  H+V YIDS+A++S+ N+G+YEV+ LME+C  GGLI F
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RLKEFEVL IMNQV QGI+AMH+L PPLIHRDIKIENVLI+ NG+ KVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           V G+IRPPKNT E ++VQ DI+KNTTAQYR PEM+DLYRG  ++EKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFE  GE AIL A +Q+P YP YS+RLKNLI +ML E P  RPN CQVLEEV  +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 300 GQPCPVKNFYLERSLKQQI 318
           G PCP+ NFYL+R    Q+
Sbjct: 301 GIPCPLPNFYLQRQQATQL 319

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  458 bits (1179), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 220/351 (62%), Positives = 263/351 (74%), Gaps = 6/351 (1%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKD-VACLKRVHV 59
           MNQ     + PGT+L+VGSH+ +++KYLTSGGFAQ+Y  E+   D  +   + CLKRV V
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLNTLRAEVDAMKLLR N H+VSYIDSHA+K   N GSYEV LLMEYC RGGLI F
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL E E+L IM+QV QG+ AMHALQPPL+HRDIKIENVL+   G  K+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCG+IRPP N  E +YVQHDI+KNTTAQYR+PEMI+L +G  ++EKSDIWALGVFLYKLC
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEKTGE AIL A+FQFP++P YS+R+K+LI + L   P  RPN  Q+LEEV +IQ
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 300 GQPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQQAKIPIVIPQVQNS 350
             PCP+ +FYL+R L Q         V      MN      P+ IP + N+
Sbjct: 301 NVPCPIPDFYLQRKLAQAQAQTQAQDV-----VMNVPIPSYPVAIPAITNN 346

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  458 bits (1179), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 223/408 (54%), Positives = 290/408 (71%), Gaps = 19/408 (4%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKD-VACLKRVHV 59
           MNQ    ++  GT LTVGSH+V+++KYLTSGGFAQ+Y   +  PD      VACLKRV V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLNTLRAEVDAM+LL+ N+++VSYIDSHA+K++L+NGSYEV +LMEYC RGGLI F
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL EFE+L+IM+QV QG+ AMHALQPPLIHRDIKIENVLI+ N + K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCG+IRPP+N+ ELSYVQ DILKNTTAQYR+PEMID +RG  +DEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK G++AIL   F+FP YP YS +LK LI  +L ++P HRPN  Q+L+ +  +Q
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 300 GQPCPVKNFYLERSLKQQIPSQLRH--SVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNTM 357
             PCP+ +  + ++    +     H  S +Q ++++N          P    + +P+ T 
Sbjct: 301 NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSLNS---------PTTMENTMPNATF 351

Query: 358 NMGY----VTGAFQPASQPNEVRGDTALRVSKAKLLSTACDWDKTQNF 401
            +       T    P  +P+++  D +   S      +   +DK+QN 
Sbjct: 352 QISMADNTTTAQMHPNRKPSQIAYDASFSNSAK---GSQPLFDKSQNM 396

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  459 bits (1182), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 207/317 (65%), Positives = 260/317 (82%), Gaps = 1/317 (0%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKV-KDVACLKRVHV 59
           MN     ++ PGTVL+VG+H  K++KY+ SGGFAQ+Y  E+   D+    +  CLKRV +
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           P+K  LN LRAEV+AMKLL+G+KH+V YIDSHA++S+L NG+YEV LLME+C+ GGLI F
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RLKE+E+L IM+QV QGI AMHALQPPLIHRDIKIENVLI+ +G+ KVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           V G IRPP+N  E ++VQHDILKNTTAQYR+PEMIDLYR  ++DEKSDIWALG+FLYKLC
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK G+ AIL + +QF ++P YS+RLKNLI+ ML++ P+ RPN CQVLEEV R+Q
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 300 GQPCPVKNFYLERSLKQ 316
           G   P++NFYL R+++ 
Sbjct: 301 GVSSPMRNFYLLRAMQH 317

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  456 bits (1172), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 207/309 (66%), Positives = 253/309 (81%), Gaps = 1/309 (0%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKV-KDVACLKRVHV 59
           MNQ    ++  GT LTVGSH+V++VKYLTSGGFAQ+Y   +  PD     ++ACLKRV V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLNTLRAEVDAM+LLR N+++VSYIDSHA+K++L+NGSYEV +LMEYC RGGLI F
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL EFE+L+IM+QV QG+ AMHALQPPLIHRDIKIENVLI+ N + K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCGVIRPP+N  ELSYVQ DI KNTTAQYR+PEM+D++RG  +DEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK GE AIL  +F+FP YP YS +L++LI  +L +NP  RPN  Q+L+ +  +Q
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 300 GQPCPVKNF 308
             PCP+ + 
Sbjct: 301 NVPCPISDI 309

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  452 bits (1164), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 206/309 (66%), Positives = 253/309 (81%), Gaps = 1/309 (0%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59
           MNQ    ++  GT LTVGSH+V+++KYLTSGGFAQ+Y   +  PD     +VACLKRV V
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLNTLRAEVDAM+LL+ N+++VSYIDSHA+K++L NGSYEV +LMEYC RGGLI F
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL EFE+L+I++QV QG+ AMHALQPPLIHRDIKIENVLI+ N + K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCG+IR P+N+ ELSYVQ DILKNTTAQYR+PEMID++RG  +DEKSDIWALG+FLYKLC
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK GE AIL   F+FP YP YS +LK+LI  +L +NP HRP+  Q+L+ +  +Q
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 300 GQPCPVKNF 308
             PCP+ + 
Sbjct: 301 NVPCPINDI 309

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  444 bits (1142), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 249/308 (80%), Gaps = 1/308 (0%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59
           MNQ    ++  GT LTVGSH+V+++KYLTSGGFAQ+Y   +  PD     +VACLKRV V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK SLNTLRAEVDAMKLLR N+++VSYIDSHA+K+ L+NGSYEV +LMEYC RGGLI F
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNTRLQ+RL E E+L+IM QV QG+ AMHALQPPLIHRDIKIENVLI+   + K+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCGVIRPP+N  ELSYV+ D+LKNTTAQYR+PEM+D++RG  +DEKSDIWALG+FLYKLC
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK GE AIL   F+F  YP YS +L+NLI  +L +NP  RPN  Q+L+++  +Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 300 GQPCPVKN 307
             P P+++
Sbjct: 301 NAPYPIRD 308

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  463 bits (1192), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 251/315 (79%), Gaps = 3/315 (0%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDS---KVKDVACLKRV 57
           MNQ     ++ G VL +G+H+V + KYL  GGFAQ+Y   VI   +   ++  +ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 58  HVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLI 117
            VPDK  LNTLRAEVDAMKLL+GNK+IVSYIDSHA +S L  G YEV LLMEYCSRGG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 118 SFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDF 177
            F+NTRL  RL+EFE+L+IM+ V QG+ AMH LQPPLIHRDIKIENVLI+ENGD K+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 178 GSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYK 237
           GS C V+RPPK   E +++ HDI+ NTTAQYR+PEMID Y G+ +DEKSDIWALGVFLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 238 LCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCR 297
           LCYYTTPFEK GE AIL   FQFPSYPQYS+ ++N+IT+ML ++PI RPN CQVLE+V +
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 298 IQGQPCPVKNFYLER 312
           +QG PCP++NF L R
Sbjct: 301 LQGVPCPIENFMLTR 315

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  442 bits (1137), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 213/357 (59%), Positives = 270/357 (75%), Gaps = 14/357 (3%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPD-SKVKDVACLKRVHV 59
           MNQ     + P TV+TVGSH  K+VKYL SGG+AQ+Y   V   D S   ++ACLKRV V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PDK+SLN LRAEVDA+K+LR  K++VSYIDSHASK   + GSYEV +LMEYCS G LI F
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           +NTRL++RL+E E+L IM QV  G+  MH LQP LIHRDIKIEN+LI+ENG+ KVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           VCGVIRPP++  E+ Y+QHDI+KNTTAQYR+PEM+DL +G+ ++EKSDIWALGVFL+KLC
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFEK GE AILK+ FQ+P+YP YS+ LKN+I V+L+ +P  RPN CQ++EE+ R+Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 300 GQPCPVKNFYLERSLKQQIPSQLRHSVSQPM------IAMNPQQAKIPIVIPQVQNS 350
           G   P+KNFYL R+L+         S+ QP+      + ++  Q K    IP +Q+S
Sbjct: 301 GIVPPMKNFYLSRALETS-------SLMQPLQNNSYKVPISDIQDKHKRQIPNIQSS 350

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  426 bits (1096), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 199/313 (63%), Positives = 251/313 (80%), Gaps = 3/313 (0%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEV--ISPDSKVKDVACLKRVH 58
           MNQ    ++  GT LTVGSH+V+++KYLT+GGFAQIY   +  I P S   ++ACLKRV 
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGT-NIACLKRVI 59

Query: 59  VPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLIS 118
           VPDK SLN LRAEVDAMKLLR N+ +VSYIDSHA+KS   NG+YEV LLMEYC  GGLI+
Sbjct: 60  VPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLIN 119

Query: 119 FMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFG 178
           F+N+RLQ+RLKE EV+ IM  V QG+ AMHALQPPL+HRDIKIENVL+++N + K+CDFG
Sbjct: 120 FLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFG 179

Query: 179 SVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKL 238
           SV G IRPP N  EL+ VQ+DI++NTTAQYR+PEMID+ RGF +DEKSDIWALGVFLYK+
Sbjct: 180 SVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKI 239

Query: 239 CYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRI 298
           CYYTTPFEK+GE  IL + ++FP++P YS+RL++LI+ +LA  P HRPN   V++E+  +
Sbjct: 240 CYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299

Query: 299 QGQPCPVKNFYLE 311
           +   CP+ NFYL+
Sbjct: 300 KNISCPIINFYLK 312

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  417 bits (1071), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 191/303 (63%), Positives = 239/303 (78%), Gaps = 1/303 (0%)

Query: 9   FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKV-KDVACLKRVHVPDKQSLNT 67
           ++PGT +TVGSH V ++KYLTSGG+AQIY  +++  D  +  ++A LKRV VPDK  LNT
Sbjct: 9   YEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNT 68

Query: 68  LRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDR 127
           LRAEVDAMK L+ +K+IVSYIDSHA+KS   +G+YEV L+MEYCSRGGLI FMNTRLQ+R
Sbjct: 69  LRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNR 128

Query: 128 LKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPP 187
           L E E+L I   + QG+ AMH LQPPLIHRDIKIENVLI+ +   K+CDFGSV G IRPP
Sbjct: 129 LTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPP 188

Query: 188 KNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEK 247
           K   EL+YV+HDI+ +TTAQYRAPEM+DL +GFSV++KSDIWALGVFLYKLCYYTTPFE+
Sbjct: 189 KTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQ 248

Query: 248 TGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVKN 307
           TGE  IL    +FP YP YS+ +K LI  MLA+NP+HRPN  Q+++ V ++    CP+ N
Sbjct: 249 TGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVNCPIPN 308

Query: 308 FYL 310
            ++
Sbjct: 309 IHV 311

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  410 bits (1055), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 190/330 (57%), Positives = 253/330 (76%), Gaps = 6/330 (1%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59
           M+Q+ +D ++ GT L V SH+V +  YLTSGGFAQ+Y   + S    +  ++ CLKRV V
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           P+KQSLN LRAEVDAMK+L+ NK+IVSYIDSHA++   +  SY V+LLMEYCS  GL+ F
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MN RL++RLKE E+L+IM  V QG+  MH LQPPL+HRDIKIENVL++ +G+ K+CDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
           V GV+R P ++ E  Y+Q+DILKNTTAQYR+PEM++L  GF ++EKSDIWALG+ LYKLC
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           YYTTPFE+ G  AI++  F +P+YPQY++ LKN+I V+L+ NPI RPN CQ+LEE+ RIQ
Sbjct: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300

Query: 300 GQPCPVKNFYLERSLKQQIPSQLRHSVSQP 329
            +  P+ NFY++R++     S L+   +QP
Sbjct: 301 HKSSPLPNFYVQRAM-----SSLQMDTTQP 325

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  407 bits (1045), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 196/321 (61%), Positives = 243/321 (75%), Gaps = 9/321 (2%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59
           MNQ    ++ PG V+ VGSH+ K++KYLTSGGFAQIY  E+   D     ++ACLKRV V
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           P+K  LN LR EVDAMKLL+ N+H+VSYIDS+A+KS   NGSYEV LLMEYC RG L+ F
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MNT+L++RL+E EVL IMNQV QGI AMH L PPLIHRDIKIENVLI+ +G  KVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYK-- 237
           VCG+IRPP+N  EL YVQHD++KNTTAQYR+PEMIDL +GF ++ K  I  LG +     
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238

Query: 238 --LCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
             L +YT  F +  EVAIL   +Q+P+YP YS+RLKN++ V+L+ +P+ RPN CQ+LEE+
Sbjct: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296

Query: 296 CRIQGQPCPVKNFYLERSLKQ 316
            +IQ  PCP+ NFYLERS  Q
Sbjct: 297 SKIQNIPCPIDNFYLERSRHQ 317

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  311 bits (797), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 205/325 (63%), Gaps = 23/325 (7%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVIS--------PDS------------ 46
           + F PG V+ VG HKV+++KYL  GGFAQIY    I         PDS            
Sbjct: 17  EKFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQF 76

Query: 47  --KVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEV 104
             +  ++ACLKRV VPD+  LN LR EV+ M+ L+G  +IV Y DS+AS+    N  +EV
Sbjct: 77  KLEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEV 136

Query: 105 VLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENV 164
           +LLME C    L+ +MN RL  +L E E+L+IM  V  GI  MH LQ PLIHRDIKIENV
Sbjct: 137 LLLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENV 196

Query: 165 LIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDE 224
           L+  + + K+CDFGS         +  E++ +  +I  +TT QYR+PEMIDLYR   +DE
Sbjct: 197 LVDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDE 256

Query: 225 KSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIH 284
           KSDIWALGVFLYKL +YTTPFE TG+ AIL + ++ P    YS+RL NLI +MLAENP  
Sbjct: 257 KSDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNL 315

Query: 285 RPNSCQVLEEVCRIQGQPCPVKNFY 309
           RPN  QV+ +VC   G   P+K+ Y
Sbjct: 316 RPNIYQVMHQVCITIGIEPPIKDKY 340

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  304 bits (779), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 155/313 (49%), Positives = 203/313 (64%), Gaps = 11/313 (3%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCE------VISPDSKV----KDVACLKR 56
           DS+ PGT++ VG HKV+VVKYL  GGFA+IY  +       + P+ K      D  CLKR
Sbjct: 27  DSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKR 86

Query: 57  VHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGL 116
           V V D   LN +R EV+ M+ L+G   +V Y DS+AS+ +     YEV+LLME CS   L
Sbjct: 87  VLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSL 146

Query: 117 ISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCD 176
           + +MN RL  +L E E+L+IM  V   +  MH L  PLIHRDIKIENVL+    + K+CD
Sbjct: 147 LDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCD 206

Query: 177 FGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLY 236
           FGS    +    +  +++ +  +I  +TT QYR+PEMIDLYR   V+EKSDIWALGVFLY
Sbjct: 207 FGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLY 266

Query: 237 KLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVC 296
           KL +YTTPFE+TG+ AIL + ++FP    YS++L NLI VMLAENP  RPN  QVL ++C
Sbjct: 267 KLMFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQIC 325

Query: 297 RIQGQPCPVKNFY 309
            I G   P+ + Y
Sbjct: 326 YISGIKNPMDDAY 338

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  303 bits (775), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 202/308 (65%), Gaps = 10/308 (3%)

Query: 11  PGTVLTVGSHKVKVVKYLTSGGFAQIYCC-------EVISPDSKVK--DVACLKRVHVPD 61
           PGT++ VGSHKV++VKYL  GGFA IY         E+ +P S +K  D+ACLKRV V D
Sbjct: 34  PGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLVTD 93

Query: 62  KQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMN 121
           +  LN LR EV+ MK L+ + +IV Y DS+AS+    +  YEV+LLME C    L+ +MN
Sbjct: 94  ENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNKSLLDYMN 153

Query: 122 TRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVC 181
            RL  +L E EVL+IM  V + +  MH L  PLIHRDIKIENVL+    + K+CDFGS  
Sbjct: 154 QRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDFGSTS 213

Query: 182 GVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYY 241
                     +++ + ++I  +TT QYRAPEMIDLYR   +DEKSDIWALG+FLYKL +Y
Sbjct: 214 SCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 273

Query: 242 TTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQ 301
           TTPFE TG+ AIL + +  P+   YS++L NLI +MLAENP  RPN  QV+ +VC I   
Sbjct: 274 TTPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQVCAIMKV 332

Query: 302 PCPVKNFY 309
             P ++ Y
Sbjct: 333 DVPFEDKY 340

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  303 bits (776), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 210/325 (64%), Gaps = 25/325 (7%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVI----------SPDSK----VKDVA 52
           + +QPG V+ VGSH+V++++Y+  GGFAQIY  + +          SP SK    V D+A
Sbjct: 16  EKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDLA 75

Query: 53  CLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGS--------YEV 104
           CLKRV V D+  LN LR EV+ MK L G  +IV Y DS+AS+  L NG+        +EV
Sbjct: 76  CLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASR--LRNGTDSQPQENKFEV 133

Query: 105 VLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENV 164
           +LLME C    L+ +MN RL  +L E E+L +M  V   I  MH L+ PLIHRDIKIENV
Sbjct: 134 LLLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENV 193

Query: 165 LIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDE 224
           L+ +    K+CDFGS            +++Y+  +I  +TT QYR+PEMIDLYR   +DE
Sbjct: 194 LVDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDE 253

Query: 225 KSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIH 284
           KSDIWALG+FLYKL ++TTPFE+TG+ AIL + F+FP    YS +L NLI VML+ENP  
Sbjct: 254 KSDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNL 312

Query: 285 RPNSCQVLEEVCRIQGQPCPVKNFY 309
           RPN  QVL ++C+++  P P+ + Y
Sbjct: 313 RPNIYQVLHQICQLKQVPIPIADKY 337

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  306 bits (784), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 197/314 (62%), Gaps = 12/314 (3%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDS-----------KVKDVACLK 55
           + F  G+ + VG+ KV++VKYLT GGFAQIY  + +   +           K+ D+ACLK
Sbjct: 23  EKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLK 82

Query: 56  RVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGG 115
           RV V D+  LN +R EV+ MKLL+G  +IV Y DS+AS+       +EV+LLME C    
Sbjct: 83  RVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNKS 142

Query: 116 LISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVC 175
           L+ FMN RL  +L E E+L IM+ V   +  MH L PPLIHRDIKIENVL+      K+ 
Sbjct: 143 LLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKLA 202

Query: 176 DFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFL 235
           DFGS            +++ +  DI  +TT QYR+PEMIDLY+   +DEKSDIWALG+FL
Sbjct: 203 DFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIFL 262

Query: 236 YKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
           YKL +Y TPFE TG+ AIL + + FP    YS+RL NLI +ML+ENP  RPN  QVL E+
Sbjct: 263 YKLLFYITPFEMTGQFAILHSKYDFPQT-NYSSRLINLIIIMLSENPNLRPNIYQVLHEI 321

Query: 296 CRIQGQPCPVKNFY 309
           C I G    + + Y
Sbjct: 322 CSISGTRLEITDKY 335

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  305 bits (781), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 158/327 (48%), Positives = 206/327 (62%), Gaps = 21/327 (6%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVIS----------------P 44
           ++ L  + F  G  + VGSH V++VKYLT GGFAQIY  ++                   
Sbjct: 21  ISNLAIEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQ 80

Query: 45  DSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEV 104
           + K+ D+ CLKRV V D+  L+ ++ EV+ MK LRG  ++V Y DS+A+++   NG +EV
Sbjct: 81  ELKIGDLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEV 140

Query: 105 VLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENV 164
            LLMEYC    L+ +MN RL  +L E E+L IM  +  G+  +H L  PLIHRDIKIENV
Sbjct: 141 FLLMEYCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENV 200

Query: 165 LIAENGDCKVCDFGSVCGVIRPPKNTY--ELSYVQHDILKNTTAQYRAPEMIDLYRGFSV 222
           L+  N   K+CDFGS    I PP  T   ++S + HDI  +TT QYR+PEMIDL+R   V
Sbjct: 201 LVDHNNRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPV 258

Query: 223 DEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENP 282
           +EK+DIWALGVFLYKL +YTTPFE TG+ AIL + ++ P    YS RL NLI VMLAENP
Sbjct: 259 NEKADIWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQS-HYSERLLNLIVVMLAENP 317

Query: 283 IHRPNSCQVLEEVCRIQGQPCPVKNFY 309
             RPN  QVL E+C I     P+ + Y
Sbjct: 318 NLRPNIYQVLSEICSILNVEVPIPDIY 344

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  303 bits (776), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 202/316 (63%), Gaps = 12/316 (3%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVIS-----------PDSKVKDVACLK 55
           + + PGT + VG+HKV+++KY+  GGFAQIY  + I            P  ++ DVACLK
Sbjct: 20  ERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLK 79

Query: 56  RVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGG 115
           RV V D+  LN +R EV+ MK L+G  +IV Y DS+AS+       +EV+LLME C    
Sbjct: 80  RVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCPNKS 139

Query: 116 LISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVC 175
           L+ +MN RL  +L E E+L+IM  V   +  MH L  PL+HRDIKIENVL+    + K+C
Sbjct: 140 LLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLC 199

Query: 176 DFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFL 235
           DFGS            +++ +  +I  +TT QYR+PEMIDLYR   +DEKSDIWALG+FL
Sbjct: 200 DFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFL 259

Query: 236 YKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
           YKL ++TTPFE TG+ AIL + ++FP    YS++L NLI +MLAENP  RPN  QVL  +
Sbjct: 260 YKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQVLHNI 318

Query: 296 CRIQGQPCPVKNFYLE 311
           C I G   P+++ Y E
Sbjct: 319 CSISGMKVPIEDQYAE 334

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  299 bits (766), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 147/307 (47%), Positives = 201/307 (65%), Gaps = 10/307 (3%)

Query: 12  GTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK---------DVACLKRVHVPDK 62
           G++L VG H+V++++YL  GGFA IY    I   +++          D+ACLKRV V D+
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVNDE 90

Query: 63  QSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNT 122
             LN LR EV+ MK L+G  ++V Y DS+AS+       +EV+LLME CS G L+ +MN 
Sbjct: 91  NGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMNQ 150

Query: 123 RLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCG 182
           RL  +L E EVL+IM  + +GI  MH L+ PLIHRDIKIENVL+    + K+CDFGS   
Sbjct: 151 RLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTST 210

Query: 183 VIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYT 242
            +       E++ + ++I  +TT QYR+PEMIDLYR  +++EKSDIWALG+FLYKL +YT
Sbjct: 211 CLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFYT 270

Query: 243 TPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQP 302
           TPFE TG+ AIL + +  P    +S++L NLI VMLAENP  RPN  Q+L  +C I    
Sbjct: 271 TPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSIMECD 329

Query: 303 CPVKNFY 309
            P+++ Y
Sbjct: 330 VPIEDHY 336

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  300 bits (767), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 209/320 (65%), Gaps = 12/320 (3%)

Query: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVI-------SPDSK----VK 49
           +N   ++ +  G +++VG+H+V++V YL  GGFAQIY  + +       S  SK    V 
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 50  DVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLME 109
           D+ACLKRV V D+  LN +R EV+ MK L+ + +IV Y DS+AS+       +EV+LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 110 YCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAEN 169
            C    L+ +MN RL+ +L E E+L+IM  V  GI  MH L  PLIHRDIKIENVL+  N
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 170 GDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIW 229
            + K+CD GS      P  +  +++ +  +I  +TT QYRAPEMIDLYR   ++EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 230 ALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSC 289
           ALG+FLYKL +YTTPFE TG++AIL + + FP   +YS+++ NLI +MLAENP  RPN  
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310

Query: 290 QVLEEVCRIQGQPCPVKNFY 309
           QV+  +C I   P P+++ Y
Sbjct: 311 QVVYHICSIMNLPVPIEDRY 330

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  300 bits (767), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 154/323 (47%), Positives = 204/323 (63%), Gaps = 17/323 (5%)

Query: 2   NQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK------------ 49
           N LP  ++  GT + VGSHKV+V+KY+  GGFAQIY  + I   ++              
Sbjct: 93  NTLP-GNYPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPL 151

Query: 50  ---DVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVL 106
              D+ACLKRV V D   LN +R EV+ M+ L+G   +V Y DS+AS    +   YEV+L
Sbjct: 152 QPGDIACLKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLL 211

Query: 107 LMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLI 166
           LME+C    L+ +MN RL  RL E E+++IM     GI  +H L+ PLIHRDIKIENVL+
Sbjct: 212 LMEFCPNNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLV 271

Query: 167 AENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKS 226
            +  + K+CDFGS         N  +++    +I  NTT QYR+PEMIDLYR   +DEKS
Sbjct: 272 DQENNFKLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKS 331

Query: 227 DIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRP 286
           DIWALGVFLYKL ++TTPFE+TG+ AIL + ++FP    YS++L NLI +MLAENP  RP
Sbjct: 332 DIWALGVFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRP 390

Query: 287 NSCQVLEEVCRIQGQPCPVKNFY 309
           N  QVL+ +C I G   P+ + Y
Sbjct: 391 NIYQVLQYLCSINGWKVPLNDKY 413

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  297 bits (761), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 155/323 (47%), Positives = 210/323 (65%), Gaps = 23/323 (7%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVI-------SPDS-----------KV 48
           + F+ G  L VG+HKV++V YLT GGFAQIY  + I       + D+           K+
Sbjct: 29  EKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLKL 88

Query: 49  KDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLM 108
            DVACLKRV V D+  LN +R EV+ MK LRG  +IV Y DS+A++S   N  YEV+LLM
Sbjct: 89  GDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLLM 148

Query: 109 EYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAE 168
           E CS   L+++MN RL  +L E EVL+IM  V  G+  MH L+ PLIHRDIKIENVL+  
Sbjct: 149 ELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVDS 208

Query: 169 NGDCKVCDFGSVCGVIRPPKNTY--ELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKS 226
           N + K+CDFGS      PP  T   +++ +  ++  +TT QYR+PEMIDLYR   ++EKS
Sbjct: 209 NNNFKLCDFGSATTC--PPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKS 266

Query: 227 DIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRP 286
           DIWALGVFLYKL +YTTPFE TG+ A+L + F  P+  +YS+++ NL+ +ML+EN   RP
Sbjct: 267 DIWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLNLRP 325

Query: 287 NSCQVLEEVCRIQGQPCPVKNFY 309
           N  QV+  +C++     P+ + Y
Sbjct: 326 NIYQVMHYICQLIQVDTPILDIY 348

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  293 bits (751), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 150/314 (47%), Positives = 205/314 (65%), Gaps = 13/314 (4%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVI----------SPDSKVKDVACLKR 56
           +  + G+ + VG+H+V++VKYL  GGFA IY  + +          S   KV + ACLKR
Sbjct: 27  ERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKR 86

Query: 57  VHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGL 116
           V V D+  LN +R EV  MK L G  +IV Y DSHAS+S      +EV+LLME C    L
Sbjct: 87  VLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPNNSL 146

Query: 117 ISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCD 176
           + +MN RL  +L E E+L+IM  V + +  MH L  PLIHRD+KIENVL+  + + K+CD
Sbjct: 147 LDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCD 206

Query: 177 FGSVCGVIRPPKNTY-ELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFL 235
           FGS    + P  NT+ E++ + ++I  +TT QYR+PEMIDLYR   +DEKSDIWALG+FL
Sbjct: 207 FGSTSTCL-PVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFL 265

Query: 236 YKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
           YKL +YTTPFE TG+ AIL + ++FP    YS++L NLI +MLAENP  RPN  Q+++ +
Sbjct: 266 YKLLFYTTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMDNL 324

Query: 296 CRIQGQPCPVKNFY 309
           C I     P+++ Y
Sbjct: 325 CSIMKVENPIEDKY 338

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  296 bits (759), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 146/313 (46%), Positives = 201/313 (64%), Gaps = 11/313 (3%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVI------SPDSKV----KDVACLKR 56
           D + PGTV+ VG+ +V+++ ++  GGFAQIY  + I      +  SK      D+ACLKR
Sbjct: 20  DGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGDIACLKR 79

Query: 57  VHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGL 116
           V VPD+  L+ +R EV+ MK LRG K I+ Y DS+AS+       YEV+LLME C    L
Sbjct: 80  VLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMELCPNNSL 139

Query: 117 ISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCD 176
           + +MN RL  RL E E+L++M      I  MH L  PLIHRDIKIENVL+    + K+CD
Sbjct: 140 LDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQNNFKLCD 199

Query: 177 FGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLY 236
           FGS            +++ +  +I  NTT QYR+PEMIDLYR   ++EKSDIWALG+FLY
Sbjct: 200 FGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 259

Query: 237 KLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVC 296
           KL ++ TPFE TG+ +IL + ++FP+  +YS++L NLI +MLAENP  RPN  QV+  +C
Sbjct: 260 KLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQVMHHIC 318

Query: 297 RIQGQPCPVKNFY 309
            + G   P+++ Y
Sbjct: 319 SVIGCEVPIEDKY 331

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  296 bits (758), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 214/345 (62%), Gaps = 12/345 (3%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVI----------SPDSKVKDVACLKR 56
           + F PG ++ VG+HKV+V+ YL  GGFAQIY  + +          S   K+ DVACLKR
Sbjct: 20  ERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGDVACLKR 79

Query: 57  VHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGL 116
           V V D+  LN +R EV+ MK L+G  ++V Y DS+AS+       +EV+LLME C    L
Sbjct: 80  VLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMELCPNKSL 139

Query: 117 ISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCD 176
           + +MN RL  +L E E+++IM  VV  I  MH L  PLIHRDIKIENVL+  N + K+ D
Sbjct: 140 LDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANNNFKLAD 199

Query: 177 FGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLY 236
           FGS            +++ +  +I  +TT QYR+PEMIDLYR   ++EKSDIWALG+FLY
Sbjct: 200 FGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 259

Query: 237 KLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVC 296
           KL ++TTPFE TG+ AIL + ++FP   +YS++L NLI +MLAENP  RPN  QVL  +C
Sbjct: 260 KLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYHLC 318

Query: 297 RIQGQPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAM-NPQQAKI 340
            I     P+++ Y E +      +Q ++ +    + M   QQ KI
Sbjct: 319 EILNIEVPIEDKYTEGAYNFSKYTQFQNKLQNVQLQMYQLQQKKI 363

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  293 bits (750), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 204/314 (64%), Gaps = 13/314 (4%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVIS--------PDSK--VKDVACLKR 56
           +  + G+ + VG+H+V++VKYL  GGFA IY    I         P  K  V D+ACLKR
Sbjct: 69  EQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKR 128

Query: 57  VHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGL 116
           V V D+  LN +R EV  MK L G  +IV Y DSHAS++   +  +EV LLME C    L
Sbjct: 129 VLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSL 188

Query: 117 ISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCD 176
           + +MN RL  +L E E+L+IM  V + +  MH L  PLIHRD+KIENVL+  N + K+CD
Sbjct: 189 LDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCD 248

Query: 177 FGSVCGVIRPPKNTY-ELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFL 235
           FGS      P  NT+ E++ + ++I  +TT QYR+PEMIDLYR   ++EKSDIWALG+FL
Sbjct: 249 FGSTSTCF-PVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 307

Query: 236 YKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
           YKL +YTTPFE TG+ AIL + ++FP    YS++L NLI +MLAENP  RPN  QV++ +
Sbjct: 308 YKLLFYTTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMDNL 366

Query: 296 CRIQGQPCPVKNFY 309
           C I     P+++ Y
Sbjct: 367 CSILKVKNPLEDKY 380

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  290 bits (741), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 144/316 (45%), Positives = 197/316 (62%), Gaps = 11/316 (3%)

Query: 4   LPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK----------DVAC 53
            P D++ PG ++ VG HKV+++KYL  GGFA+IY  + +    ++           D+ C
Sbjct: 94  FPIDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLIC 153

Query: 54  LKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSR 113
           LKRV V D   LN +R EV  MK L G  +IV   DS+AS+       YEV+LLME CS 
Sbjct: 154 LKRVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSN 213

Query: 114 GGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCK 173
             L+ +MN RL  +L E E+L+IM  V   +  MH L  PLIHRDIKIENVL+    + K
Sbjct: 214 KSLLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFK 273

Query: 174 VCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGV 233
           +CDFGS    +       +++ +  ++  +TT QYR+PEMID+YR   ++EKSDIWALG+
Sbjct: 274 LCDFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGI 333

Query: 234 FLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLE 293
           FLYKL +Y TPFE+TG+ AIL + ++FP +  YS +L NLI +MLAENP  RPN  QVL 
Sbjct: 334 FLYKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLA 392

Query: 294 EVCRIQGQPCPVKNFY 309
            +C+I     P+ + Y
Sbjct: 393 YICKIINIKTPIDDIY 408

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  293 bits (751), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 197/313 (62%), Gaps = 11/313 (3%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVIS----------PDSKVKDVACLKR 56
           + F PG V+ VG+H+V+VV YL  GGFAQIY  + +              KV DVACLKR
Sbjct: 20  ERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVACLKR 79

Query: 57  VHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGL 116
           V V D+  L+ +R EV+ MK L G ++IV Y DS+A +    N  +EV+LLME C    L
Sbjct: 80  VLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPNKSL 139

Query: 117 ISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCD 176
           + +MN RL  +L E E+L+IM  V   +  MH L+ PLIHRDIKIENVL+      K+CD
Sbjct: 140 LDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFKLCD 199

Query: 177 FGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLY 236
           FGS            E++ +  +I  +TT QYR PEMIDLYR   ++EKSDIWALG+FLY
Sbjct: 200 FGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGIFLY 259

Query: 237 KLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVC 296
           KL ++ TPFE TG+ AIL + ++FP    YS++L NLI +MLAENP  RPN  QVL  +C
Sbjct: 260 KLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLNHIC 318

Query: 297 RIQGQPCPVKNFY 309
            + G   P+++ Y
Sbjct: 319 TMIGVEVPIEDKY 331

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  293 bits (749), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 153/318 (48%), Positives = 200/318 (62%), Gaps = 34/318 (10%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVI----------------SPDSKVKD 50
           + ++ GT+LTVG  +++++KYLT GGFAQIY    I                S + K+ D
Sbjct: 38  EKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIGD 97

Query: 51  VACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNG---------- 100
           VACLKRV VPD+  L+ +R EVD MK L    +IV Y DS+ASK   N+           
Sbjct: 98  VACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNNNDNN 157

Query: 101 -----SYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLI 155
                 +E++LLMEYC    L+ FMN RL  +L E E+L+ M  +   +L MH L  PLI
Sbjct: 158 KNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPLI 217

Query: 156 HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTY-ELSYVQHDILKNTTAQYRAPEMI 214
           HRDIKIENVL+  N + K+ DFGS    I+PP  T+ +++ +  DI  NTT QYR+PEMI
Sbjct: 218 HRDIKIENVLVDSNNNFKLADFGSTTK-IQPPITTHQDIAILNKDIYMNTTPQYRSPEMI 276

Query: 215 DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLI 274
           DLY+   +DEKSDIWALGV LYKL +YTTPFE TG+ AIL + ++FP+   YS++  NLI
Sbjct: 277 DLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFINLI 335

Query: 275 TVMLAENPIHRPNSCQVL 292
            +MLAENP  RPN  QVL
Sbjct: 336 IIMLAENPNLRPNIFQVL 353

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  291 bits (744), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 147/315 (46%), Positives = 200/315 (63%), Gaps = 11/315 (3%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVI----------SPDSKVKDVACLKR 56
           + + PG ++ VG+HKV++V YL  GGFAQIY  + +          S   K+ DVACLKR
Sbjct: 20  ERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGDVACLKR 79

Query: 57  VHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGL 116
           V V D+  LN +R EV+ MK L+G  ++V Y DS+AS+       +EV+LLME C    L
Sbjct: 80  VLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMELCPNKSL 139

Query: 117 ISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCD 176
           + +MN RL  +L E E+++IM  V   I  MH L  PLIHRDIKIENVL+    + K+ D
Sbjct: 140 LDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAENNFKLAD 199

Query: 177 FGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLY 236
           FGS            +++ +  +I  +TT QYR+PEMIDLYR   ++EKSDIWALG+FLY
Sbjct: 200 FGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 259

Query: 237 KLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVC 296
           KL ++TTPFE TG+ AIL + ++FP   +YS++L NLI +MLAENP  RPN  QVL  +C
Sbjct: 260 KLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYHIC 318

Query: 297 RIQGQPCPVKNFYLE 311
            I     P+++ Y E
Sbjct: 319 DILNAEVPIEDKYSE 333

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  291 bits (745), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 202/328 (61%), Gaps = 26/328 (7%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISP-----DS--------------- 46
           + F  GT + VGSHKV+++KY+  GGFAQIY  + +       DS               
Sbjct: 22  EKFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAP 81

Query: 47  -----KVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGS 101
                K+ D+ACLKRV V D+  LN +R EV+ MK L+G  ++V Y DS+AS+       
Sbjct: 82  NPMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASG 141

Query: 102 YEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKI 161
           +EV+LLME C    L+ +MN RL  +L E E+L+IM  +   +  MH L+ PL+HRDIKI
Sbjct: 142 FEVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKI 201

Query: 162 ENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFS 221
           ENVL+    + K+CDFGS    +       +++ +  +I  +TT QYR+PEMIDLYR   
Sbjct: 202 ENVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLP 261

Query: 222 VDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAEN 281
           +DEKSDIWALG+FLYKL ++ TPFE TG+ AIL + ++FP    YS++L NLI +MLAEN
Sbjct: 262 IDEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAEN 320

Query: 282 PIHRPNSCQVLEEVCRIQGQPCPVKNFY 309
           P  RPN  QVL+ +C +     P+++ Y
Sbjct: 321 PNLRPNIYQVLDNICSMMNVEVPIEDIY 348

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  285 bits (728), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 145/310 (46%), Positives = 200/310 (64%), Gaps = 12/310 (3%)

Query: 11  PGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVIS--------PDSKV---KDVACLKRVHV 59
           P T + VG+H+ +++++L  GGFA IY  + +          DSK+    D+ACLKRV V
Sbjct: 31  PNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIV 90

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119
           PD+  LN LR EV+ MK LRG+ +IV Y DS+AS+    +  +E++LLME C +  L+ +
Sbjct: 91  PDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDY 150

Query: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179
           MN +L  +L E E+L+IM  V   I  MH L  PLIHRDIKIENVL+ ++ + K+CDFGS
Sbjct: 151 MNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGS 210

Query: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
                       +++ + ++I  +TT QYR+PEMIDLYR   ++EKSDIWALG+FLYKL 
Sbjct: 211 TSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 270

Query: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299
           +YTTPFE TG+ AIL + ++ P    YS++L NLI +MLAENP  RPN  QV+  VC I 
Sbjct: 271 FYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSIL 329

Query: 300 GQPCPVKNFY 309
               P  + Y
Sbjct: 330 KCDVPFTDKY 339

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  289 bits (740), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 159/364 (43%), Positives = 219/364 (60%), Gaps = 18/364 (4%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVI----------SPDSKVKDVACLKR 56
           + + PG ++ VG+HKV+VV YL  GGFAQIY  + +          S   K+ DVACLKR
Sbjct: 20  ERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKR 79

Query: 57  VHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGL 116
           V V D+  LN +R EV+ MK L+G  +IV Y DS+AS+       +EV+LLME C    L
Sbjct: 80  VLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMELCPNKSL 139

Query: 117 ISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCD 176
           + +MN RL  +L E E+++IM  V   I  MH L   LIHRDIKIENVL+    + K+ D
Sbjct: 140 LDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLAD 199

Query: 177 FGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLY 236
           FGS            +++ +  +I  +TT QYR+PEMIDLYR   ++EKSDIWALGVFLY
Sbjct: 200 FGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLY 259

Query: 237 KLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVC 296
           KL ++TTPFE TG+ AIL + ++FP   +YS++L NLI +MLAENP  RPN  QVL  +C
Sbjct: 260 KLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYHLC 318

Query: 297 RIQGQPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAM-NPQQAKIPIVIPQVQNSVLPSN 355
            I     P+++ Y E +      +Q ++ +    + M   QQ KI      +QN+ L  +
Sbjct: 319 EILNVEVPIEDKYAEGAYNFSKYTQFQNKLQNVQLQMYQLQQKKI------MQNNKLSDS 372

Query: 356 TMNM 359
             N+
Sbjct: 373 EENL 376

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  288 bits (738), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 158/364 (43%), Positives = 218/364 (59%), Gaps = 18/364 (4%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVI----------SPDSKVKDVACLKR 56
           + + PG ++ VG+HKV++V YL  GGFAQIY  + +          S   K+ D+ACLKR
Sbjct: 20  ERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGDLACLKR 79

Query: 57  VHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGL 116
           V V D+  LN +R EV+ MK L+G  ++V Y DS+AS+       +EV+LLME C    L
Sbjct: 80  VLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMELCPNKSL 139

Query: 117 ISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCD 176
           + +MN RL  +L E E+++IM  V   I  MH L  PLIHRDIKIENVL+      K+ D
Sbjct: 140 LDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKDSFKLAD 199

Query: 177 FGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLY 236
           FGS            +++ +  +I  +TT QYR+PEMIDLYR   ++EKSDIWALG+FLY
Sbjct: 200 FGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 259

Query: 237 KLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVC 296
           KL ++TTPFE TG+ AIL + ++FP   +YS++L NLI +MLAENP  RPN  QVL  +C
Sbjct: 260 KLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLCHLC 318

Query: 297 RIQGQPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAM-NPQQAKIPIVIPQVQNSVLPSN 355
            I     P+++ Y E        +Q ++ +    + M   QQ KI      VQNS L  +
Sbjct: 319 DILNVEVPIEDKYAEGPYNFARYTQFQNKLQNVQLQMYQLQQKKI------VQNSKLSDS 372

Query: 356 TMNM 359
             N+
Sbjct: 373 EENL 376

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  283 bits (723), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 197/314 (62%), Gaps = 10/314 (3%)

Query: 5   PQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK---------DVACLK 55
           P +  Q G+ + VG H+V+V++YL  GGFA IY    +   +++          D  CLK
Sbjct: 25  PLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLK 84

Query: 56  RVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGG 115
           RV V D+  LN LR EV+ MK LR   +IV Y DS+AS+       YEV+LLME C  G 
Sbjct: 85  RVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGS 144

Query: 116 LISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVC 175
           L+ +MN RL  +L E EVL+IM  +  G+  MH  + PLIHRDIKIENVL+  + + K+C
Sbjct: 145 LLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLC 204

Query: 176 DFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFL 235
           DFGS    +    +  E++ + ++I  +TT QYR+PEMIDLYR   ++EKSDIWALG+FL
Sbjct: 205 DFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFL 264

Query: 236 YKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
           YKL +YTTPFE TG+ AIL + ++ P    +S++L NL+ +MLAENP  RPN  QV+  +
Sbjct: 265 YKLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHI 323

Query: 296 CRIQGQPCPVKNFY 309
           C +      + + Y
Sbjct: 324 CSMMECEVKIDDLY 337

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  285 bits (728), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 197/315 (62%), Gaps = 13/315 (4%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVIS------------PDSKVKDVACL 54
           + ++PG +++VG+H+VK+  YL  GGFAQIY  + I                K  D+ACL
Sbjct: 33  EKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIACL 92

Query: 55  KRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRG 114
           KRV V D+  LN +R EV+ MKLL+G  +IV Y DS+A +       YE++LLME C   
Sbjct: 93  KRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPNN 152

Query: 115 GLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKV 174
            L+ +MN RL+ +L E E+++IM      +  MH L  PLIH+DIK+EN+L+  N + K+
Sbjct: 153 SLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFKL 212

Query: 175 CDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVF 234
           CDFGS         + ++++ +  +I  +TT QYR+PEMIDLYR   ++E SDIWALGVF
Sbjct: 213 CDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGVF 272

Query: 235 LYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEE 294
           LYKL ++ TPFE+TG+ +IL A F  P    Y  +L NLI +ML+EN   RPN  QV+ E
Sbjct: 273 LYKLLFFITPFERTGQFSILHAKFDIP-VNNYHPKLINLIIIMLSENLNLRPNIYQVMYE 331

Query: 295 VCRIQGQPCPVKNFY 309
           +C I   P P+++ Y
Sbjct: 332 ICSITNTPLPIEDKY 346

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  281 bits (718), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 200/317 (63%), Gaps = 19/317 (5%)

Query: 6   QDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK--------------DV 51
           ++ F  G V+TVGSH+V+VV YL  GGFAQIY  + +   ++ +                
Sbjct: 93  EEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSP 152

Query: 52  ACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGS----YEVVLL 107
           ACLKRV V D+  LN +R+EV+ MK L+G  +IV Y DS+AS+    +G+    +EV+LL
Sbjct: 153 ACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLL 212

Query: 108 MEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIA 167
           ME C    L+ +MN RL  +L E E+ +IM  +   +  MH L  PLIHRDIKIENVL+ 
Sbjct: 213 MELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVD 272

Query: 168 ENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSD 227
            N + K+CDFGS         +  +++ +  D+  +TT QYR+PEMIDL++   ++EKSD
Sbjct: 273 ANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSD 332

Query: 228 IWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPN 287
           IWALGVFLYKL ++TTPFE+TG+ A+L + F+FP    YS++L NLI VMLAENP  RPN
Sbjct: 333 IWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPN 391

Query: 288 SCQVLEEVCRIQGQPCP 304
             QVL  +  +  +  P
Sbjct: 392 IYQVLYYLSEVTNREVP 408

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 83/339 (24%), Positives = 145/339 (42%), Gaps = 62/339 (18%)

Query: 13  TVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEV 72
           + +++   K ++ K L  GG + +Y  E     SK  ++  LK+   P      ++ +  
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVE-----SKEGELFALKKTRCP----FGSIGSIS 67

Query: 73  DAMKLLRGNK-----HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQD- 126
            AMK +   +     +I   +DS   +    +GS  V +L+ Y ++G L   +N  L D 
Sbjct: 68  PAMKEVANYQRFSSPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDC 125

Query: 127 -RLKEFEVLRIMNQVVQGILAMHALQP--------------------------------- 152
            ++ E ++LR+   + +G+L +H   P                                 
Sbjct: 126 TQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGES 185

Query: 153 --PLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYE-LSYVQHDILKNTTAQYR 209
                HRD+K  N++I+      + D GS C   R   N+ + L   Q     N T  Y 
Sbjct: 186 QQSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYA 244

Query: 210 APEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV-------AILKANFQFPS 262
           APE++D+     + EK DIW+ G  +Y +C+  +PFE+  ++       AI    +  P 
Sbjct: 245 APEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPR 304

Query: 263 YPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQ 301
              YS+ L  LI   L+ NP  RP+  +++  +  +QGQ
Sbjct: 305 GTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQGQ 343

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 93.6 bits (231), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 82/340 (24%), Positives = 146/340 (42%), Gaps = 55/340 (16%)

Query: 8   SFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVP--DKQSL 65
           S QP  V +V  H+  + + L  GGF+ +Y  E     S+   +  LK++  P     S+
Sbjct: 13  SSQPSYV-SVNGHRYHIKRLLGEGGFSFVYLVE-----SRENGLMALKKIRCPFGSIGSI 66

Query: 66  NTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQ 125
           +    EVD  +  + + +I   IDS   +    +GS  V +L+ Y S+G L   +N  L 
Sbjct: 67  SPAMKEVDNYQKFK-SPYIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLL 123

Query: 126 D--RLKEFEVLRIMNQVVQGILAMHALQPP------------------------------ 153
           D  ++ E EV+R+   V +G+L +H   P                               
Sbjct: 124 DCTQVPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFG 183

Query: 154 -----LIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQY 208
                  H DIK  N++I+  G   + D GS         +   L   Q    ++ T  +
Sbjct: 184 ESHQAYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTF 243

Query: 209 RAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV-------AILKANFQFP 261
            APE++D+     + EK D+W+ G  +Y +C+  +PFE+  ++       ++    +  P
Sbjct: 244 MAPEILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIP 303

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQ 301
           S   YS+ L +++   L  +P  RP+  +++  +  +Q Q
Sbjct: 304 SGTNYSSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQSQ 343

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 95.9 bits (237), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 82/307 (26%), Positives = 149/307 (48%), Gaps = 39/307 (12%)

Query: 7   DSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPD-KQSL 65
           ++  P T+ T+        K +  G F  ++     + ++  K+V  +K +++ D ++  
Sbjct: 8   NTLPPSTLFTID-------KCVGKGNFGDVFK----AMNNVTKEVVAIKIINLDDSEEET 56

Query: 66  NTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQ 125
             +  E+  M LL+ + +I  YI +        N  Y + ++MEYC  G     + T  +
Sbjct: 57  FEIIKEMRLMSLLK-SPYIARYITTI-------NEDYLMWIVMEYCGGGSARDLIKTCYR 108

Query: 126 DRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIR 185
           + L E +V  ++  V+ G+  +HA     IHRDIK  N+L+ ++G  KV DFG V   +R
Sbjct: 109 EGLAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMR 165

Query: 186 PPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPF 245
                   ++V        T  + APE++ +  G   +EKSDIW+LG+  Y+L     P 
Sbjct: 166 STMKAK--TFV-------GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPL 215

Query: 246 EKTGEVAILKANFQFPSYPQ----YSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQ 301
            K   + +++ N      P+    Y+N +K+ I   L ++P  RP++ ++LE    ++G 
Sbjct: 216 AKYDAIRVMR-NIPKRKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEHDFMVKG- 273

Query: 302 PCPVKNF 308
           P  V+N 
Sbjct: 274 PGNVENL 280

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 120/242 (49%), Gaps = 38/242 (15%)

Query: 67  TLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQD 126
           T+  E++  KL+ G+K+I+S ID     + +        +++E C  G L   +  R + 
Sbjct: 95  TILKEIEIHKLVNGHKNIISMIDHFEIDATM-------YMVLELCGAGSLYDII-CRSKR 146

Query: 127 RLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRP 186
            L+E+E  R+M Q+   +  +H  +  ++H D+K+ N+LI  + + ++CDFG        
Sbjct: 147 SLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH------- 197

Query: 187 PKNTYELSYVQHDILKNT-----TAQYRAPEMIDLY-----RGFSVDEKSDIWALGVFLY 236
                  S+V  DI  N+     T  Y +PE+I  +     +     ++SDIW++G+ LY
Sbjct: 198 -------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLY 250

Query: 237 KLCYYTTPFEKTGEVA----ILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
            + +  TPFE T   +    I++  + F    + SN++K LI  +L   P+ R    +++
Sbjct: 251 AMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIV 310

Query: 293 EE 294
            +
Sbjct: 311 SD 312

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 130/278 (46%), Gaps = 42/278 (15%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLN--------TLRAEVDAMKLLRGNK 82
            G F  +Y C  ++      ++  +K+V VP   S N         LR+EV  +K L  + 
Sbjct: 1187 GSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDL-DHL 1241

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+          N +    L +EY + G + S +  R+  R  E  +  +  QV++
Sbjct: 1242 NIVQYLG-------FENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLK 1292

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+ ++G CK+ DF    G+ R  K+ Y  S    D+  
Sbjct: 1293 GLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDIYSNS----DMTM 1342

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL----KANF 258
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +    K+  
Sbjct: 1343 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKS 1400

Query: 259  QFP----SYPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
              P    + P  S   ++ +      NP  RP + ++L
Sbjct: 1401 APPIPEDTLPLISQVGRSFLDACFEINPEERPTATELL 1438

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/335 (23%), Positives = 146/335 (43%), Gaps = 62/335 (18%)

Query: 13  TVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVAC------LKRVHVPDKQSLN 66
           T + V   + K+ + L  GG + +Y  +++     +++ A       LK++  P  ++++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 67  TLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQD 126
               E++  K  + + +++  IDS   +    +GS  + +++ Y S G L   +N RL +
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 127 R--LKEFEVLRIMNQVVQGILAMHA---------------------------------LQ 151
              + E E +RIM  V +G+L +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 152 PPLI-----------HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDI 200
             ++           HRDI   N+L + +G   + D GS         N  +LS +Q  +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 201 LKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV-------AI 253
             N T  Y APE+++L    ++  K DIW++G   Y L +  +PFE+  ++       AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 254 LKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNS 288
               + FP   ++S RL ++I   +  +PI RP +
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRPTT 352

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/339 (22%), Positives = 149/339 (43%), Gaps = 62/339 (18%)

Query: 13  TVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK------DVACLKRVHVPDKQSLN 66
           T + V   + K+ + L  GG + +Y  +++     ++      ++  LK++  P+ +S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 67  TLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQD 126
               E++  K  + + +++  IDS   +    +GS  + +++ + + G L   +N RL +
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 127 R--LKEFEVLRIMNQVVQGILAMHA---------------------------------LQ 151
              + E E +RIM  V++G+L +H                                  L+
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 152 PPLI-----------HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDI 200
             ++           HRDI   N+L + +G   + D GS         N  +L  +Q  +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 201 LKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV-------AI 253
             N T  Y APE++ L    ++D K DIW+LG   Y L +  +PFE+  ++       AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 254 LKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
               + FP   ++S  L ++I   +  +P+ RP + Q+L
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 130/278 (46%), Gaps = 42/278 (15%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLN--------TLRAEVDAMKLLRGNK 82
            G F  +Y C  ++      ++  +K+V VP   S N         LR+EV  +K L  + 
Sbjct: 1184 GSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHL 1238

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+          N +    L +EY + G + S +  R+  R  E  +  +  QV++
Sbjct: 1239 NIVQYLG-------FENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLK 1289

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+ ++G CK+ DF    G+ R  K+ Y  S    D+  
Sbjct: 1290 GLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDIYSNS----DMTM 1339

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL----KANF 258
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +    K+  
Sbjct: 1340 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKS 1397

Query: 259  QFP----SYPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
              P    + P  S   +N +      NP  RP + ++L
Sbjct: 1398 APPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 114/232 (49%), Gaps = 34/232 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLN--------TLRAEVDAMKLLRGNK 82
            G F  +Y C  ++      ++  +K+V VP   S N         LR+EV  +K L  + 
Sbjct: 1190 GSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHL 1244

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+      S+ +       L +EY + G + S +  R+  R  E  +  +  QV++
Sbjct: 1245 NIVQYLGFENKNSIYS-------LFLEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLR 1295

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+ ++G CK+ DF    G+ R  K+ Y  S    D+  
Sbjct: 1296 GLAYLHSKG--ILHRDMKADNLLLDQDGICKISDF----GISRKSKDIYSNS----DMTM 1345

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +
Sbjct: 1346 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNLEVVAAM 1395

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 93.6 bits (231), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 126/271 (46%), Gaps = 29/271 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++   D KV     + ++ +  +++ N L +E+   K +R +++IV 
Sbjct: 103 FLGEGGFAR--CFQMKDDDGKVFAAKTVAKISIKSEKARNKLLSEIQIHKNMR-HQNIVH 159

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID              V +L+E C  G L+  +  R    L E EV     Q+   +  
Sbjct: 160 FIDCFED-------DINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALDH 210

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+    +IHRD+K+ N+   ++ + K+ DFG    +    +  Y +           T 
Sbjct: 211 MHSRN--IIHRDLKLGNIFFDKDFNLKIGDFGLAAIINNENERKYTIC---------GTP 259

Query: 207 QYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVA-----ILKANFQFP 261
            Y APE+I   +      + DIW+LGV ++ +     PF+   EV+     I   N+ FP
Sbjct: 260 NYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQ-AKEVSTIYDRIKHCNYSFP 318

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
           +    S  +K LI  +L+ NP+ RP   ++L
Sbjct: 319 TDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 92.8 bits (229), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 128/274 (46%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K +R + ++V 
Sbjct: 96  FLGEGGFAR--CFQIKDESGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HFNVVQ 152

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID     +        V +L+E C  G L+  +  R    + E EV   M Q+   I  
Sbjct: 153 FIDCFEDDT-------NVYILLEICPNGSLMELLKKRRT--VTEPEVRYFMTQICGAIKY 203

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   +N + K+ DFG    +    +  Y +           T 
Sbjct: 204 MHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVC---------GTP 252

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE ++  + G S +   DIW++GV +Y L     PF+      I +     +F FP
Sbjct: 253 NYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDFAFP 310

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                SN  K LI  +L+ +P+ RP+  ++++ V
Sbjct: 311 KDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 92.8 bits (229), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 130/275 (47%), Gaps = 30/275 (10%)

Query: 26  KYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIV 85
           ++L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K +  + +IV
Sbjct: 85  QFLGEGGFAR--CFQIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSM-SHTNIV 141

Query: 86  SYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGIL 145
            +ID           +  V +L+E C  G L+  +  R    + E EV   M Q+  GI 
Sbjct: 142 QFIDCFED-------NVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGIQ 192

Query: 146 AMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTT 205
            MH+ +  +IHRD+K+ N+   E+ + K+ DFG    +    +  + +           T
Sbjct: 193 YMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTIC---------GT 241

Query: 206 AQYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFE----KTGEVAILKANFQF 260
             Y APE ++  + G S +   DIW++GV LY L     PF+     T    I + NF +
Sbjct: 242 PNYIAPEVLMGKHSGHSYE--VDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAY 299

Query: 261 PSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
           P   + S   K LI  +L+ NP+ RP+  ++++ V
Sbjct: 300 PKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 139/299 (46%), Gaps = 35/299 (11%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K ++ ++++V 
Sbjct: 87  FLGEGGFAR--CFQIKDDSGKIFAAKTVAKLSIKSEKTRKKLLSEIQIHKSMK-HQNVVQ 143

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID     +        V +L+E C  G L+  +  R    L E EV     Q+   I  
Sbjct: 144 FIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+    N + K+ DFG    +    +  Y +           T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVC---------GTP 243

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE ++  + G S +   DIW++GV LY L     PF+      I +     +F FP
Sbjct: 244 NYIAPEVLMGKHSGHSYE--VDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSFP 301

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVKNFYLERSLKQQIPS 320
                SN  K LI  +L+ +P+ RP+  ++++ V   +G   P    Y+E ++  ++P+
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVW-FRGIFPP----YIESTVMTEVPN 355

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 128/278 (46%), Gaps = 42/278 (15%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLN--------TLRAEVDAMKLLRGNK 82
            G F  +Y C  ++      ++  +K+V VP   S N         LR+EV  +K L  + 
Sbjct: 1184 GSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHL 1238

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+          N      L +EY + G + S +  R+  R  E  +  +  QV++
Sbjct: 1239 NIVQYLG-------FENKDNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLK 1289

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+ ++G CK+ DF    G+ R  K+ Y  S    D+  
Sbjct: 1290 GLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKDIYSNS----DMTM 1339

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL----KANF 258
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +    K+  
Sbjct: 1340 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKS 1397

Query: 259  QFP----SYPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
              P    + P  S   +  +      NP  RP + ++L
Sbjct: 1398 APPIPEDTLPLISQVGRGFLDACFEINPEKRPTATELL 1435

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 129/274 (47%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K +R + +IV 
Sbjct: 106 FLGEGGFAR--CFQIKDDSGKIFAAKTVAKLSIKTEKTRKKLLSEIQIHKSMR-HANIVQ 162

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID    ++        V +L+E C  G L+  +  R    L E EV     Q+  GI  
Sbjct: 163 FIDCFEDET-------NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIKY 213

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   +N + K+ DFG    +    +  Y +           T 
Sbjct: 214 MHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVC---------GTP 262

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE ++  + G S +   DIW++GV +Y L     PF+      I +     +F FP
Sbjct: 263 NYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFP 320

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                S+  + L+  +L+ +P+ RP+  +VL+ V
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 133/282 (47%), Gaps = 48/282 (17%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPD--------KQSLNTLRAEVDAMKLLRGNK 82
            G F  +Y    I+      ++  +K+V VP         K  +  L++EV  +K L  + 
Sbjct: 1160 GSFGAVYLSLNIT----TGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-DHL 1214

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+ S    ++ +       L +EY + G + S +  RL  R  E  +  +  QV+ 
Sbjct: 1215 NIVQYLGSEIRGNIYS-------LFLEYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVLS 1265

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+ E+G CK+ DF    G+ +  KN Y  S    D+  
Sbjct: 1266 GLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKNIYSNS----DMTM 1315

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQF-- 260
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     + ++ A FQ   
Sbjct: 1316 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPW---SNLEVVAAMFQIGK 1370

Query: 261  ----PSYPQ-----YSNRLKNLITVMLAENPIHRPNSCQVLE 293
                P  P       S++ K+ ++     +P  RP +  +LE
Sbjct: 1371 SKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/335 (24%), Positives = 142/335 (42%), Gaps = 63/335 (18%)

Query: 13  TVLTVGSHKVKVVKYLTSGGFAQIYCCE----VISPDSKVKDVACLKRVHVP--DKQSLN 66
           + L++   +  + K L    F+ IY  +    V +  +   ++  LKR+  P  + +S++
Sbjct: 24  SYLSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESIS 83

Query: 67  TLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQD 126
               EVD  K  + + +I+  +DS  ++    +GS  V +L+ Y   G L    +  L +
Sbjct: 84  GAMKEVDNYKRFQ-SPYIIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNLLN 140

Query: 127 R--LKEFEVLRIMNQVVQGILAMHA---------------------------------LQ 151
              + E E +RI+  + +G+  +H                                  L+
Sbjct: 141 GTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLE 200

Query: 152 PPLI------------HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD 199
             ++            HRDIK  N+L + +G   + + GS            +L+ +Q  
Sbjct: 201 LDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAW 260

Query: 200 ILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV-------A 252
           +  + T  Y APE++ +    SVD K DIW+LG   Y + +  +PFE+  ++       A
Sbjct: 261 VSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYA 320

Query: 253 ILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPN 287
           I   NF FPS  +YS  L  LIT  L  NP  RP+
Sbjct: 321 IGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPD 355

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 115/232 (49%), Gaps = 34/232 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLN--------TLRAEVDAMKLLRGNK 82
            G F  +Y C  ++      ++  +K+V VP   S N         LRAE+  +K L  + 
Sbjct: 1133 GSFGAVYLCLNVT----TGEMMAVKQVEVPKYGSQNEQIIHTVEALRAEMSTLKNL-DHL 1187

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+   A K  +N+      L +EY + G + S +  R+  R  E  +  +  QV++
Sbjct: 1188 NIVQYLGFEA-KDHMNS------LFLEYVAGGSVGSLI--RMYGRFDEVMIKHLTTQVLR 1238

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+ + G CK+ DF    G+ R  K+ Y  S    ++  
Sbjct: 1239 GLSYLHSRG--ILHRDMKADNLLLDQEGVCKISDF----GISRKSKDIYSNS----EMTM 1288

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
              T  + APEM+D  +G+S   K DIW++G  + ++     P+     VA +
Sbjct: 1289 RGTVFWMAPEMVDTAQGYSA--KVDIWSMGCVVLEMFAGKRPWSNLEVVAAM 1338

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 114/232 (49%), Gaps = 34/232 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQS--------LNTLRAEVDAMKLLRGNK 82
            G F  +Y C  ++      ++  +K+V VP   S        +  LR+EV  +K L  + 
Sbjct: 1223 GSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDL-DHL 1277

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+      ++ +       L +EY + G + S +  R+  R  E  +  +  QV++
Sbjct: 1278 NIVQYLGFENKDNIYS-------LFLEYVAGGSVGSLI--RMYGRFDEPLIRHLNTQVLR 1328

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+ ++G CK+ DF    G+ R  K+ Y  S    D+  
Sbjct: 1329 GLAYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSKDIYSNS----DMTM 1378

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +
Sbjct: 1379 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNYEVVAAM 1428

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 128/274 (46%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K +R + +IV 
Sbjct: 78  FLGEGGFAR--CFQMKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HPNIVQ 134

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           + D     +        V +L+E C  G L+  +  R Q  L E EV     Q+V  I  
Sbjct: 135 FTDCFEDDT-------NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIKY 185

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   ++ + K+ DFG    +    +  Y +           T 
Sbjct: 186 MHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTIC---------GTP 234

Query: 207 QYRAPEMI-DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE++   + G S +   D+W++GV +Y L     PF+      I +     +F FP
Sbjct: 235 NYIAPEVLTGKHTGHSFE--VDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFNFP 292

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                S+  K LI  +L+ +P+ RP+  +++E V
Sbjct: 293 RDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 97/207 (46%), Gaps = 47/207 (22%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           +V + +EYC    L  ++   +Q R+   E  ++  Q+V  +   H+LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 163 NVLIAENGDCKVCDFG------------SVCGVIRPPKNTYELSYVQHDILKNTTAQYRA 210
           N+L+ + G  K+ DFG            +VCG                      T  Y A
Sbjct: 158 NILLDKKGRAKITDFGFTRECATKTMLETVCG----------------------TTVYMA 195

Query: 211 PEMIDL--YRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAI-LKANFQFPSYPQ-- 265
           PE+I+   Y GF +    DIW+LGV LY + + T PF++  E     K   + P Y    
Sbjct: 196 PELIERKSYDGFKI----DIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFYNDDV 251

Query: 266 YSNRLKNLITVMLAENPIHRPNSCQVL 292
            S   K+LI+ +L ++P  RP   QVL
Sbjct: 252 VSKDAKDLISQLLCKDPSQRPQLSQVL 278

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 133/305 (43%), Gaps = 48/305 (15%)

Query: 8    SFQPGTVLTVGSHK-------VKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVH-- 58
            +F+     T+G+ K         ++K +  G + ++  C       K K +  +K +   
Sbjct: 981  TFRETPQTTIGAQKRTKKITDFIILKKMGEGAYGKVDLCY----HKKEKYIVVIKMIFKE 1036

Query: 59   -------VPDKQSLNTLRAEVDAMKLLR--GNKHIVSYIDSHASKSVLNNGSYEVVLLME 109
                   V D++ L T+ +E+  M  L    NK+I+S +D         +  Y  V    
Sbjct: 1037 RILVDTWVRDRK-LGTIPSEIQIMSTLNKTSNKNILSILD------FFEDDDYYYVEQPV 1089

Query: 110  YCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAEN 169
            +   G +  F     +  + EFE   I  Q++ GI  +H  +  ++HRDIK ENV++   
Sbjct: 1090 HGKTGCIDLFDLIEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAK 1147

Query: 170  GDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEK-SDI 228
            G  K+ DFGS   V   P + +             T  Y +PE++   RG   + K  DI
Sbjct: 1148 GFVKLIDFGSAAYVKNGPFDVFV-----------GTIDYASPEVL---RGEKYEGKPQDI 1193

Query: 229  WALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNS 288
            WALG+ LY + +   PF    E  IL+ + +FP     S    +LI ++L  + + RP+ 
Sbjct: 1194 WALGILLYTIVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSI 1251

Query: 289  CQVLE 293
              + E
Sbjct: 1252 TDISE 1256

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 128/274 (46%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     KV     + ++ +  +++   L +E+   K ++ + +IV 
Sbjct: 78  FLGEGGFAR--CFQMKDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMK-HPNIVQ 134

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           + D     +        V +L+E C  G L+  +  R Q  L E EV     Q+V  I  
Sbjct: 135 FTDCFEDDT-------NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIKY 185

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   ++ + K+ DFG    +    +  Y +           T 
Sbjct: 186 MHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTIC---------GTP 234

Query: 207 QYRAPEMI-DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE++   + G S +   DIW++GV +Y L     PF+      I +     +F FP
Sbjct: 235 NYIAPEVLTGKHTGHSFE--VDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFP 292

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                S+  K LI  +L+ +P+ RP+  +++E V
Sbjct: 293 KDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 78/335 (23%), Positives = 141/335 (42%), Gaps = 62/335 (18%)

Query: 13  TVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK------DVACLKRVHVPDKQSLN 66
           T + V   + K+ + L  GG + +Y  +++     ++      ++  LK++  P  +S++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 67  TLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQD 126
               E++  K  + + +++  IDS  ++    NGS  + +++ Y S G L   +N RL +
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 127 R--LKEFEVLRIMNQVVQGILAMH------------------------------------ 148
              + E E +RIM  V +G+L +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 149 --------ALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDI 200
                   A      HRDI   N+L +  G   + D GS         +  +LS +Q  +
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 201 LKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV-------AI 253
             N T  Y APE+++L     +  K DIW++G   Y L +  +PFE+  ++       AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 254 LKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNS 288
               + FP   ++S  L N+I   +  +PI RP +
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRPTT 352

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 87.8 bits (216), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 80/340 (23%), Positives = 144/340 (42%), Gaps = 65/340 (19%)

Query: 9   FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKD-------VACLKRVHVPD 61
           F   T+  V   + ++ + L  GG + +Y  + +S +S + D       +  LK++  P 
Sbjct: 18  FSDATI-RVNDKRYRIQRLLGEGGMSFVYLVQ-LSKNSLIIDNGIATPELYALKKIICPS 75

Query: 62  KQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMN 121
            +S++    E++  K  + + +++  IDS   +    +GS  + +++ Y S G L   +N
Sbjct: 76  VESISNGMREIENYKRFQ-SPYVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSIN 132

Query: 122 TRLQDR--LKEFEVLRIMNQVVQGILAMH------------------------------- 148
            RL +   + E E +RIM  V +G+L +H                               
Sbjct: 133 RRLLEGTFVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLE 192

Query: 149 -------------ALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSY 195
                        A      HRDI   N+L + +G   + D GS        +N ++LS 
Sbjct: 193 DTPLEMDMLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSE 252

Query: 196 VQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV---- 251
           +Q  +  N T  Y  PE+++L     +  K DIW+LG   Y L +  +PFE+  ++    
Sbjct: 253 LQEWVNDNCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGAS 312

Query: 252 ---AILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNS 288
              AI    + FP   ++S  L ++I   +  +PI RP +
Sbjct: 313 LTYAINTGKYSFPRNSRFSEGLLSVIKKCIQVDPIQRPTT 352

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 114/232 (49%), Gaps = 34/232 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVP-----DKQSLNT---LRAEVDAMKLLRGNK 82
            G F  +Y C  ++      ++  +K+V VP     D+  L+T   LR+EV  +K L  + 
Sbjct: 1284 GSFGAVYLCLNLT----TGEMMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKDL-DHL 1338

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+       + +       L +EY   G + S +  RL  R  E  +  +  QV++
Sbjct: 1339 NIVQYLGFENDHDIYS-------LFLEYVGGGSVGSLI--RLYGRFDEALIRFLTVQVLE 1389

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+  +G CK+ DF    G+ R  K+ Y  S    D+  
Sbjct: 1390 GLAYLHSKG--ILHRDMKADNLLLDLDGVCKISDF----GISRKSKDIYSNS----DMTM 1439

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +
Sbjct: 1440 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNLEVVAAM 1489

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 129/278 (46%), Gaps = 42/278 (15%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQS--------LNTLRAEVDAMKLLRGNK 82
            G F  ++    ++      ++  +K+V VP   S        L  LR+EV  +K L  + 
Sbjct: 1155 GSFGSVFLGLNVT----TGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDL-DHT 1209

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+          N +Y   L +EY + G + S +  RL  +  E  +  +  QV++
Sbjct: 1210 NIVQYLG-------FENKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLR 1260

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+ +  ++HRD+K +N+L+  +G CK+ DF    G+ +   N Y  S    D+  
Sbjct: 1261 GLSYLHSKK--ILHRDMKADNLLLDVDGICKISDF----GISKKSNNIYSNS----DMTM 1310

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPS 262
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +    +F S
Sbjct: 1311 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKS 1368

Query: 263  YPQYSNRLKNLITVMLAE--------NPIHRPNSCQVL 292
             P      + +I+    E        NP  RP + ++L
Sbjct: 1369 APPIPEDTQKIISAEGKEFLDACFEINPEKRPTADELL 1406

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 115/232 (49%), Gaps = 34/232 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQS--------LNTLRAEVDAMKLLRGNK 82
            G F  +Y C  ++      ++  +K+V VP   S        ++ +++EV  +K L  + 
Sbjct: 1263 GSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQDEAIMSTVDAIKSEVSTLKDL-DHL 1317

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+      ++ +       L +EY + G + S +  R+  R  E  +  +  QV++
Sbjct: 1318 NIVQYLGFENKDNIYS-------LFLEYVAGGSVGSLI--RIYGRFDEPLIRHLNIQVLR 1368

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +HA    ++HRD+K +N+L+ ++G CK+ DF    G+ R  K+ Y  S    D+  
Sbjct: 1369 GLAYLHARG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSKDIYSNS----DMTM 1418

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +
Sbjct: 1419 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNFEVVAAM 1468

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 131/301 (43%), Gaps = 58/301 (19%)

Query: 54  LKRVHVP--DKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYC 111
           LKR+  P  + +S++    EVD  K  + + +I++ +DS   +    +GS  + +L+ Y 
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQ-SPYIITLVDSQVVQE--KDGSKTLCILLPYF 129

Query: 112 SRGGLISFMNTRL--QDRLKEFEVLRIMNQVVQGILAMH--------------------- 148
             G L   +N  L     + E E +RIM  + +G+  +H                     
Sbjct: 130 PLGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSY 189

Query: 149 -------ALQPPL----------------IHRDIKIENVLIAENGDCKVCDFGSVCGVIR 185
                      PL                +HRDI++ N+L +  G   V D GS C    
Sbjct: 190 SDEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADI 249

Query: 186 PPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPF 245
                ++L+ +Q  +  N +  Y APE++++    ++D K+DIW++G   Y + +  +PF
Sbjct: 250 TVSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPF 309

Query: 246 EKTGEV-------AILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRI 298
           E+  +V       AI    + FP   +YS  L  +I   L  +P  RP+  ++L+ +  +
Sbjct: 310 ERELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDL 369

Query: 299 Q 299
           Q
Sbjct: 370 Q 370

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 144/312 (46%), Gaps = 35/312 (11%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     KV     + ++ +  +++   L +E+   K ++ + +IV 
Sbjct: 95  FLGEGGFAR--CFQMKDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMK-HPNIVQ 151

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           + D     +        V +L+E C  G ++  +  R +  L E EV   M Q++  I  
Sbjct: 152 FTDCFEDDT-------NVYILLEICPNGSVMELL--RQRKHLTEPEVRFCMIQIIGAIRY 202

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   +  + K+ DFG    +    +  Y +           T 
Sbjct: 203 MHSRR--VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTIC---------GTP 251

Query: 207 QYRAPEMI-DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA----NFQFP 261
            Y APE++   + G S +   DIW++GV LY L +   PF+      I +     +F FP
Sbjct: 252 NYIAPEVLTGKHTGHSYE--VDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFP 309

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVKNFYLERSLKQQIPSQ 321
           +    S+  KNLI+ +L  NP  RP+  ++ + V      P       L  ++ ++IP+ 
Sbjct: 310 ADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSR-----LPSTITKEIPNF 364

Query: 322 LRHSVSQPMIAM 333
              S S+ +I +
Sbjct: 365 DHLSFSESLINL 376

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 123/274 (44%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++      +     + +  +  +++   L +E+   K +  + +IV 
Sbjct: 87  FLGEGGFAR--CFQIKDDSGDIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-AHPNIVQ 143

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID     S        V +L+E C  G L+  +  R    L E EV     Q+   I  
Sbjct: 144 FIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+    N + K+ DFG    +    +  Y +           T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTIC---------GTP 243

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE ++  + G S +   DIW+LGV LY L     PF+      I +     +F FP
Sbjct: 244 NYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                S+  K LI  +L+ +PI RP+  ++++ V
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 105/234 (44%), Gaps = 31/234 (13%)

Query: 63   QSLNTLRAEVDAMKLLRGNKH----IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLIS 118
            + L T+ +E+  M  L  NKH    I++ ID         +  Y  +    +   G +  
Sbjct: 1047 RKLGTIPSEIQIMAAL--NKHPDGNILTLID------FFEDDDYYYIETPVHGETGCIDL 1098

Query: 119  FMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFG 178
            F    L+  + E+E   I  QVV  I  +H+    ++HRDIK ENV++   G  K+ DFG
Sbjct: 1099 FDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVKLIDFG 1156

Query: 179  SVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEK-SDIWALGVFLYK 237
            S   V   P + +             T  Y APE++    G   D K  DIWA+GV LY 
Sbjct: 1157 SAAYVKSGPFDVFV-----------GTIDYAAPEVL---SGEPFDGKPQDIWAIGVLLYT 1202

Query: 238  LCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQV 291
            + +   PF    E  IL+ N +F      S    NLI ++L +NP  RP   +V
Sbjct: 1203 IVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 114/232 (49%), Gaps = 34/232 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLN--------TLRAEVDAMKLLRGNK 82
            G F  ++ C  ++      ++  +K+V VP   S N         LRAEV  +K L  + 
Sbjct: 1191 GSFGAVFLCLNVT----TGEMMAVKQVEVPRYGSQNEAIISTVEALRAEVSTLKDL-DHL 1245

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+      S+ +       L +EY + G + S +  R+  +  E  +  +  QV++
Sbjct: 1246 NIVQYLGFEVKDSIYS-------LFLEYVAGGSVGSLI--RMYGKFDEKLIKHLTIQVLR 1296

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+ ++G CK+ DF    G+ R  K+ Y  S    ++  
Sbjct: 1297 GLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSKDIYSNS----EMTM 1346

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +
Sbjct: 1347 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNLEVVAAM 1396

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 124/274 (45%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     ++     + +  +  +++   L +E+   K +  + +IV 
Sbjct: 87  FLGEGGFAR--CFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-AHPNIVQ 143

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           ++D     S        V +L+E C  G L+  +  R    L E EV     Q+   I  
Sbjct: 144 FVDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+    N + K+ DFG    +    +  Y +           T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTIC---------GTP 243

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE ++  + G S +   DIW+LGV LY L     PF+      I +     +F FP
Sbjct: 244 NYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                S+  K LI  +L+ +PI RP+  ++++ V
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 124/274 (45%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     ++     + +  +  +++   L +E+   K +  + +IV 
Sbjct: 87  FLGEGGFAR--CFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-SHPNIVQ 143

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID     S        V +L+E C  G L+  +  R    L E EV     Q+   I  
Sbjct: 144 FIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+    N + K+ DFG    +    +  Y +           T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTIC---------GTP 243

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE ++  + G S +   DIW+LGV LY L     PF+      I +     +F FP
Sbjct: 244 NYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                S+  K LI  +L+ +PI RP+  ++++ V
Sbjct: 302 RDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 124/274 (45%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     ++     + +  +  +++   L +E+   K +  + +IV 
Sbjct: 87  FLGEGGFAR--CFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-SHPNIVQ 143

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID     S        V +L+E C  G L+  +  R    L E EV     Q+   I  
Sbjct: 144 FIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIKY 194

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+    N + K+ DFG    +    +  Y +           T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTIC---------GTP 243

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE ++  + G S +   DIW+LGV LY L     PF+      I +     +F FP
Sbjct: 244 NYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                S+  K LI  +L+ +PI RP+  ++++ V
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 85/300 (28%), Positives = 136/300 (45%), Gaps = 47/300 (15%)

Query: 12  GTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAE 71
           GT+      KVK+ + LT+GG   I   ++++   K    +    V  P       +R E
Sbjct: 54  GTLGNGQYGKVKLARDLTTGGLVAI---KILNRFEKKNGYSLQGTVENP------RIREE 104

Query: 72  VDAMKLLRGNKHIVSYIDSHASKSVLNN-GSYEVVLLMEYCSRGGLISFMNTRLQDR--- 127
           ++ MK    ++++V   D      +LN+  S +V L++EYCSRG +      +L+ +   
Sbjct: 105 IEIMKRCH-HENVVKLYD------ILNDPESTKVYLVLEYCSRGPVKWCPENQLEIKAVG 157

Query: 128 --LKEFEVLR-IMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVI 184
             +  FE  R I++ VV G+  +H+    + HRDIK  N+LI+ NG  K+ DFG     I
Sbjct: 158 PSILTFEQARKIVSDVVSGLEYLHS--QGITHRDIKPSNLLISSNGAVKISDFGV---SI 212

Query: 185 RPPKNTYELSYVQHDILKNTTA---QYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYY 241
                +  +   Q  I K+ T     + APE+      +      DIW+LGV LY + + 
Sbjct: 213 LTTTGSTNIQSSQEQISKSKTLGTPAFFAPELCTADGDYRCSSAIDIWSLGVTLYCMLFG 272

Query: 242 TTPFEKTGEVA----ILKANFQFPSYPQYSNR------------LKNLITVMLAENPIHR 285
           T PF     +     I+     FPSY Q S R             K+++  +L +NP  R
Sbjct: 273 TLPFNANSALELFDNIISKPLSFPSYEQVSKRGHPNLAREEYNDAKDILNRLLKKNPSER 332

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 111/232 (47%), Gaps = 34/232 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQS--------LNTLRAEVDAMKLLRGNK 82
            G F  +Y C  ++      ++  +K+V VP   S        +  LR+EV  +K L  + 
Sbjct: 1105 GSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQDENIISTVEALRSEVSTLKDL-DHL 1159

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+          N      L +EY + G + S +  R+  R  E  +  +  QV++
Sbjct: 1160 NIVQYLG-------FENKDNIYSLFLEYVAGGSVGSLI--RMYGRFDEAMIRHLTIQVLR 1210

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+ ++G CK+ DF    G+ R   + Y  S    D+  
Sbjct: 1211 GLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSNDIYSNS----DMTM 1260

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +
Sbjct: 1261 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNLEVVAAM 1310

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 90/333 (27%), Positives = 154/333 (46%), Gaps = 58/333 (17%)

Query: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNN-GSYEVVLLMEYCSRGGLIS 118
           P K   + ++ E+  MK    +KH+V  I+      VL++  S ++ L++EYCSRG +  
Sbjct: 188 PGKTENDKIKREIAIMKKCH-HKHVVKLIE------VLDDLKSRKIYLVLEYCSRGEVKW 240

Query: 119 FMNTRLQDRLK-----EFEVLR-IMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDC 172
                L+   K      F+  R I+  VV G+  +H     +IHRDIK  N+L++E G  
Sbjct: 241 CPPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLH--YQGIIHRDIKPANLLLSETGIV 298

Query: 173 KVCDFGSVCGVIRPPKNTYELSYVQHDILKNT-TAQYRAPEMI--------------DLY 217
           K+ DFG          +  + +  + ++ K   T  + APE+               +L+
Sbjct: 299 KISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELF 358

Query: 218 RGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFP-SYPQYSNRLKN---- 272
           +G  +  K DIWALGV LY L +   PF  + E+ + +     P  +P+YS+ LKN    
Sbjct: 359 KGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVL 418

Query: 273 -------------LITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVKNF-YLERSLKQQI 318
                        L+T +L +NPI R N    +EE+ R    P    +F +L+   +Q++
Sbjct: 419 QMTEEAEYEAAKDLLTRLLEKNPIKRIN----IEEIKR---HPFVCWDFDHLDGESEQEL 471

Query: 319 PSQLRHSVSQPMIAMNPQQAKIPIVIPQVQNSV 351
             +L   ++    A      +I + + ++ N+V
Sbjct: 472 SLKLEEKMN-FQCAQRDYLTQISVTMHELNNAV 503

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 88/329 (26%), Positives = 145/329 (44%), Gaps = 70/329 (21%)

Query: 13  TVLTVGSHKVKVVKYLTSGGFAQIYCCEVISP-----------DSKVKDVACLK-----R 56
           T + VGS +  V K +  G FA ++   +I+P            S + +  C       R
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 57  VHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGL 116
             + +K+ L  L  E+  +K +  + HIV  ID           S +  L+MEYCS G L
Sbjct: 89  SKLKNKKLLENLEIEIAILKKI-SHPHIVKLID-------FERTSKDFYLIMEYCSLGDL 140

Query: 117 ISFMNTRLQDRLKEFEVLR--------------------IMNQVVQGILAMHALQPP-LI 155
            +F+  + Q  +K   +L                     I+N + Q   A+  L+   L+
Sbjct: 141 -TFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLV 199

Query: 156 HRDIKIENVLIAE-----NGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQ--- 207
           HRDIK +N+L++      N      D G V     P     +  + +   L NT+     
Sbjct: 200 HRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPNTSMAETL 257

Query: 208 -----YRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVA----ILKAN- 257
                Y APE+++ Y+ ++   K+D+W++G  LY++CY   PF+ +  +     I KAN 
Sbjct: 258 CGSPLYMAPEILN-YQKYNA--KADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKAND 314

Query: 258 -FQFPSYPQYSNRLKNLITVMLAENPIHR 285
              FP+Y +  N LK+LI+ +L  +P  R
Sbjct: 315 LIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 107/214 (50%), Gaps = 34/214 (15%)

Query: 90  SHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHA 149
           +H   S LNN   E+ ++MEYC+ G L + +      ++ E  +  IM +++  I  MH 
Sbjct: 79  THYYGSYLNN--TELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMHI 131

Query: 150 LQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQ-- 207
            +  +IHRDIK  NVLI  +G  K+CDFG             +LS  Q  I + T A   
Sbjct: 132 HKDGVIHRDIKAANVLITNDGHIKLCDFGVAA----------QLS--QTKIRRQTMAGTP 179

Query: 208 -YRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA-NFQFPSYP- 264
            + APE+I    G   D K DIW+LG+  Y++     P+    +V  L+A      S P 
Sbjct: 180 YWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPY---CDVEALRAMQLITKSKPP 234

Query: 265 -----QYSNRLKNLITVMLAENPIHRPNSCQVLE 293
                Q+S+ LK  I + L E+P  RP++ ++L+
Sbjct: 235 RLEGRQHSSALKEFIALCLDEDPKERPSAEELLK 268

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 126/270 (46%), Gaps = 36/270 (13%)

Query: 31  GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQS-LNTLRAEVDAMKLLRGNKHIVSYID 89
           G F  +Y    +    K + V  +K +++ + +  +  +R E+  +  L+   +I  Y  
Sbjct: 25  GKFGVVYKAFHV----KTQQVYAIKVLNLDNTEDEVEDIRKEIQFLSSLKQTPNITHYYG 80

Query: 90  SHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHA 149
           S+   + L        ++MEYC+ G L + +   +   ++E  +  IM +++  ++++H 
Sbjct: 81  SYLIDTKL-------WVIMEYCAGGSLRTLLRPGI---IEEKYIGVIMREILVALISIH- 129

Query: 150 LQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYR 209
            +  +IHRDIK  N+LIA NG  K+CDFG    + +        S ++   +   T  + 
Sbjct: 130 -RDNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQ--------SMLKRQTMAG-TPYWM 179

Query: 210 APEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYP----- 264
           APE+I    G   D K DIW+LG+  Y++     P+      AI        S P     
Sbjct: 180 APEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPY--CHMEAIRAMQMITKSKPPRLEG 235

Query: 265 -QYSNRLKNLITVMLAENPIHRPNSCQVLE 293
            +YS  LK  I + L E+P  RP + ++ +
Sbjct: 236 REYSQPLKEFIALCLDEDPKERPYAEELFK 265

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 103/201 (51%), Gaps = 35/201 (17%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           +V +++EYC    L  ++ ++   R+   E  RI  Q+V  +   H+L    +HRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSLS--CVHRDLKLE 159

Query: 163 NVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGF 220
           N+L+ ++ + K+ DFG         KNT      Q + +  TT  Y APE++  + Y G+
Sbjct: 160 NILLDKDNNAKLTDFGFTRDF---SKNT------QLETICGTTV-YMAPELLRREKYDGY 209

Query: 221 SVDEKSDIWALGVFLYKLCYYTTPFE----KTGEVAILKANFQFPSYPQYSNRLKN---- 272
            +    DIWALG+ LY +   T PF+    K  E+ I+ A+      P Y N+  N    
Sbjct: 210 KI----DIWALGILLYTIINGTMPFDEDDPKKTELKIISAS------PDYDNKYFNDDSI 259

Query: 273 -LITVMLAENPIHRPNSCQVL 292
            L+  +L+++P  RP   Q+L
Sbjct: 260 DLVNRLLSKDPSMRPTIEQIL 280

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/302 (27%), Positives = 139/302 (46%), Gaps = 45/302 (14%)

Query: 4   LPQDSFQPGTVLTVGSH--KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPD 61
           +P    +PG++  +G    K +V+K L  G F ++     +S   KV      K+V +  
Sbjct: 20  MPHGMHRPGSI-PIGQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKV-LAK 77

Query: 62  KQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMN 121
                 +  E+  ++LLR + HI+   D   SK        E+++++EY     L  ++ 
Sbjct: 78  SDMQGRIEREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAG-NELFDYIV 128

Query: 122 TRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVC 181
            R  D++ E E  R   Q++  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG   
Sbjct: 129 QR--DKMSENEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG--- 181

Query: 182 GVIRPPKNTYELSYVQHD--ILKNTTA--QYRAPEMID--LYRGFSVDEKSDIWALGVFL 235
                      LS +  D   LK +     Y APE+I   LY G  V    D+W+ GV L
Sbjct: 182 -----------LSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVIL 226

Query: 236 YKLCYYTTPFEKTGEVAILKANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVL 292
           Y +     PF+    + +L  N     Y  P++ S    NLI  ML  NP++R    +++
Sbjct: 227 YVMLCRRLPFDDES-IPVLFKNISNGVYSIPKFLSQGAANLIKRMLIVNPLNRITIHEIM 285

Query: 293 EE 294
           E+
Sbjct: 286 ED 287

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 88/353 (24%), Positives = 158/353 (44%), Gaps = 50/353 (14%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C +      K+     + ++ +  +++   L +E+   K ++ N +IV 
Sbjct: 88  FLGEGGFAR--CFQFNDDSGKIFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMK-NVNIVQ 144

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID     +        V +L+E C  G L+  +  R    L E EV     Q+   I  
Sbjct: 145 FIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKY 195

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   ++ + K+ DFG    +    +  Y +           T 
Sbjct: 196 MHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVC---------GTP 244

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE ++  + G S +   DIW++GV LY L     PF+      I +     +F FP
Sbjct: 245 NYIAPEVLMGKHTGHSYE--VDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCP---------VKNFYLER 312
                S   K LI  +L+ +P+ RP+  ++++ V   +G   P         + N+  + 
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVW-FRGLFPPQIESDVMTNIPNYDNQL 361

Query: 313 SLKQQIPSQLRHSVSQPMI----AMNPQQAKIPIVI------PQVQNSVLPSN 355
           +++Q I +  +   S  ++    A+NP   K PI I       Q++ +VLP +
Sbjct: 362 TMEQSIVNFKKCLESSGLLSDAAAVNPSSDKQPISIIKNNELQQLRKNVLPDS 414

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 127/278 (45%), Gaps = 42/278 (15%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDK--------QSLNTLRAEVDAMKLLRGNK 82
            G F  ++    I+      ++  +K+V VP           +++ LR EV  +K L  + 
Sbjct: 1149 GSFGAVFLAMNIT----TGEMMAVKQVEVPKYGLQNETVVNTVDALRLEVSTLKDL-DHL 1203

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+   A      NG Y   L +EY + G + S +  R+  R  +  +  +  QV+Q
Sbjct: 1204 NIVQYLGFEA-----KNGIYS--LFLEYVAGGSVGSLI--RMYGRFDDILIRHLTIQVLQ 1254

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+ ++G CK+ DF    G+ R   + Y  S    ++  
Sbjct: 1255 GLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDF----GISRKSNDIYSNS----EMTM 1304

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPS 262
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +    Q  S
Sbjct: 1305 KGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGQAKS 1362

Query: 263  --------YPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
                     P  S   K  +      +P  RP + ++L
Sbjct: 1363 APPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 128/274 (46%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K ++ +++IV 
Sbjct: 150 FLGEGGFAR--CFQIRDDSGKLFAAKTVAKLSIKTEKTRKKLLSEIQIHKSMK-HQNIVQ 206

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID     +        V +L+E C  G L+  +  R Q  L E EV     Q+   I  
Sbjct: 207 FIDCFEDDT-------NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIKY 257

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+    N + K+ DFG    +    +  + +           T 
Sbjct: 258 MHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKFTVC---------GTP 306

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE ++  + G S +   D+W++GV +Y L     PF+      I +     +F FP
Sbjct: 307 NYIAPEVLMGKHSGHSYE--VDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFIFP 364

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                S+  K L+  +L+ +P+ RP+  ++++ V
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 135/299 (45%), Gaps = 46/299 (15%)

Query: 8   SFQPGTVLTVGS-HKVKVVKYLTSGGFAQI-YCCEVISPDSKVKDVACLKRVHVPDKQSL 65
           S++ G  L +GS  KV++    T+G  A I    + I  DS   +V  +     PD    
Sbjct: 17  SWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDS---NVTSMVDNTTPDALPY 73

Query: 66  NTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQ 125
              R E+  MKLL  + +++   D   + S L        +++EY  +G L + +  R  
Sbjct: 74  GIER-EIVIMKLL-NHANVLRLYDVWETNSNL-------YMVLEYAEKGELFNLLVER-- 122

Query: 126 DRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIR 185
             L E E +R   Q++ GI   HAL   ++HRD+K EN+L+    + K+ DFG       
Sbjct: 123 GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFGMAA---- 176

Query: 186 PPKNTYELSYVQHDILKNTTA---QYRAPEMIDL--YRGFSVDEKSDIWALGVFLYKLCY 240
                        D L  T+     Y APE++    Y GF+    SD+W+ GV LY L  
Sbjct: 177 ---------LETEDKLLETSCGSPHYAAPEIVSGIPYHGFA----SDVWSCGVILYALLT 223

Query: 241 YTTPF-EKTGEVA--ILK---ANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLE 293
              PF E+ G +   +LK     F+ P   + S   +NLI+ +L  NP  R  +  +L+
Sbjct: 224 GRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 98/210 (46%), Gaps = 53/210 (25%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           +V + +EYC    L   + +    R+   E   +  Q+   +   H++    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 163 NVLIAENGDCKVCDFG------------SVCGVIRPPKNTYELSYVQHDILKNTTAQYRA 210
           N+L+ +NG+ K+ DFG            +VCG                      T  Y A
Sbjct: 162 NILLDKNGNAKLTDFGFTRECMTKTTLETVCG----------------------TTVYMA 199

Query: 211 PEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPS-YPQYS 267
           PE+I+   Y GF +    DIW+LGV LY L   + PF+   EV   K  ++  +  P Y 
Sbjct: 200 PELIERRTYDGFKI----DIWSLGVILYTLITGSLPFDDDDEV---KTKWKIVNEEPNYD 252

Query: 268 NRL-----KNLITVMLAENPIHRPNSCQVL 292
           + L     K+LI+ +LA+NP  RP+  QVL
Sbjct: 253 STLIPDDAKDLISRLLAKNPKERPSLPQVL 282

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 111/232 (47%), Gaps = 34/232 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQS--------LNTLRAEVDAMKLLRGNK 82
            G F  +Y    ++      ++  +K+V VP+  S        +  L++EV  +K L  + 
Sbjct: 1047 GSFGAVYLALNVT----TGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NHV 1101

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+          NG Y   L +EY + G + S +  R+  R  +  +  +  QV++
Sbjct: 1102 NIVQYLGFEE-----KNGIYS--LFLEYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVLE 1152

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+  +G CK+ DF    G+ R   N Y  S    D+  
Sbjct: 1153 GLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNNIYSNS----DMTM 1202

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
              T  + APEM+D   G+S   K DIW+LG  + ++     P+     VA +
Sbjct: 1203 RGTVFWMAPEMVDTAHGYSA--KVDIWSLGCVVLEMFAGKRPWSNFEVVAAM 1252

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 100/203 (49%), Gaps = 23/203 (11%)

Query: 104 VVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIEN 163
           V LLMEY   G L   +  R      +    R + Q+   +  +H  Q  +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLL--RSHGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 164 VLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVD 223
           +LI  N   K+ DFG    +I P         V+   L  T   Y +PEMI   R    D
Sbjct: 220 ILIGFNNVIKLTDFG--WSIINPRG-------VKRKTLCGTI-DYLSPEMI---RSREYD 266

Query: 224 EKSDIWALGVFLYKLCYYTTPFEK-TGEVA---ILKANFQFPSYPQYSNRLKNLITVMLA 279
           +K D+WALGV  Y+L   + PFE+ T E+    ILK + +FP     S+ +K+LI+ +L 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPE--TVSHDVKDLISKLLK 324

Query: 280 ENPIHRPNSCQVLEEVCRIQGQP 302
            NP  R +   V++    I+ +P
Sbjct: 325 YNPSERISMRDVMKHPWIIRNKP 347

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 99/195 (50%), Gaps = 23/195 (11%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           +V + +EYC   G   + +  +  R+   E  ++  Q+V  +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCP--GRELYEHLLMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLE 157

Query: 163 NVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGF 220
           N+L+ +NG+ K+ DFG     +   K++ E        +  TT  Y APE+I    Y GF
Sbjct: 158 NILLDKNGNAKLTDFGFTRECV--SKSSLE-------TICGTTV-YMAPELIQRQAYDGF 207

Query: 221 SVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAI-LKANFQFPSYPQ--YSNRLKNLITVM 277
            +    DIW+LGV LY +   T PF++  E     K    FP++     S+  K+LI  +
Sbjct: 208 KI----DIWSLGVILYTMINGTMPFDEDDETKTKWKIVNDFPNFNDNFVSHEAKDLIKRL 263

Query: 278 LAENPIHRPNSCQVL 292
           LA+ P  RP   Q+L
Sbjct: 264 LAKCPSERPTMEQIL 278

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 120/282 (42%), Gaps = 43/282 (15%)

Query: 24   VVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRV---------HVPDKQSLNTLRAEVDA 74
            V++ L  G +  ++ C     + K K +  +K +          V D++   T+ +E+  
Sbjct: 797  VLQKLGDGAYGHVHLC----MNKKTKHLVIIKAIIKERILIDTWVRDRE-FGTIPSEIYI 851

Query: 75   MKLLRGNKH--IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFE 132
            M     + H  I   +D         +  Y  + L  +   G +  F    L+  + EFE
Sbjct: 852  MSKFNAHPHDNITQIMD------FFEDDDYYYIELESHGETGSIDLFDLIELKTNMTEFE 905

Query: 133  VLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYE 192
               I  Q+V GI  +H     ++HRDIK ENV++  NG  K+ DFGS       P   + 
Sbjct: 906  AKLIFKQIVSGIKYLH--DQGIVHRDIKDENVIVDSNGFVKLIDFGSAAYTKTGPFEVFV 963

Query: 193  LSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGE 250
                        T  Y APE++  + Y+G    +  DIWALGV LY L Y   PF    E
Sbjct: 964  -----------GTIDYAAPEILGGNPYKG----KPQDIWALGVLLYTLIYKENPFYNVDE 1008

Query: 251  VAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
              IL+   +F      +    +LI  +L ++   RP+  +++
Sbjct: 1009 --ILEGQLRFDGTCNVTQDCIDLIRWILTKSVNDRPSIDEIV 1048

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 132/282 (46%), Gaps = 44/282 (15%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQS-LNTLRAEVDAMKLLRGN 81
           K  + +  G F  +Y        +K K V  +K +++      +  ++ E+  +  L+  
Sbjct: 20  KRTEVIGRGKFGVVYKGYY----TKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQV 75

Query: 82  KHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVV 141
            +I  Y  S+     LN+    V+  MEYC+ G L + +      ++ E  +  IM +++
Sbjct: 76  PNITHYYGSY-----LNDTKLWVI--MEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL 125

Query: 142 QGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDIL 201
             ++ +H  +  +IHRDIK  NVLI  +G  K+CDFG             +LS  Q  I 
Sbjct: 126 TALMHIH--KDGVIHRDIKAANVLITNDGHIKLCDFGVAA----------QLS--QTKIR 171

Query: 202 KNTTAQ---YRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA-N 257
           + T A    + APE+I    G   D K DIW+LG+  Y++     P+    EV  L+A  
Sbjct: 172 RQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPY---CEVEALRAMQ 226

Query: 258 FQFPSYP------QYSNRLKNLITVMLAENPIHRPNSCQVLE 293
               S P      Q+S+ LK +I + L E+P  RP++  +L+
Sbjct: 227 LITKSKPPRLEGRQHSSALKEIIALCLDEDPKERPSAEDLLK 268

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 135/284 (47%), Gaps = 39/284 (13%)

Query: 19  SHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPD-KQSLNTLRAEVDAMKL 77
           +H   V + +  G F  +Y     + D     V  +K V + +  + L  L  E+  +  
Sbjct: 19  AHNYIVKECVGRGNFGDVYR----AIDRTTNKVVAIKVVDLENTNERLEVLAQEIFFLAE 74

Query: 78  LRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIM 137
           L+ + +I++YI      ++L + S  +V  MEYC  G     +     + L E +V  I 
Sbjct: 75  LK-SPYIINYI-----TTLLEDASMWIV--MEYCGGGSCSDLLKYYFNNGLPEKKVAYIT 126

Query: 138 NQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQ 197
            ++++G+  +H  +   IHRDIK  N+L+ E G  K+ DFG V G ++        S ++
Sbjct: 127 REILKGLQYLHEQKK--IHRDIKAANILLTEEGHVKLGDFG-VSGQLK--------STLR 175

Query: 198 HDILKNTTAQYRAPEM----IDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAI 253
              +   T  + APE+    I+ Y     DEK DIW+LG+ +++L     P  K   + +
Sbjct: 176 RGTIVG-TPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLKGVPPLVKLDPIRV 229

Query: 254 LKANFQFPSYPQ----YSNRLKNLITVMLAENPIHRPNSCQVLE 293
           L AN    S P+    YS+  K+ + + L +NP  RP +  +L+
Sbjct: 230 L-ANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 128/284 (45%), Gaps = 52/284 (18%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQS-----LNTLRAEVDAMKLLRGNKH-- 83
            G F  ++    I+      ++  +K++ VP   S     LNT+ A    +  L+   H  
Sbjct: 1144 GSFGAVFLSLNIT----TGEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDLDHLN 1199

Query: 84   IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQG 143
            IV Y+      ++ +       L +EY + G + S +  R+  R  +  +  + NQV++G
Sbjct: 1200 IVQYLGFEMKHNIYS-------LFLEYVAGGSVGSLI--RMYGRFDDKLIRHLTNQVLEG 1250

Query: 144  ILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKN 203
            +  +H+    ++HRD+K +N+L+ ++G CK+ DFG              +S    DI  N
Sbjct: 1251 LSYLHSQG--ILHRDMKADNLLLDQDGICKISDFG--------------ISKKSEDIYSN 1294

Query: 204  T------TAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTP---FEKTGEVAIL 254
            +      T  + APEM+D  +G++   K DIW+LG  + ++     P   FE    +  +
Sbjct: 1295 SEMTMRGTVFWMAPEMVDTKQGYNA--KVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKI 1352

Query: 255  KANFQFPSYPQYSNRL-----KNLITVMLAENPIHRPNSCQVLE 293
              +   P  P+ +  L     KN +      +P  RP + Q+LE
Sbjct: 1353 GQSKSAPPIPEDTKDLISPTAKNFLNQCFHIDPKERPTAGQLLE 1396

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 99/195 (50%), Gaps = 23/195 (11%)

Query: 104 VVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIEN 163
           V + +EYC    L  ++   L+ R+   E  R+  Q+V  +   H+LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 164 VLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGFS 221
           +L+ +NG   + DF    G  R      +L  V        T  Y APE+I  + Y G+ 
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETV------CGTTVYMAPELIKREAYDGYK 208

Query: 222 VDEKSDIWALGVFLYKLCYYTTPFEKTGEVAI-LKANFQFPS-YPQYSN-RLKNLITVML 278
           V    D W+LG+ LY + +   PF++   V   LK   + P+   +Y++ + K+LI  +L
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLL 264

Query: 279 AENPIHRPNSCQVLE 293
            +N   RPN  +VL+
Sbjct: 265 DKNAAQRPNLNEVLQ 279

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 127/275 (46%), Gaps = 32/275 (11%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K ++ + +IV 
Sbjct: 82  FLGEGGFAR--CFQMKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMK-HPNIVQ 138

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID     +        V +L+E C  G L+  +  R    L E EV     Q+V  I  
Sbjct: 139 FIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIKY 189

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH  +  +IHRD+K+ N+    N + K+ DFG    +    +  Y +           T 
Sbjct: 190 MHNRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVC---------GTP 238

Query: 207 QYRAPEMI-DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL-----KANFQF 260
            Y APE++   + G S +   DIW++GV +Y L     PF+   EV I+       ++ F
Sbjct: 239 NYIAPEVLAGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGDYIF 295

Query: 261 PSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
           P     S  +  LI  +L+ +PI RP+  ++++ V
Sbjct: 296 PREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 99/228 (43%), Gaps = 29/228 (12%)

Query: 63   QSLNTLRAEVDAMKLLRGNKH--IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM 120
            + L T+ +E+  M  L    H  I+  +D         +  Y  +    +   G +  F 
Sbjct: 1225 RKLGTIPSEIQIMATLNKQPHENILRLLD------FFEDDDYYYIETPIHGETGCIDLFD 1278

Query: 121  NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV 180
               L++ + E EV  I  Q+V GI  +H     +IHRDIK ENV++   G  K+ DFGS 
Sbjct: 1279 LIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVKLIDFGSA 1336

Query: 181  CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLYKL 238
              V   P + +             T  Y APE++  D Y G    +  DIWA+G+ LY +
Sbjct: 1337 AHVKSGPFDVFV-----------GTIDYAAPEVLSGDPYEG----KPQDIWAIGILLYTI 1381

Query: 239  CYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRP 286
             +   PF    E  IL+    F      S   K LI+++L  N   RP
Sbjct: 1382 VFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRP 1427

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 125/275 (45%), Gaps = 30/275 (10%)

Query: 26  KYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIV 85
           ++L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K ++ +++IV
Sbjct: 146 QFLGEGGFAR--CFQIKDESGKIFAAKTVAKISIKTEKTRRKLLSEIQIHKSMK-HQNIV 202

Query: 86  SYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGIL 145
            ++D              V +L+  C  G L+  +  R    L E EV     Q+   I 
Sbjct: 203 QFVDCFEDH-------INVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAIK 253

Query: 146 AMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTT 205
            MH+ +  +IHRD+K+ N+   EN + K+ DFG    +    +  Y +           T
Sbjct: 254 YMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYTVC---------GT 302

Query: 206 AQYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFE----KTGEVAILKANFQF 260
             Y APE ++  + G S +   DIW++GV ++ L     PF+     T    I  + + F
Sbjct: 303 PNYIAPEVLLGKHSGHSYE--VDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTF 360

Query: 261 PSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
           P     S   K LI  +L  +PI RP+  +++E V
Sbjct: 361 PINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 125/274 (45%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K ++ + +IV 
Sbjct: 100 FLGEGGFAR--CFQIRDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMK-HVNIVQ 156

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID     +        V +L+E C  G L+  +  R    L E EV     Q+   I  
Sbjct: 157 FIDCFEDDT-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKY 207

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+      + K+ DFG    +    +  Y +           T 
Sbjct: 208 MHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVC---------GTP 256

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE ++  + G S +   DIW++GV +Y L     PF+      I +     +F FP
Sbjct: 257 NYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFSFP 314

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                S+  K LI  +L+ +P+ RP+  ++++ +
Sbjct: 315 KDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 98/200 (49%), Gaps = 33/200 (16%)

Query: 104 VVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIEN 163
           V + +EYC    L  ++  +    L+E   L   +Q+V  +   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSEL--FSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 164 VLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNT--TAQYRAPEMIDL--YRG 219
           +L+ + G  K+ DFG            +        IL+    T  Y APE+I+   Y G
Sbjct: 159 ILLDKKGHAKLTDFG------------FTRECATKGILETICGTTVYMAPELIERKPYEG 206

Query: 220 FSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSY-PQYSNRL-----KNL 273
           + +    D W+LG+ LY + + T PF++  EV   K  ++   Y P Y N       K L
Sbjct: 207 YKI----DTWSLGIILYTMIHGTMPFDEVDEV---KTKYKIVHYNPTYDNDYIDSNGKEL 259

Query: 274 ITVMLAENPIHRPNSCQVLE 293
           I+ +L ++P  RP+  QVL+
Sbjct: 260 ISQLLEKDPNQRPSLTQVLQ 279

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 128/277 (46%), Gaps = 40/277 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVP-----DKQSLNTLRAEVDAMKLLRGNKH-- 83
            G F  +Y    ++      ++  +K+V VP     D+ +L+ L A    +  L+   H  
Sbjct: 1155 GSFGSVYLGLNVT----TGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDLDHVN 1210

Query: 84   IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQG 143
            IV Y+          N ++   L +EY + G + S +  RL  R  E  +  +  QV++G
Sbjct: 1211 IVQYLG-------FENKNHVYSLFLEYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVLRG 1261

Query: 144  ILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKN 203
            +  +H+    ++HRD+K +N+L+  +G CK+ DF    G+ +   N Y  S    D+   
Sbjct: 1262 LAYLHSKG--ILHRDMKADNLLLDVDGICKISDF----GISKKSNNIYSNS----DMTMR 1311

Query: 204  TTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQF--- 260
             T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +    +F   
Sbjct: 1312 GTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSA 1369

Query: 261  PSYPQYSNRL-----KNLITVMLAENPIHRPNSCQVL 292
            P  P+ + +L     K+ +      +P  RP +  +L
Sbjct: 1370 PPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTADDLL 1406

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 107/239 (44%), Gaps = 33/239 (13%)

Query: 63   QSLNTLRAEVDAMKLLRGNKH----IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLIS 118
            + L T+ +E+  M +L  NKH    I+  +D         +  Y  +    +   G +  
Sbjct: 1022 RKLGTIPSEIQIMAVL--NKHPDENILRLLD------FFEDDDYYYIETPVHGETGSIDL 1073

Query: 119  FMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFG 178
            F    L+  + EFE   I  QV+ GI  +H  +  ++HRDIK ENV++   G  K+ DFG
Sbjct: 1074 FDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVKLIDFG 1131

Query: 179  SVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLY 236
            S   V   P + +             T  Y APE++  + Y G    +  DIWA+G+ LY
Sbjct: 1132 SAAYVKSGPFDVFV-----------GTIDYAAPEVLGGEPYEG----KPQDIWAVGILLY 1176

Query: 237  KLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
             + +   PF    E  I++   +F    + S    NLI  +L +N   RP    + ++V
Sbjct: 1177 TIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDIYDDV 1233

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 83/293 (28%), Positives = 131/293 (44%), Gaps = 40/293 (13%)

Query: 11  PGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLR- 69
           P +V+   S K    + L  GGFA+   C  I  D  +   AC     +  K+S+ T R 
Sbjct: 82  PPSVIKDNSKKYFRRECLGEGGFAR---CFHIKDDVGI-SFAC----KIVSKKSIKTERT 133

Query: 70  -----AEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRL 124
                +E+   + LR + HIV ++D    +  LN     V +L+E C  G L+  +  R 
Sbjct: 134 KFKLLSEIQIHQNLRYS-HIVKFMDCFEDE--LN-----VYILLELCPNGSLMDLLKKR- 184

Query: 125 QDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVI 184
              L E EV  +  QV   I  MH+    +IHRD+K+ NV   +N + K+ DFG    + 
Sbjct: 185 -KILTEAEVKFMTTQVCGAINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLS 241

Query: 185 RPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTP 244
              +  Y +           T  Y APE+I L +      ++DIW+LG+ +Y +     P
Sbjct: 242 NVSEKKYTMC---------GTPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPP 291

Query: 245 FEKTGEVAILK----ANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLE 293
           F+      I +      ++FP     +N +K LI  +L  +P  RP    +L+
Sbjct: 292 FQAKDVTTIYEKIKLCQYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 124/274 (45%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K ++ + +IV 
Sbjct: 100 FLGEGGFAR--CFQIKDESGKIFAAKTVAKISIKSEKTKRKLLSEIQIHKSMK-HSNIVQ 156

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID     +        V +L+E C  G L+  +  R    L E EV     Q+   I  
Sbjct: 157 FIDCFEDDA-------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKY 207

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           +H+ +  +IHRD+K+ N+   ++ + KV DFG    +    +  Y +           T 
Sbjct: 208 LHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVC---------GTP 256

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----ANFQFP 261
            Y APE ++  + G S +   DIW++GV +Y L     PF+      I +      + +P
Sbjct: 257 NYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLCKYGYP 314

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                S   + LI  +L+ NP+ RP    ++++V
Sbjct: 315 KDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 99/196 (50%), Gaps = 23/196 (11%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           +V + +EYC    L  +       R+   E +++  Q+V G+   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKEL--YDRVLSMHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 163 NVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDL--YRGF 220
           N+L+ ++GD K+ DFG     +   K T E        +  TT  Y APE+I+   Y GF
Sbjct: 159 NILLDKSGDAKLTDFGFTRECM--TKTTLE-------TICGTTV-YMAPELIERKSYDGF 208

Query: 221 SVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAI-LKANFQFPSYPQ--YSNRLKNLITVM 277
            +    DIW+LGV LY +   + PF++  E     K   Q P   +   +   K+LI  +
Sbjct: 209 KI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRL 264

Query: 278 LAENPIHRPNSCQVLE 293
           LA+NP  RP   Q+L+
Sbjct: 265 LAKNPNDRPTVEQILK 280

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 129/274 (47%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K ++ + +IV 
Sbjct: 97  FLGEGGFAR--CFQIKDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMK-HPNIVH 153

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           ++D     +        V +L+E CS G L+  M  R    L E EV     Q+   +  
Sbjct: 154 FVDCFEDDT-------NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVKY 204

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   ++ + KV DFG    +    +  Y +           T 
Sbjct: 205 MHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVC---------GTP 253

Query: 207 QYRAPE-MIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAI---LKA-NFQFP 261
            Y APE ++  + G S +   DIW++GV +Y L     PF+      I   +KA  + +P
Sbjct: 254 NYIAPEVLMGKHAGHSFE--VDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYP 311

Query: 262 SYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                S+  K LI  +L  +P+ RP+  +++++V
Sbjct: 312 KDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 133/292 (45%), Gaps = 38/292 (13%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVP-DKQSLNTLRAEVDAMKLLRGN 81
           K  K +  G F  +Y    I    K K V  +K +++  D   +  ++ E+  + LLR  
Sbjct: 7   KRTKVIGKGKFGTVYKGHSI----KSKKVFAIKVLNLDCDINEIQDIQNEIKFLSLLRYA 62

Query: 82  KHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVV 141
            +I  Y  S+    ++N    ++ ++MEYC+ G + + +      R  E  +  I+ +++
Sbjct: 63  PNITYYYHSY----LINR---KIWIIMEYCNGGSVRNLIKI---GRFNEIYISVILRELL 112

Query: 142 QGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDIL 201
             +  +H     +IHRDIK  N+LI +NG  K+CDFG    +        E S  +   +
Sbjct: 113 YALEYIH--HDNIIHRDIKAANILINQNGGIKLCDFGIAAKL--------EFSKPKRQTM 162

Query: 202 KNTTAQYRAPEMI---DLYRGFSVDEKSDIWALGVFLYKLCYYTTPF-EKTGEVAI-LKA 256
              T  + APE+I    LY     D K+DIW++G+  Y++     P+ E     A+ L  
Sbjct: 163 AG-TPYWMAPEVIIESSLY-----DTKADIWSVGITAYEITTGNPPYCEYDATKAMQLIT 216

Query: 257 NFQFPSYP--QYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVK 306
             + P      YS  LK  I + L E+P  R  S ++LE     + Q  P K
Sbjct: 217 KLKPPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKLLETEFIKEYQETPTK 268

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 92/209 (44%), Gaps = 51/209 (24%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           +V + +EYC    L   + ++   RL   E   +  Q+   +   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 163 NVLIAENGDCKVCDFG------------SVCGVIRPPKNTYELSYVQHDILKNTTAQYRA 210
           NVL+ +NG+ K+ DFG            +VCG                      T  Y A
Sbjct: 163 NVLLDKNGNAKLTDFGFTRESMTKAVLETVCG----------------------TTVYMA 200

Query: 211 PEMIDL--YRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSN 268
           PEMI    Y GF V    DIW+LGV LY L     PF++  +  +L         P    
Sbjct: 201 PEMIQHKPYDGFKV----DIWSLGVILYTLLCGCLPFDEDDD--LLTKQKIINDTPVIDE 254

Query: 269 RL-----KNLITVMLAENPIHRPNSCQVL 292
           R+     +NLI  +L+++P  RPN+  +L
Sbjct: 255 RITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 122/284 (42%), Gaps = 43/284 (15%)

Query: 24   VVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVH---------VPDKQSLNTLRAEVDA 74
            +++ +  G + ++  C       K K + C+K +          V D++ L T+ +E+  
Sbjct: 1153 ILQKMGEGAYGKVNLC----IHKKEKYIVCIKMIFKERILVDTWVRDRK-LGTIPSEIQI 1207

Query: 75   MKLLRGNKH--IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFE 132
            M  L    H  I+  +D         + +Y  +    +   G +  F     +  + EFE
Sbjct: 1208 MATLNKKPHENILRLLD------FFEDDNYYYIETPIHGETGCIDLFDLIEFKTNMTEFE 1261

Query: 133  VLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYE 192
               I  QVV GI  +H     ++HRDIK ENV++   G  K+ DFGS   V   P + + 
Sbjct: 1262 AKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVKIIDFGSAAYVKSGPFDVFV 1319

Query: 193  LSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGE 250
                        T  Y APE++  + Y G    +  DIWALG+ LY + +   PF    E
Sbjct: 1320 -----------GTIDYAAPEVLSGEPYEG----KPQDIWALGILLYTIVFKENPFYNIDE 1364

Query: 251  VAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEE 294
              IL+ + +F S  + +     LI  +L     +RP   ++ ++
Sbjct: 1365 --ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIFDD 1406

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score = 83.2 bits (204), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 85/313 (27%), Positives = 142/313 (45%), Gaps = 48/313 (15%)

Query: 15  LTVGSH--KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEV 72
           L+ GSH    ++VK L  G F ++     ++   KV      K+V +        +  E+
Sbjct: 37  LSDGSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKV-LAKSDMQGRIEREI 95

Query: 73  DAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFE 132
             ++LLR + HI+   D   SK        E++++MEY     L  ++  R  D++ E E
Sbjct: 96  SYLRLLR-HPHIIKLYDVIKSKD-------EIIMVMEYAG-NELFDYIVQR--DKMSEDE 144

Query: 133 VLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYE 192
             R   Q++  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              
Sbjct: 145 ARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG-------------- 188

Query: 193 LSYVQHD--ILKNTTA--QYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFE 246
           LS +  D   LK +     Y APE+I   LY G  V    D+W+ GV LY +     PF+
Sbjct: 189 LSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCRRLPFD 244

Query: 247 KTGEVAILKANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPC 303
               + +L  N     Y  P++ S     LI  ML  NP++R +  +++++     G P 
Sbjct: 245 DES-IPVLFKNINNGVYTIPKFLSQGASTLIKKMLIVNPLNRISIQEIMQDEWFKAGLP- 302

Query: 304 PVKNFYLERSLKQ 316
               + + + LKQ
Sbjct: 303 ---EYLIPQDLKQ 312

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 84/186 (45%), Gaps = 25/186 (13%)

Query: 114  GGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCK 173
            G +  F     +  + EFE   I  Q+V GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1038 GSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1095

Query: 174  VCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWAL 231
            + DFGS   V   P + +             T  Y APE++  + Y G S     DIWA+
Sbjct: 1096 LIDFGSAAYVKSGPFDVFV-----------GTIDYAAPEVLGGNPYEGKS----QDIWAI 1140

Query: 232  GVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQV 291
            G+ LY L Y   PF    E  IL+   +F      S   K LIT +L      RP     
Sbjct: 1141 GILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRP----T 1194

Query: 292  LEEVCR 297
            ++E+C+
Sbjct: 1195 IDEICQ 1200

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 83.2 bits (204), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 117/263 (44%), Gaps = 42/263 (15%)

Query: 55  KRVHVPDKQSLNTLRAEVDAMKLL--RGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCS 112
           K+VH P+K++   +  E++  K++    + HIV+  D+             + ++++YCS
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHHNHIVALRDAFQWGK-----ESCIYMILDYCS 124

Query: 113 RGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDC 172
              L S +  R    L E E   +M Q+  GI  +H     +IH D+K+ N+L  E    
Sbjct: 125 NNSLQSILQYR--GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQL 180

Query: 173 KVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYR-----GFSVDEKS- 226
           K+CDFGS       P+   E+           T  Y APE +  ++     G ++   S 
Sbjct: 181 KICDFGSSFIATSSPRGPGEIM---------GTPYYLAPETVYTHKNINKSGMAILLISF 231

Query: 227 --DIWALGVFLYKLCYYTTPFEKTGEVA-----------ILKANFQFPSYPQYSNRLKNL 273
             DIW++G+ LY L Y   PF K+ +             I     +FP+        + L
Sbjct: 232 PIDIWSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQL 291

Query: 274 ITVMLAENPIHRPNSCQVLEEVC 296
           I  ML++NP+ R     ++E VC
Sbjct: 292 ILKMLSQNPLER---ITLVEIVC 311

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 128/281 (45%), Gaps = 42/281 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLN--------TLRAEVDAMKLLRGNK 82
            G F  +Y    +S +    ++  +K+V VP+  S N         LR+EV  +K L  + 
Sbjct: 1347 GSFGSVY----LSLNVTTGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEVTLLKDL-DHI 1401

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+      ++ +       L +EY + G + S +  R+  R  E  +     Q++ 
Sbjct: 1402 NIVQYLGFEKKNNIYS-------LFLEYVAGGSIGSLI--RMYGRFDESLIRHSTTQILA 1452

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+   G CK+ DF    G+ R  K+ Y  S    ++  
Sbjct: 1453 GLSYLHS--KGILHRDMKADNILLDGEGICKISDF----GISRKSKDIYSNS----EMTM 1502

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPS 262
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA +    Q  S
Sbjct: 1503 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIILEMFAGKRPWSNLEVVAAMFKIGQSKS 1560

Query: 263  --------YPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
                     P  S   ++ +      +P  RP + Q+L+ +
Sbjct: 1561 APPIPEDTLPLISQDGRDFLDDCFKIDPEKRPTAEQMLDHL 1601

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 124/268 (46%), Gaps = 41/268 (15%)

Query: 36  IYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKS 95
           +Y  +V+S +S + +VA ++R              E+  +  L+   +I  Y  S+   +
Sbjct: 67  VYAIKVLSLESDLDEVADIQR--------------EIQFLVSLKQVPNITRYYASYLKDT 112

Query: 96  VLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLI 155
            L        ++MEYC+ G + + +      ++ E  +  IM +++  +  +H  +  +I
Sbjct: 113 SL-------WIIMEYCAGGSVRTLLR---PGKIDEKYIAVIMRELLVALHYIH--KDNVI 160

Query: 156 HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMID 215
           HRDIK  N+LI   G+ K+CDFG    +    +NT     +        T  + APE+I 
Sbjct: 161 HRDIKAANLLITNEGNVKLCDFGVAAQL---NQNTMRRQTMAG------TPYWMAPEVI- 210

Query: 216 LYRGFSVDEKSDIWALGVFLYKLCYYTTPF-EKTGEVAILKANFQFPSYPQYSNR---LK 271
              G S D K+DIW++G+  Y++     PF E     A+   +   P+  +  N    LK
Sbjct: 211 -MEGISYDTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLK 269

Query: 272 NLITVMLAENPIHRPNSCQVLEEVCRIQ 299
             I + L E+P  RP + ++L E   I+
Sbjct: 270 EFIAMCLDEDPQERPTADKLLHESAFIK 297

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 127/272 (46%), Gaps = 39/272 (14%)

Query: 31  GGFAQIY-CCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYID 89
           G F  +Y  C+ +  + KV  V  +   H   ++ ++ L  E+  +  LR +  I +YI 
Sbjct: 24  GNFGDVYKACDKV--EGKVVAVKVVNLEH--SEEDIDLLAQEIFFLAELR-SPFITNYIT 78

Query: 90  SHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHA 149
           +             + ++MEYC  G     +     + + E +V  I +QV++G++ +H 
Sbjct: 79  TLTE-------DVSMWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHE 131

Query: 150 LQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPP--KNTYELSYVQHDILKNTTAQ 207
            +   IHRDIK  N+L+ + G  K+ DFG V G IR    + T+             T  
Sbjct: 132 QKK--IHRDIKAANILLTDEGTVKLGDFG-VSGQIRATLKRGTFV-----------GTPY 177

Query: 208 YRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPS----- 262
           + APE++        DEK+DIW+LG+ +Y+L     P  K   + ++      P      
Sbjct: 178 WMAPEVVS-KENDGYDEKADIWSLGITVYELLKGAPPLSKCDPMKVM---INLPKRKPPA 233

Query: 263 -YPQYSNRLKNLITVMLAENPIHRPNSCQVLE 293
            +  YS+  KN ++  L +NP+ R ++ +++E
Sbjct: 234 LHGHYSHSAKNFVSSCLVKNPVGRASAYEMVE 265

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 125/284 (44%), Gaps = 47/284 (16%)

Query: 17  VGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMK 76
           +G+ K  VV         Q+Y  +V++ DS   +V  ++R              EV  + 
Sbjct: 35  IGTGKFGVVYKGHHARTKQVYAIKVLNLDSDEDEVEDVQR--------------EVQFLA 80

Query: 77  LLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRI 136
            ++   +I  Y  S+   + L        +++EYC+ G L + +      ++ E  +  I
Sbjct: 81  SMKQTPNITHYYGSYLKDTTL-------WIIIEYCAGGSLRTLLR---PGKIDEKYIGII 130

Query: 137 MNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYV 196
           M +V+  +  +H     +IHRDIK  NVLI   G  K+CDFG    + +        S +
Sbjct: 131 MREVLIALKYIHKDN--VIHRDIKAANVLITNEGHVKLCDFGVAAQLNQ--------SSL 180

Query: 197 QHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA 256
           +   +   T  + APE+I    G S D K DIW+LG+  Y++     P+    +V  L+A
Sbjct: 181 KRQTMAG-TPYWMAPEVI--MEGVSYDTKVDIWSLGITTYEIATGNPPY---CDVEALRA 234

Query: 257 -NFQFPSYP------QYSNRLKNLITVMLAENPIHRPNSCQVLE 293
                 S P       YS  LK  I + L E+P  R ++  +L+
Sbjct: 235 MQLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKERLSADDLLK 278

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 126/270 (46%), Gaps = 27/270 (10%)

Query: 28  LTSGGFAQIYCCEVISPDSKVK-DVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           L  G ++ +     I  DSK +  V  L + ++  ++ +  +  E +A++ +  +K IV 
Sbjct: 185 LGDGAYSTVMLATSI--DSKKQYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVK 242

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
              +   +S L         L+EYC  G  +S M  +    L E        QV+  I  
Sbjct: 243 LFFTFQDESSL-------YFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDY 293

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           +H     +IHRDIK EN+L+ +    K+ DFG+   +     N ++L       +   TA
Sbjct: 294 LHT--NGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKSFV--GTA 349

Query: 207 QYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV----AILKANFQFPS 262
           +Y APE+++    F VD + D+WA G  LY++     PF+ T E      ++K  + F +
Sbjct: 350 EYVAPELLN--DSF-VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTA 406

Query: 263 -YPQYSNRLKNLITVMLAENPIHRPNSCQV 291
            +P     +++L+  +L ++   RP+  Q+
Sbjct: 407 GFPLI---IRDLVKKILVKDLNQRPSISQI 433

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/342 (23%), Positives = 138/342 (40%), Gaps = 66/342 (19%)

Query: 12  GTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPD-SKVKDVACLKRVHVPDKQSLNTLRA 70
           G  +++      V   L  G    +Y  +V  P  S    V  LK+V  P  ++    RA
Sbjct: 21  GVRISINGKSYLVTTLLREGELTALY--QVKCPKRSHSGGVYALKKVTCPIGRADFVTRA 78

Query: 71  EVDAMKLLRGNK-HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRL--QDR 127
             +     R N  +I + +D   ++   +NG+  + +L+ Y   G L   +N  +   D 
Sbjct: 79  MTEISNYQRFNSPYITNILDFQVAQH--DNGTKIIYMLLPYFPAGSLQDLINNMIIRGDS 136

Query: 128 LKEFEVLRIMNQVVQGILAMHA-------------------------------------L 150
           L E  V+R+M  + +G+  MH                                      L
Sbjct: 137 LSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMELDLL 196

Query: 151 QPPL--------IHRDIKIENVLIAENGDCKVCDFGSVCGVIRPP---KNTYELSYVQHD 199
            PPL        +H  +  EN++++  G   + +  S    +R P    +  +L  +Q  
Sbjct: 197 SPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLGLQEW 253

Query: 200 ILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV-------A 252
           + +N+   Y  PE++DL+   S+  + DIW+LG   Y L Y  + F +  ++       +
Sbjct: 254 LNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPIKHS 313

Query: 253 ILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEE 294
           I   NF FP  P+YS  LK ++   L  +P  RP+  + L +
Sbjct: 314 ISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQ 355

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 132/289 (45%), Gaps = 36/289 (12%)

Query: 11  PGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQS-LNTLR 69
           P T +   S    + + +  G F  +Y     + D +  ++  +K +++ + Q  ++ L 
Sbjct: 25  PDTAVEKPSQLYDIKECVGKGSFGDVYR----AIDKETGEMVAVKIINLEETQDDIDVLA 80

Query: 70  AEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLK 129
            E+  +  LR    + +Y  ++            + ++ME+C  G     +    + RL 
Sbjct: 81  QEIYFLSELRA-PFVTTYYKTYVE-------DVSMWIVMEFCGGGSCADLLKHLPEHRLP 132

Query: 130 EFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPP-- 187
           E +V  I+ +V+ G+  +H+ +   IHRD+K  N+L+ + G+ K+ DFG V G I     
Sbjct: 133 ENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFG-VSGQIMATLK 189

Query: 188 KNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEK 247
           +NT+             T  + APE+I    G+  DEK+DIW+LG+   +L     P+ K
Sbjct: 190 RNTF-----------VGTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPPYAK 236

Query: 248 TGEVAILKANFQFPSYPQYSNRL----KNLITVMLAENPIHRPNSCQVL 292
              + +L  N      P+   R     ++ I + L ++P  RP +  +L
Sbjct: 237 YDPMKVL-MNIPLRKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 92/350 (26%), Positives = 156/350 (44%), Gaps = 62/350 (17%)

Query: 21  KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRG 80
           K +++K L  G F ++     I+   KV      K+V +        +  E+  ++LLR 
Sbjct: 31  KYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKV-LAKSDMQGRIEREISYLRLLR- 88

Query: 81  NKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQV 140
           + HI+   D   SK        E+V+++EY     L  ++  R  D++ E E  R   Q+
Sbjct: 89  HPHIIKLYDVIKSKD-------EIVMVIEYAG-NELFDYIVQR--DKMNEDEARRFFQQI 138

Query: 141 VQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD- 199
           +  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              LS +  D 
Sbjct: 139 ISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG--------------LSNIMTDG 182

Query: 200 -ILKNT--TAQYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
             LK +  +  Y APE+I   LY G  V    D+W+ GV LY +     PF+    + +L
Sbjct: 183 NFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVILYVMLCRRLPFDDES-IPVL 237

Query: 255 KANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVKNFYLE 311
             N     Y  P++ S    NLI  ML  NP++R    +++++     G P      YL 
Sbjct: 238 FKNISNGVYTLPKFLSPGASNLIKRMLIVNPLNRITIHEIMQDEWFKVGMPE-----YL- 291

Query: 312 RSLKQQIPSQLRHSVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNTMNMGY 361
                 IP +L++  S    + +         I +V +S++ + +  MGY
Sbjct: 292 ------IPPELKNESSNAQASNDN--------IEEVDDSLVSTLSKTMGY 327

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/292 (28%), Positives = 135/292 (46%), Gaps = 43/292 (14%)

Query: 21  KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRG 80
           K +++K L  G F ++     ++   KV      K+V +        +  E+  ++LLR 
Sbjct: 29  KYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKV-LAKSDMQGRIEREISYLRLLR- 86

Query: 81  NKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQV 140
           + HI+   D   SK        E+V+++EY     L  ++  R  D++ E E  R   Q+
Sbjct: 87  HPHIIKLYDVIKSKD-------EIVMVIEYAG-NELFDYIVQR--DKMSEREARRFFQQI 136

Query: 141 VQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD- 199
           +  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              LS +  D 
Sbjct: 137 ISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG--------------LSNIMTDG 180

Query: 200 -ILKNT--TAQYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
             LK +  +  Y APE+I   LY G  V    D+W+ GV LY +     PF+    + IL
Sbjct: 181 NFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVILYVMLCRRLPFDDES-IPIL 235

Query: 255 KANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLE-EVCRIQGQP 302
             N     Y  P++ S    NLI  ML  NP++R    +++E E  ++  QP
Sbjct: 236 FKNISNGIYTLPKFLSPGAANLIKRMLIVNPLNRITIHEIMEDEWFKVDIQP 287

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 97/199 (48%), Gaps = 26/199 (13%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           ++ L++EY  +G L + +  R    L E E +R   Q++ G+   HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPE 160

Query: 163 NVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDL--YRGF 220
           N+L+    + K+ DFG     +       E S          +  Y APE++    Y+GF
Sbjct: 161 NLLLDHKYNIKIADFG--MAALETEGKLLETSC--------GSPHYAAPEIVSGIPYQGF 210

Query: 221 SVDEKSDIWALGVFLYKLCYYTTPF-EKTGEVAIL-----KANFQFPSYPQYSNRLKNLI 274
           +    SD+W+ GV L+ L     PF E+ G +  L     K  F+ PS  + S   ++LI
Sbjct: 211 A----SDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQDLI 266

Query: 275 TVMLAENPIHRPNSCQVLE 293
           + +L  +P  R  +  +L+
Sbjct: 267 SRILTVDPERRIKTRDILK 285

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 125/282 (44%), Gaps = 44/282 (15%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHV-PDKQSLNTLRAEVDAMKLLRGN 81
           K  + +  G F  +Y    +    K + V  +K +++  D   +  ++ E+  +  L+  
Sbjct: 24  KRTEVIGRGKFGVVYKGYNV----KTRRVFAIKVLNLDSDSDEVEDVQREIQFLASLKQI 79

Query: 82  KHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVV 141
            +I  Y  S+   + L        ++MEYC+ G L S +      ++ E  +  IM +V+
Sbjct: 80  HNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVL 129

Query: 142 QGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDIL 201
             +  +H  +  +IHRDIK  NVLI   G+ K+CDFG    V             Q  + 
Sbjct: 130 VALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV------------NQTSLR 175

Query: 202 KNTTAQ---YRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA-N 257
           + T A    + APE+I    G   D K DIW+LG+  Y++     P+    EV  L+A  
Sbjct: 176 RQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPY---CEVEALRAMQ 230

Query: 258 FQFPSYP------QYSNRLKNLITVMLAENPIHRPNSCQVLE 293
               S P       YS  LK  I + L E+P  R ++  +L+
Sbjct: 231 LIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKERLSADDLLK 272

>TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86
           YAL017W
          Length = 959

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 119/272 (43%), Gaps = 34/272 (12%)

Query: 24  VVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRA-----EVDAMKLL 78
           ++K L +G F  +Y C +   +  +  +  + +  + ++  L    A     EV  +  L
Sbjct: 700 ILKELGAGAFGNVYLC-LHRTEKYIITIKVIYKEKIAEEYWLKEDLADGIPLEVKILLDL 758

Query: 79  RGNKH--IVSYIDSHASKSVLNNGSYEV-VLLMEYCSRGGLISFMNTRLQDRLKEFEVLR 135
             NKH  ++  +D    K   +N   E  V  ++ C    L   ++++ +  L E E   
Sbjct: 759 HENKHANVLELLDYFEDK---DNYYLESPVHGIDGCV--DLFDIIDSKQE--LSEIEYKL 811

Query: 136 IMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSY 195
           I  Q+V  +   H L   + HRDIK +NV+I   G CK+ DFGS       P  ++    
Sbjct: 812 IFKQIVSAVKHSHTL--GIAHRDIKEQNVIIDSRGHCKLIDFGSAVYTHMGPFLSF---- 865

Query: 196 VQHDILKNTTAQYRAPEMIDLYRGFSVDEK-SDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
                    T  Y APE I   R  + + K  DIWALGV LY L +   PF+   E+   
Sbjct: 866 -------TGTIDYSAPETI---RAMAYEGKPQDIWALGVLLYTLIFKQLPFKNVEEILEA 915

Query: 255 KANFQFPSYPQYSNRLKNLITVMLAENPIHRP 286
           K NF  PS P  S    NLI  ML     +RP
Sbjct: 916 KLNFSNPSIP-ISKECMNLIERMLELQVRNRP 946

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 106/238 (44%), Gaps = 33/238 (13%)

Query: 63   QSLNTLRAEVDAMKLLRGNKH--IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM 120
            + L T+ +E+  M  L    H  I+  +D         +  Y  +    + + G +  F 
Sbjct: 998  RKLGTIPSEIQIMATLNAKPHENILMLLD------FFEDDDYYYIETAVHGTSGSIDLFD 1051

Query: 121  NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV 180
               ++  + E E + I  Q+  GI  +H     ++HRDIK ENV++  NG  K+ DFGS 
Sbjct: 1052 LIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSA 1109

Query: 181  CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLYKL 238
              V   P + +             T  Y APE++  + Y G    +  DIWA+GV LY +
Sbjct: 1110 AYVKSGPFDVFV-----------GTIDYAAPEVLGGEPYEG----KPQDIWAIGVLLYTI 1154

Query: 239  CYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVC 296
             Y   PF    E  IL A+ +  S  + S+    LI  +L  +   RP+    ++E+C
Sbjct: 1155 IYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPS----IDEIC 1206

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 96/199 (48%), Gaps = 26/199 (13%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           ++ L++EY  +G L + +  R    L E E +R   Q++ G+   HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPEHEAIRFFRQIIIGVSYCHAL--GIVHRDLKPE 160

Query: 163 NVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDL--YRGF 220
           N+L+    + K+ DFG     +       E S          +  Y APE++    Y+GF
Sbjct: 161 NLLLDHKYNIKIADFG--MAALETEGKLLETSC--------GSPHYAAPEIVSGIPYQGF 210

Query: 221 SVDEKSDIWALGVFLYKLCYYTTPF-EKTGEVAIL-----KANFQFPSYPQYSNRLKNLI 274
           +    SD+W+ GV L+ L     PF E+ G +  L     K  F+ PS  + S   ++LI
Sbjct: 211 A----SDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLI 266

Query: 275 TVMLAENPIHRPNSCQVLE 293
             +L  +P  R  +  +L+
Sbjct: 267 RKILTVDPERRIKTRDILK 285

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 127/275 (46%), Gaps = 32/275 (11%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K +R + +IV 
Sbjct: 84  FLGEGGFAR--CFQIKDDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HTNIVQ 140

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           ++D     +        V +L+E C  G L+  +  R    L E EV     Q+V  +  
Sbjct: 141 FVDCFEDDT-------NVYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVKY 191

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   ++ + KV DFG    +    +  Y +           T 
Sbjct: 192 MHSRR--VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVC---------GTP 240

Query: 207 QYRAPEMI-DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK-----ANFQF 260
            Y APE++   + G S +   DIW+ GV +Y L     PF+   EV I+       +F F
Sbjct: 241 NYIAPEVLTGKHTGHSYE--VDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDFVF 297

Query: 261 PSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
           P     S     LI  +L+ +P+ RP+  ++++ V
Sbjct: 298 PKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 97/199 (48%), Gaps = 26/199 (13%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           ++ L++EY  +G L + +  R    L E E +R   Q++ G+   HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHAL--GIVHRDLKPE 160

Query: 163 NVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDL--YRGF 220
           N+L+    + K+ DFG     +       E S          +  Y APE++    Y+GF
Sbjct: 161 NLLLDHKYNIKIADFG--MAALETEGKLLETSC--------GSPHYAAPEIVSGIPYQGF 210

Query: 221 SVDEKSDIWALGVFLYKLCYYTTPF-EKTGEVAIL-----KANFQFPSYPQYSNRLKNLI 274
           +    SD+W+ GV L+ L     PF E+ G +  L     K  F+ PS  + S   ++LI
Sbjct: 211 A----SDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEFELPSDDEISREAQDLI 266

Query: 275 TVMLAENPIHRPNSCQVLE 293
           + +L  +P  R  +  +L+
Sbjct: 267 SKILTVDPERRIKARDILK 285

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 130/283 (45%), Gaps = 42/283 (14%)

Query: 21  KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRG 80
           K +V+K L  G F ++     +S   KV      K+V +        +  E+  ++LLR 
Sbjct: 42  KYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKV-LAKSDMQGRIEREISYLRLLR- 99

Query: 81  NKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQV 140
           + HI+   D   SK        E+++++EY     L  ++  R  D++ E E  R   Q+
Sbjct: 100 HPHIIKLYDVIKSKD-------EIIMVIEYAG-NELFDYIVQR--DKMSENEARRFFQQI 149

Query: 141 VQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD- 199
           +  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              LS +  D 
Sbjct: 150 ISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG--------------LSNIMTDG 193

Query: 200 -ILKNTTAQ--YRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
             LK +     Y APE+I   LY G  V    D+W+ GV LY +     PF+    + +L
Sbjct: 194 NFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVILYVMLCRRLPFDDES-IPVL 248

Query: 255 KANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEE 294
             N     Y  P++ S    NLI  ML  NP++R    +++E+
Sbjct: 249 FKNISNGVYSIPKFLSPGAANLIKKMLIVNPLNRITIHEIMED 291

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 136/301 (45%), Gaps = 44/301 (14%)

Query: 14  VLTVGSH--KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAE 71
           +L  GSH    ++VK L  G F ++     I+   KV      K+V +        +  E
Sbjct: 41  LLADGSHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKV-LAKSDMQGRIERE 99

Query: 72  VDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEF 131
           +  ++LLR + HI+   D   SK        E+++++EY     L  ++  R  D++ E 
Sbjct: 100 ISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAG-NELFDYIVQR--DKMSEE 148

Query: 132 EVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTY 191
           E  R   Q++  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG             
Sbjct: 149 EARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG------------- 193

Query: 192 ELSYVQHD--ILKNTTA--QYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPF 245
            LS +  D   LK +     Y APE+I   LY G  V    D+W+ GV LY +     PF
Sbjct: 194 -LSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVILYVMLCRRLPF 248

Query: 246 EKTGEVAILKANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQP 302
           +    + +L  N     Y  P++ S     LI  ML  NP++R +  +++++     G P
Sbjct: 249 DDES-IPVLFKNISNGVYTLPKFLSEGAAGLIKRMLIVNPLNRISILEIMQDDWFKVGLP 307

Query: 303 C 303
            
Sbjct: 308 T 308

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 116/239 (48%), Gaps = 46/239 (19%)

Query: 68  LRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDR 127
           +  E+  MKLL  + +++S  D   +    NN  Y   L++EY  +G L +     L DR
Sbjct: 66  IEREIVVMKLL-SHPNVLSLYDVWET----NNNLY---LILEYAEKGELFNL----LVDR 113

Query: 128 --LKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIR 185
             L E E ++   Q++  I   HAL   ++HRD+K EN+L+  + + K+ DFG       
Sbjct: 114 GPLPEKEAVKCFRQIIIAISYCHALG--IVHRDLKPENLLLDNDYNIKIADFG------- 164

Query: 186 PPKNTYELSYVQHD--ILKNT--TAQYRAPEMIDL--YRGFSVDEKSDIWALGVFLYKLC 239
                  ++ +Q D  +L+ +  +  Y APE++    YRGF+    SD+W+ GV L+ L 
Sbjct: 165 -------MAALQTDARLLETSCGSPHYAAPEIVSGLPYRGFA----SDVWSCGVILFALL 213

Query: 240 YYTTPF-EKTGEVAIL-----KANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
               PF E  G V  L     +  F+ P   + S   +NLI+ +L  +P  R  +  +L
Sbjct: 214 TGRLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQNLISRILVVDPTQRMKTRDIL 272

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 131/286 (45%), Gaps = 43/286 (15%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVP-----DKQSLN---TLRAEVDAMKLLRGNK 82
            G F  +Y    ++      ++  +K+V VP     D+ +++    LR+EV  +K L  + 
Sbjct: 1183 GSFGAVYLGLNVT----TGEMMAVKQVEVPKFGSQDEATISVVEALRSEVSTLKNL-DHL 1237

Query: 83   HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
            +IV Y+      S+ +       L +EY + G + S +  RL  R  E  +  +  QV++
Sbjct: 1238 NIVQYLGFENKNSIYS-------LFLEYVAGGSVGSLI--RLYGRFDESLIRFLTVQVLR 1288

Query: 143  GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            G+  +H+    ++HRD+K +N+L+  +G CK+ DF    G+ R   +     Y   D+  
Sbjct: 1289 GLSYLHSRG--ILHRDMKADNLLLDLDGVCKISDF----GISRKSNDI----YCNSDMTM 1338

Query: 203  NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVA----ILKANF 258
              T  + APEM+D  +G+S   K DIW+LG  + ++     P+     VA    I K+  
Sbjct: 1339 RGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKT 1396

Query: 259  QFP----SYPQYSNRLKNLITVMLAENPIHRPNSCQVLE-EVCRIQ 299
              P    + P  S   +  +      +P  RP +  +L    C ++
Sbjct: 1397 APPIPEDTLPLISKEGREFLDACFEIDPERRPTADTLLRHRFCEVE 1442

>ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON}
           similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129W PAK1 Upstream kinase for the SNF1 complex
           partially redundant function with Elm1p and Tos3p
           members of this family of kinases have functional
           orthology with LKB1 a mammalian kinase associated with
           Peutz-Jeghers cancer-susceptibility syndrome and some
           similarities with YGL179C uniprot|P43637 Saccharomyces
           cerevisiae YGL179C TOS3 Putative protein kinase, related
           to and redundant with Elm1p and Pak1p in activating the
           SNF1 complex
          Length = 1131

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 93/316 (29%), Positives = 141/316 (44%), Gaps = 63/316 (19%)

Query: 15  LTVGSH-KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNT----LR 69
           L  G H KVK+ + L +G   Q+   +++    K       +R  V DK++  T    +R
Sbjct: 121 LGHGQHGKVKLARELLTG---QLVAIKIVDRHEKKG-----RRFLVLDKKNSLTQNEKIR 172

Query: 70  AEVDAMKLLRGNKHIVSYIDSHASKSVLNN-GSYEVVLLMEYCSRGGLISFMNTRLQDR- 127
            E+  MK     KH+V  ++      VL++  S ++ L++EYCSRG +       L+   
Sbjct: 173 REIAIMKKCH-YKHVVKLVE------VLDDLKSRKIYLVLEYCSRGEVKWCPGDVLETEA 225

Query: 128 ----LKEFEVLR-IMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCG 182
               L  F+  R I+  VV G+  +H     +IHRDIK  N+L+AE+G  K+ DFG V  
Sbjct: 226 RGPPLLNFQRTREIIRGVVLGLEYLH--YQGVIHRDIKPANLLMAEDGTVKISDFG-VSL 282

Query: 183 VIRPPKNTYELSYVQHDILKNT--TAQYRAPEMI--------------DLYRGFSVDEKS 226
             R P     L  +    L  T  T  + APE+               DL++G SV    
Sbjct: 283 AARDPNGDANLESLDELELAKTAGTPAFFAPEICLGEEAFEKFSIDRSDLFKGSSVSFMI 342

Query: 227 DIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFP-SYPQYSNRLKN------------- 272
           DIWALGV LY L +   PF    E+ + +     P + P + N   N             
Sbjct: 343 DIWALGVTLYCLLFGMLPFISDYELELFEKIVNQPLTCPSFQNLNNNGVSHISSKEEYDL 402

Query: 273 ---LITVMLAENPIHR 285
              L+T +L ++P+ R
Sbjct: 403 AVDLLTRLLKKSPLDR 418

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 129/282 (45%), Gaps = 44/282 (15%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNK 82
           +++K L  G F ++     ++ + KV      K+V +        +  E+  ++LLR + 
Sbjct: 69  QIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKV-LAKSDMQGRVEREISFLRLLR-HP 126

Query: 83  HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
           HI+   D   SK        E+++++EY +   L  ++  R  D++ E E  +   Q++ 
Sbjct: 127 HIIKLYDVIKSKD-------EIIMVIEYAN-NELFEYIVQR--DKMTENEARKFFQQIIS 176

Query: 143 GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD--I 200
            +   H  +  ++HRD+K EN+L+ EN + K+ DFG              LS +  D   
Sbjct: 177 AVEYCH--RHKIVHRDLKPENLLLDENLNVKIADFG--------------LSNIMTDGNF 220

Query: 201 LKNTTA--QYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK- 255
           LK +     Y APE+I   LY G  V    D+W+ GV LY +     PF+     A+ K 
Sbjct: 221 LKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCRRLPFDDDSIPALFKN 276

Query: 256 ---ANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEE 294
                +  P +   S    NLI  ML  NP++R +  +++ +
Sbjct: 277 ISNGIYTLPKF--LSEGAANLIKKMLIVNPLNRISMTEIIHD 316

>Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W
           (REAL)
          Length = 1139

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 123/295 (41%), Gaps = 84/295 (28%)

Query: 17  VGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMK 76
           V  H+ K  K+     F  I   ++   D   +++A +K+ H                  
Sbjct: 165 VDRHEKKQRKF-----FTFIKSSKIFENDKIKREIAIMKKCH------------------ 201

Query: 77  LLRGNKHIVSYIDSHASKSVLNN-GSYEVVLLMEYCSRG-----------------GLIS 118
               +KH+V  I+      VL++  S ++ L++EYCSRG                  L+S
Sbjct: 202 ----HKHVVQLIE------VLDDLKSRKIYLVLEYCSRGEVKWCPPDCLESDAKGPSLLS 251

Query: 119 FMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFG 178
           F  TR            I+  VV G+  +H     +IHRDIK  N+LI+E+G  K+ DFG
Sbjct: 252 FQETR-----------DILRGVVLGLEYLH--YQGIIHRDIKPANLLISEDGTVKISDFG 298

Query: 179 SVCGVIRPPKNTYELSYVQHDILKNT-TAQYRAPEMI--------------DLYRGFSVD 223
                     +    S  + ++ K   T  + APEM               +L+RG  + 
Sbjct: 299 VSLAATSTNSSDSNESLDELELAKTVGTPAFFAPEMCLGEDAFAKYNLTKENLFRGSCIS 358

Query: 224 EKSDIWALGVFLYKLCYYTTPFEKTGEV----AILKANFQFPSYPQY-SNRLKNL 273
              DIWA+GV LY L +   PF    E+     I+    +FPSY +  SN++ N+
Sbjct: 359 FMIDIWAVGVTLYCLIFGMLPFFSDFELKLFEKIVNDPLKFPSYKEMQSNKVSNI 413

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 120/279 (43%), Gaps = 53/279 (18%)

Query: 17  VGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMK 76
           VG  K  VV    +    ++Y  +V++ DS   +V  ++R              E+  + 
Sbjct: 29  VGRGKFGVVYKGYNVKTRRVYAIKVLNLDSDSDEVEDVQR--------------EIQFLA 74

Query: 77  LLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRI 136
            L+   +I  Y  S+   + L        +LMEYC+ G L S +      ++ E  +  I
Sbjct: 75  SLKQMPNITRYYGSYLKDTSL-------WILMEYCAGGSLRSLLRP---GKIDEKYIGVI 124

Query: 137 MNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYV 196
           M +++  +  +H  +  +IHRDIK  NVLI   G  K+CDFG    V             
Sbjct: 125 MRELLVALKCIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVAAQV------------N 170

Query: 197 QHDILKNTTAQ---YRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAI 253
           Q  + + T A    + APE+I    G   D K DIW+LG+  Y++     P+    +V  
Sbjct: 171 QTSLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPY---CDVEA 225

Query: 254 LKA-NFQFPSYP------QYSNRLKNLITVMLAENPIHR 285
           L+A      S P       YS+ LK  I + L E+P  R
Sbjct: 226 LRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKER 264

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 96/199 (48%), Gaps = 26/199 (13%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           ++ L++EY  +G L + +  R    L E E +R   Q++ G+   HAL   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPE 160

Query: 163 NVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDL--YRGF 220
           N+L+    + K+ DFG     +       E S          +  Y APE++    Y+GF
Sbjct: 161 NLLLDHKYNIKIADFG--MAALETEGKLLETSC--------GSPHYAAPEIVSGIPYQGF 210

Query: 221 SVDEKSDIWALGVFLYKLCYYTTPF-EKTGEVAIL-----KANFQFPSYPQYSNRLKNLI 274
           +    SD+W+ GV L+ L     PF E+ G +  L     K  F+ PS  + S   ++LI
Sbjct: 211 A----SDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLI 266

Query: 275 TVMLAENPIHRPNSCQVLE 293
             +L  +P  R  +  +L+
Sbjct: 267 CKILTVDPKRRIKARDILK 285

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 127/275 (46%), Gaps = 32/275 (11%)

Query: 27  YLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVS 86
           +L  GGFA+  C ++     K+     + ++ +  +++   L +E+   K +R + +IV 
Sbjct: 84  FLGEGGFAR--CFQIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HFNIVQ 140

Query: 87  YIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILA 146
           +ID     +        V +L+E C  G L+  +  R    L E EV     Q+V  +  
Sbjct: 141 FIDCFEDDT-------NVYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVKY 191

Query: 147 MHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA 206
           MH+ +  +IHRD+K+ N+   ++ + K+ DFG    +    +  Y +           T 
Sbjct: 192 MHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVC---------GTP 240

Query: 207 QYRAPEMI-DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK-----ANFQF 260
            Y APE++   + G S +   DIW+ GV +Y L     PF+   EV I+       ++ F
Sbjct: 241 NYIAPEVLTGKHTGHSYE--VDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDYVF 297

Query: 261 PSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295
           P     S     LI  +L+ +P+ RP+  ++++ V
Sbjct: 298 PRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 122/275 (44%), Gaps = 44/275 (16%)

Query: 22  VKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHV-PDKQSLNTLRAEVDAMKLLRG 80
           +K  + +  G F  +Y    +    K K V  +K +++  D   +  ++ E+  +  L+ 
Sbjct: 44  IKRTEVIGRGKFGVVYKGYHL----KTKHVYAIKVLNLDSDSDEVEDVQREIQFLASLKQ 99

Query: 81  NKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQV 140
             +I  Y  S+   + L        ++MEYC+ G L + +   + D   E  +  IM ++
Sbjct: 100 VPNITRYYGSYLQDTNL-------WIIMEYCAGGSLRTLLRPGMID---EKYIGVIMREL 149

Query: 141 VQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDI 200
           +  +  +H  +  +IHRDIK  NVLI   G  K+CDFG    +             Q  +
Sbjct: 150 LTALQCIH--KDNVIHRDIKAANVLITNEGKVKLCDFGVAAQL------------NQTSL 195

Query: 201 LKNTTAQ---YRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA- 256
            + T A    + APE+I    G   D K DIW+LG+  Y++     P+    E+  L+A 
Sbjct: 196 RRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPY---CEIEALRAM 250

Query: 257 NFQFPSYP------QYSNRLKNLITVMLAENPIHR 285
                S P      QYS+ LK  I + L E+P  R
Sbjct: 251 QLITKSKPARLEGRQYSSGLKEFIALCLDEDPKER 285

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 125/275 (45%), Gaps = 47/275 (17%)

Query: 31  GGFAQIY-CCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYID 89
           G F  +Y  CE +S   KV  V  +   H    + +N L  E+  +  L+ + +I +YI 
Sbjct: 26  GNFGDVYKACEKVS--GKVVAVKVVNLEHT--DEDINLLAQEIFFLAELK-SPYITNYIT 80

Query: 90  SHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHA 149
           +             + ++MEYC  G     +       L E +   I  +V++G+  +H 
Sbjct: 81  TMTE-------DVSMWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHE 133

Query: 150 LQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPP--KNTYELSYVQHDILKNTTAQ 207
            +   IHRDIK  N+L+ + G  K+ DFG V G IR    + T+             T  
Sbjct: 134 QKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATLKRGTFV-----------GTPF 179

Query: 208 YRAPEMI----DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPS- 262
           + APE++    D Y     DEK+DIW+LG+ +Y+L   + P  K   + ++      P  
Sbjct: 180 WMAPEVVSKDSDGY-----DEKADIWSLGITVYELLKGSPPLYKCDPMKVM---VNLPKR 231

Query: 263 -----YPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
                +  YS+  K+ +   L +NP +RP++ ++L
Sbjct: 232 KPPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELL 266

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 79.3 bits (194), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 82/272 (30%), Positives = 114/272 (41%), Gaps = 42/272 (15%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNT---LRAEVDAMKLLR 79
           ++ K L  G F ++YC   I        V  LK +   D    N     R EV+    LR
Sbjct: 110 EIGKVLGKGKFGRVYCVRHIESGF----VCALKAMEKKDIIQYNIEKQFRREVEIQSSLR 165

Query: 80  GNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTR--LQDRLKEFEVLRIM 137
                  Y   H  K         V LLMEY   G L   +  R    D +  + V    
Sbjct: 166 HPNLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVY--- 214

Query: 138 NQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQ 197
            Q+   +  MH  +  ++HRDIK EN++I  N   K+ DFG    VI  PK +   +   
Sbjct: 215 -QMADALDYMH--ERNILHRDIKPENIIIGFNNTIKLTDFG--WSVI-TPKGSKRKTLC- 267

Query: 198 HDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGE----VAI 253
                  T  Y +PE+I   R    +EK D+WALGV  Y+L   + PFE+  +      I
Sbjct: 268 ------GTVDYLSPELI---RSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRI 318

Query: 254 LKANFQFPSYPQYSNRLKNLITVMLAENPIHR 285
           LK N  FP +     R  +LI+ +L  +P  R
Sbjct: 319 LKRNLIFPDHVDTEAR--HLISRLLEYDPGDR 348

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 120/284 (42%), Gaps = 43/284 (15%)

Query: 24   VVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVH---------VPDKQSLNTLRAEVDA 74
            V++ +  G + ++  C       K K +  +KR++         V D+ +L T+ +E+  
Sbjct: 971  VLQKMGEGAYGKVDLC----MHKKDKYIVVIKRIYKERILVDTWVRDR-TLGTIPSEIQI 1025

Query: 75   MKLLRGNKH--IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFE 132
            M  L    H  I+  +D         +  Y  +    +   G +  F    L+  + EFE
Sbjct: 1026 MVTLNRKPHENILRILD------FFEDDDYYYLETEMHGETGSIDLFDLIELKTNMTEFE 1079

Query: 133  VLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYE 192
               +  QV  GI  +H     ++HRDIK ENV++   G  K+ DFGS   V   P + + 
Sbjct: 1080 AKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSAAYVKSGPFDVFV 1137

Query: 193  LSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGE 250
                        T  Y APE++  + Y G    +  DIWA+GV LY + Y   PF    E
Sbjct: 1138 -----------GTIDYAAPEVLGGEPYEG----KPQDIWAIGVLLYTIIYKENPFYNIDE 1182

Query: 251  VAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEE 294
              IL  + +  S  + S     LI  +L  +   RP    ++E+
Sbjct: 1183 --ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPTIDDIMED 1224

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 79.3 bits (194), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 117/274 (42%), Gaps = 32/274 (11%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNK 82
           ++ + L  G F ++YC     P   +  +  + ++ + +       + E+D    L    
Sbjct: 119 EIGRKLGKGKFGKVYCVRH-KPSGLICALKVMNKMEIVNFNVQKQFKREIDIQYHLNHKN 177

Query: 83  HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
               Y   H SK+V         L+MEY   G L   +  +    + +      + Q+  
Sbjct: 178 LTKLYAFFHDSKNV--------YLVMEYLIGGELYKLL--KKNGPMNDITASNYVYQMTD 227

Query: 143 GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
            +  MH  +  +IHRD+K EN+LI  N   K+ DFG     I  P N    +        
Sbjct: 228 ALNYMHKRK--IIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC------ 276

Query: 203 NTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEK-TGEVA---ILKANF 258
             T  Y +PE+I        DE  D+WALG+  Y+L     PFE+ T E     I K++ 
Sbjct: 277 -GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIAKSDL 332

Query: 259 QFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
           +FP  P  S+  ++LIT +L   P  R N  QV+
Sbjct: 333 KFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 86/354 (24%), Positives = 145/354 (40%), Gaps = 76/354 (21%)

Query: 13  TVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVP--DKQSLNTLRA 70
           +VL  G H   + + L  GGF+ +Y    +    +  D+  LK++H P  + +S++    
Sbjct: 20  SVLINGQH-YAIQRLLGEGGFSFVY----LVQSRENNDLFALKKIHCPFGNIESVSEAMR 74

Query: 71  EVDAMKLLRGNKHIVSYIDSHASKSVLN--NGSYEVVLLMEYCSRGGLI----------- 117
           EV++ K  R       YI    S  VL   +GS  V +L+ Y   G L+           
Sbjct: 75  EVNSYKKFRS-----PYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDGT 129

Query: 118 ----------------------------------SFMNTRLQDR----LKEFEVLRIMNQ 139
                                             + +NT LQ R    +   E LR++N 
Sbjct: 130 TISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLND 189

Query: 140 -----VVQG-ILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYEL 193
                V+ G   +  A      H+DIK  N++ + +G   +CD GS         +  +L
Sbjct: 190 SLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQL 249

Query: 194 SYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV-- 251
              Q    ++ T  +R+PE++++     +DEK DIW+LG  LY +C+  +PFE+  ++  
Sbjct: 250 VEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSG 309

Query: 252 -----AILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQG 300
                AI    F  P    YS  L  +I   +  +   RP+  ++L  +  +QG
Sbjct: 310 ASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 100/210 (47%), Gaps = 32/210 (15%)

Query: 96  VLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLI 155
           VL N  Y + +++EY S G    ++  +   RLKE    R+  Q++ G+  MH+    L+
Sbjct: 113 VLQNSKY-IGIVLEYASGGEFYKYIQKKR--RLKESAACRLFAQLISGVYYMHSKG--LV 167

Query: 156 HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQ--YRAPEM 213
           HRD+K+EN+L+ +N +  + DFG V   +  P+N         +++K +     Y APE+
Sbjct: 168 HRDLKLENLLLDKNENLLITDFGFVNEFL--PEN---------ELMKTSCGSPCYAAPEL 216

Query: 214 IDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGE-----------VAILKANFQFPS 262
           +   R +    K+DIW+ GV +Y +     P++   E             I +   +FP 
Sbjct: 217 VVTARPYEA-RKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPD 275

Query: 263 YPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
           Y   +   ++L+  +L  +P  R    Q L
Sbjct: 276 Y--IAPVPRDLLRAILVADPKKRITIAQTL 303

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 131/298 (43%), Gaps = 59/298 (19%)

Query: 9   FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTL 68
           F    +  VG++K+  +K +  G F ++Y         KV    CLK     DK   N +
Sbjct: 30  FTSDELTEVGNYKI--LKQIGEGSFGKVYLALHRPTHRKV----CLK---TSDKNDPNIV 80

Query: 69  RAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRL 128
           R      ++    +    YI       V  +   +V + +EYC    L  + +     RL
Sbjct: 81  R------EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKEL--YDHLLSLRRL 129

Query: 129 KEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPK 188
              E   +  Q+   +   H++    +HRD+K+EN+L+  NG+ K+ DFG          
Sbjct: 130 SLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFG---------- 177

Query: 189 NTYELSYVQHDILKNT------TAQYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCY 240
                 + +  + K T      T  Y APE+I+   Y GF +    DIW+LGV LY L  
Sbjct: 178 ------FTRECMTKTTLETVCGTTVYMAPELIERKTYDGFKI----DIWSLGVILYTLIT 227

Query: 241 YTTPFEKTGEVAILKANFQFPS-YPQYSNRL-----KNLITVMLAENPIHRPNSCQVL 292
              PF+   EV   K  ++  +  P+Y ++      K+LI+ +LA+NP  RP+  QVL
Sbjct: 228 GYLPFDDDDEV---KTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 110/237 (46%), Gaps = 40/237 (16%)

Query: 68  LRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDR 127
           +  E+  MKLLR + +++S  D   + S L        +++EY  +G L + +  +    
Sbjct: 81  IEREIIIMKLLR-HANVLSLYDVWETNSNL-------YMILEYAEKGELFNLLVEK--GP 130

Query: 128 LKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPP 187
           L E E +R   Q++ GI   HAL   ++HRD+K EN+L+    + K+ DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA------ 182

Query: 188 KNTYELSYVQHDILKNTTA---QYRAPEMIDL--YRGFSVDEKSDIWALGVFLYKLCYYT 242
                      D L  T+     Y APE++    Y GF    +SD+W+ GV L+ L    
Sbjct: 183 -------LETEDKLLETSCGSPHYAAPEIVSGIPYHGF----ESDVWSCGVILFALLTGR 231

Query: 243 TPF-EKTGEV-----AILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLE 293
            PF E+ G +      +    F+ P   + S   ++LI+ +L  +P  R  + ++L+
Sbjct: 232 LPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 78/280 (27%), Positives = 124/280 (44%), Gaps = 49/280 (17%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRA-----EVDAMKL 77
           K++K +  G F ++Y         KV     LK     DK   N +R      + D + +
Sbjct: 38  KIMKQIGEGSFGKVYLASHKPTHRKV----VLK---TSDKNDPNVVREVFYHRQFDYLYI 90

Query: 78  LRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIM 137
            R  + IV+                +V + +EYC    L  + +     R+   E  R+ 
Sbjct: 91  TRLYEVIVTET--------------KVWMALEYCPGKEL--YEHLLALKRISLDECSRLF 134

Query: 138 NQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQ 197
            Q+V  I   H+L    +HRD+K+EN+L+ + G+ K+ DFG     +         S  Q
Sbjct: 135 AQIVGAIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDFGFTRECV---------SKSQ 183

Query: 198 HDILKNTTAQYRAPEMIDL--YRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAI-L 254
            D +  TT  Y APE+ +   Y GF +    DIWALGV LY +   + PF++  E     
Sbjct: 184 LDTICGTTV-YMAPELTERKSYDGFKI----DIWALGVILYTMINGSMPFDEDDEAKTKW 238

Query: 255 KANFQFPSYPQ--YSNRLKNLITVMLAENPIHRPNSCQVL 292
           K   + P   +   S   K+LI  +LA++P  RP+  ++L
Sbjct: 239 KIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKIL 278

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 103/209 (49%), Gaps = 32/209 (15%)

Query: 96  VLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLI 155
           VL N  Y + +++EY S G    ++  +   RLKE    R+  Q++ G+  MH+    L+
Sbjct: 116 VLQNSKY-IGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LV 170

Query: 156 HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQ--YRAPEM 213
           HRD+K+EN+L+ +N +  + DFG V           E ++ +++++K +     Y APE+
Sbjct: 171 HRDLKLENLLLDKNENLLITDFGFVN----------EFNH-KNELMKTSCGSPCYAAPEL 219

Query: 214 IDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGE------VA-----ILKANFQFPS 262
           +   + +    K+DIW+ GV +Y +     P++   E      +A     I K   +FP 
Sbjct: 220 VVTTKPYEA-RKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPE 278

Query: 263 YPQYSNRLKNLITVMLAENPIHRPNSCQV 291
           Y     R  +L+  +L  NP  R N  QV
Sbjct: 279 YINPVPR--DLLRRILVSNPKKRLNLRQV 305

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 119/277 (42%), Gaps = 33/277 (11%)

Query: 24  VVKYLTSGGFAQIYCC-----EVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLL 78
           V++ +  GGFA++  C     + +    KV     L+     D +  N  R E+  M  L
Sbjct: 672 VLQDMGEGGFAKVSLCLNKEDKYVVVIKKVFKEKVLEETWTSDNKFGNIPR-EIQIMSTL 730

Query: 79  RG--NKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRI 136
               NK+ +  +D         + ++  +  + +  +G +  F     +D++ E E   I
Sbjct: 731 HKYPNKNTLRMLD------FFEDENFYYIETLVHSMKGSIDLFDFIEKKDKIDEVEQKLI 784

Query: 137 MNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYV 196
             Q+V GI  +H L   +IHRDIK EN++I   G  +V DFGS       P   +     
Sbjct: 785 FKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVIDFGSAAYATNGPFQVF----- 837

Query: 197 QHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
                 + T  Y +PE++  + Y G    +  D+WALG+ LY + +  TPF    E+   
Sbjct: 838 ------HGTIDYASPEVLKGEPYEG----KPQDVWALGILLYIITFKQTPFNSVAEIIEN 887

Query: 255 KANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQV 291
           +           S++ + LI  ML +    RP   ++
Sbjct: 888 ELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 131/281 (46%), Gaps = 42/281 (14%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNK 82
           ++VK L  G F ++     I+ + KV      K+V +        +  E+  ++LLR + 
Sbjct: 46  QIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKV-LAKSDMQGRIEREISYLRLLR-HP 103

Query: 83  HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
           HI+   D   SK        E+++++E+ S   L  ++  R  D++ E E  R   Q++ 
Sbjct: 104 HIIKLYDVIKSKD-------EIIIVIEFAS-NELFDYIIQR--DKMSEQEARRFFQQIIS 153

Query: 143 GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD--I 200
            +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              LS +  D   
Sbjct: 154 AVEYCH--RHKIVHRDLKPENLLLDEDLNVKIADFG--------------LSNIMTDGNF 197

Query: 201 LKNTTA--QYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA 256
           LK +     Y APE+I   LY G  V    D+W+ GV LY +     PF+    + +L  
Sbjct: 198 LKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCRRLPFDDES-IPVLFK 252

Query: 257 NFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEE 294
           N     Y  P++ S    NLI  ML  NP++R +  ++ ++
Sbjct: 253 NISNGVYILPKFLSLGAANLIKKMLIVNPLNRISISEIFKD 293

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 98/196 (50%), Gaps = 27/196 (13%)

Query: 104 VVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIEN 163
           V +++EYCS   L  + +   + RL   E  ++ +Q+   +   H L+   +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHEL--YEHLLKEQRLSLEESKKLFSQIASAVYYAHELK--CVHRDLKLEN 158

Query: 164 VLIAENGDCKVCDFGSVCGVIRPPKNTYEL-SYVQHDILKNTTAQYRAPEMID--LYRGF 220
           VL+  NG  K+ DFG           T E+ +  Q + +  TT  Y APE+I+   Y GF
Sbjct: 159 VLLDGNGHAKLTDFGF----------TREMATRSQLETICGTTV-YMAPELIERKCYDGF 207

Query: 221 SVDEKSDIWALGVFLYKLCYYTTPFEKTGEV----AILKANFQFPSYPQYSNRLKNLITV 276
            V    DIW+LG+ LY +     PF++  ++     I+     F +    S+   +LI  
Sbjct: 208 KV----DIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF-NQEWISDDAIDLIQG 262

Query: 277 MLAENPIHRPNSCQVL 292
           ML +NP  R +  QVL
Sbjct: 263 MLRKNPNERISLAQVL 278

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 130/298 (43%), Gaps = 59/298 (19%)

Query: 9   FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTL 68
           F    +  VG++K+  +K +  G F ++Y         KV    CLK     DK   N +
Sbjct: 30  FTSDELTEVGNYKI--LKQIGEGSFGKVYLALHRPTHRKV----CLK---TSDKNDPNIV 80

Query: 69  RAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRL 128
           R      ++    +    YI       V  +   +V + +EYC    L   + +    R+
Sbjct: 81  R------EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKELYDHLLS--LHRI 129

Query: 129 KEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPK 188
              E   +  Q+   +   H++    +HRD+K+EN+L+ +NG+ K+ DFG          
Sbjct: 130 SLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG---------- 177

Query: 189 NTYELSYVQHDILKNT------TAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLYKLCY 240
                 + +  + K T      T  Y APE+I    Y GF +    D W+LGV LY L  
Sbjct: 178 ------FTRECMTKTTLETVCGTTVYMAPELIGRKTYDGFKI----DTWSLGVILYTLIT 227

Query: 241 YTTPFEKTGEVAILKANFQFPS-YPQYSNRL-----KNLITVMLAENPIHRPNSCQVL 292
            + PF+   E    K  ++  +  P+Y  +L     K+LI+ +LA+NP  RP+  QVL
Sbjct: 228 GSLPFDDDDEA---KTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 125/287 (43%), Gaps = 53/287 (18%)

Query: 17  VGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMK 76
           +G  K  VV    +    ++Y  +V++ DS   +V  ++R              E+  + 
Sbjct: 29  IGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQR--------------EIQFLA 74

Query: 77  LLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRI 136
            L+   +I  Y  S+   + L        ++ME+C+ G L S +      ++ E  +  I
Sbjct: 75  SLKQISNITRYYGSYLKDTSL-------WIIMEHCAGGSLRSLLR---PGKIDEKYIGVI 124

Query: 137 MNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYV 196
           M +++  +  +H  +  +IHRDIK  NVLI   G+ K+CDFG    V             
Sbjct: 125 MRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV------------N 170

Query: 197 QHDILKNTTAQ---YRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAI 253
           Q  + + T A    + APE+I    G   D K DIW+LG+  Y++     P+    +V  
Sbjct: 171 QTSLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPY---CDVEA 225

Query: 254 LKA-NFQFPSYP------QYSNRLKNLITVMLAENPIHRPNSCQVLE 293
           L+A      S P       YS  LK  I + L E+P  R ++  +L+
Sbjct: 226 LRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLK 272

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score = 80.1 bits (196), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 133/288 (46%), Gaps = 44/288 (15%)

Query: 18  GSH--KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAM 75
           G+H    ++VK L  G F ++     ++   KV      K+V +        +  E+  +
Sbjct: 55  GAHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKV-LAKSDMQGRIEREISYL 113

Query: 76  KLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLR 135
           +LLR + HI+   D   SK        E++++MEY     L  ++  R  D++ E E  R
Sbjct: 114 RLLR-HPHIIKLYDVIKSKD-------EIIMVMEYAG-NELFDYIVQR--DKMSENEARR 162

Query: 136 IMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSY 195
              Q++  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              LS 
Sbjct: 163 FFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG--------------LSN 206

Query: 196 VQHD--ILKNTTA--QYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTG 249
           +  D   LK +     Y APE+I   LY G  V    D+W+ GV LY +     PF+   
Sbjct: 207 IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVILYVMLCRRLPFDDES 262

Query: 250 EVAILKANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEE 294
            + +L  N     Y  P++ S    +LI  ML  NP++R +  +++++
Sbjct: 263 -IPVLFKNINNGVYTIPKFLSQGASSLIKRMLIVNPLNRISISEIMQD 309

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 117/252 (46%), Gaps = 40/252 (15%)

Query: 53  CLKRVHVPDKQSLNTLRAEVDAMKLLRGNKH---IVSYIDSHASKSVLNNGSYEVVLLME 109
           C K+ H+  ++ +  +  E D + LL G  H   +  +   H + ++          ++E
Sbjct: 42  CSKK-HIIRERKVKYVTVEKDLLNLLAGGGHPGVVRLFCTFHDTDNLY--------YVLE 92

Query: 110 YCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAEN 169
           + S G L+  +  R   RL E    RI +Q+V  +  MHA    +IHRD+K ENVL+++ 
Sbjct: 93  FVSGGELLGLV--RRMGRLPEEWCRRIASQLVDTVDYMHAKG--VIHRDLKPENVLLSQE 148

Query: 170 GDCKVCDFGSVC----GVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEK 225
           G   + DFG+ C    G   P       S+V        TA+Y +PE++ L+   S    
Sbjct: 149 GRIVITDFGAACCASEGGSAPGAADRAASFVG-------TAEYVSPELL-LHSQCSFG-- 198

Query: 226 SDIWALGVFLYKLCYYTTPFEKTGE------VAILKANFQFPSYPQYSNRLKNLITVMLA 279
           SD+WALG  +Y+L     PF    E      +  L   + + + P     +  L+  +L 
Sbjct: 199 SDVWALGCIIYQLTQGAPPFRGDTELQSFEKIVALDYRWVYAAPPL----IVALVQSILV 254

Query: 280 ENPIHRPNSCQV 291
            +P+ RP++ Q+
Sbjct: 255 LDPLQRPSAKQL 266

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 124/286 (43%), Gaps = 53/286 (18%)

Query: 17  VGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMK 76
           +G  K  VV    +    ++Y  +V++ DS   +V  ++R              E+  + 
Sbjct: 29  IGRGKFGVVYKGYNVKTRRVYAIKVLNLDSDSDEVEDVQR--------------EIQFLA 74

Query: 77  LLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRI 136
            L+   +I  Y  S+   + L        ++MEYC+ G L S +      ++ E  +  I
Sbjct: 75  SLKQISNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLLR---PGKIDEKYIGVI 124

Query: 137 MNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYV 196
           M +++  +  +H  +  +IHRDIK  NVLI   G+ K+CDFG    V             
Sbjct: 125 MRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV------------N 170

Query: 197 QHDILKNTTAQ---YRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAI 253
           Q  + + T A    + APE+I    G   D K DIW+LG+  Y++     P+    +V  
Sbjct: 171 QTSLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPY---CDVEA 225

Query: 254 LKA-NFQFPSYP------QYSNRLKNLITVMLAENPIHRPNSCQVL 292
           L+A      S P       YS  LK  I + L E+P  R ++  +L
Sbjct: 226 LRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKERLSADDLL 271

>Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {ON}
           YER129W (REAL)
          Length = 1147

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/270 (28%), Positives = 121/270 (44%), Gaps = 70/270 (25%)

Query: 66  NTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNN-GSYEVVLLMEYCSRG---------- 114
           + ++ E+  MK    +KH+V  I+      VL++  S ++ L++EYCSRG          
Sbjct: 187 DKIKREIAIMKKCH-HKHVVQLIE------VLDDLKSRKIYLVLEYCSRGEVKWCPPDCL 239

Query: 115 -------GLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIA 167
                   L+SF  TR        E+LR    VV G+  +H     +IHRDIK  N+LI+
Sbjct: 240 ESDAKGPSLLSFQETR--------EILR---GVVLGLEYLHYQG--IIHRDIKPANLLIS 286

Query: 168 ENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNT-TAQYRAPEMI------------ 214
           E+G  K+ DFG          +    S  + ++ K   T  + APEM             
Sbjct: 287 EDGTVKISDFGVSLAASSTNSSDSSESLNELELAKTVGTPAFFAPEMCLGEDAFTKYNLT 346

Query: 215 --DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV----AILKANFQFPSYPQY-S 267
             +L+RG  +    DIWA+GV LY L +   PF    E+     I+    +FP+Y +  S
Sbjct: 347 KDNLFRGSCISFMIDIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVDDPLKFPTYEEMQS 406

Query: 268 NRL------------KNLITVMLAENPIHR 285
           N +            K+L++ +L +NP  R
Sbjct: 407 NNVSKISCEEEYQMAKDLLSKLLEKNPQKR 436

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 98/195 (50%), Gaps = 22/195 (11%)

Query: 106 LLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVL 165
           ++MEYC  G     +     + L E +V  I   V++G+  +H  +   IHRD+K  NVL
Sbjct: 94  IVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQRK--IHRDVKAANVL 151

Query: 166 IAENGDCKVCDFGSVCGVIR--PPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVD 223
           + ++G  K+ DFG V G +R    +NT+             T  + APE+I        +
Sbjct: 152 LTDDGLVKLADFG-VSGQLRSTAKRNTFV-----------GTPYWMAPEIIS-NSSHGYN 198

Query: 224 EKSDIWALGVFLYKLCYYTTPFEK--TGEVA--ILKANFQFPSYPQYSNRLKNLITVMLA 279
           EK+DIW+LG+ +Y+L     P+ K   G+V   I K N Q      +S+  K  I+  L 
Sbjct: 199 EKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQ-DCMVSFSDAAKLFISACLI 257

Query: 280 ENPIHRPNSCQVLEE 294
           ++P  RP + ++L++
Sbjct: 258 KDPDERPTATELLQQ 272

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 120/269 (44%), Gaps = 53/269 (19%)

Query: 35  QIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASK 94
           Q+Y  +V++ DS   +V  ++R              E+  +  L+   +I  Y  S+   
Sbjct: 40  QVYAIKVLNLDSSEDEVEDVQR--------------EIQFLASLKQIPNITRYYGSYLRG 85

Query: 95  SVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPL 154
           + L        ++MEYC+ G L S +      ++ E  +  IM +++  +  +H  +  +
Sbjct: 86  TSL-------WIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKVIH--KDNV 133

Query: 155 IHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQ---YRAP 211
           IHRDIK  NVLI   G  K+CDFG    +             Q  + + T A    + AP
Sbjct: 134 IHRDIKAANVLITNEGQVKLCDFGVAAQL------------NQTSLRRQTMAGTPYWMAP 181

Query: 212 EMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA-NFQFPSYP------ 264
           E+I    G   D K DIW+LG+  Y++     P+    +V  L+A      S P      
Sbjct: 182 EVI--MEGVYYDTKVDIWSLGITAYEIATGNPPY---CDVEALRAMQLIIKSKPPRLEER 236

Query: 265 QYSNRLKNLITVMLAENPIHRPNSCQVLE 293
            Y+ +LK  I + L E+P  R ++ ++L+
Sbjct: 237 NYTPQLKEFIALCLDEDPQERLSAEELLK 265

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 129/274 (47%), Gaps = 35/274 (12%)

Query: 28  LTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSY 87
           L  G ++ +Y     S   +   +    + H+  ++ +  +  E D + +L    H+   
Sbjct: 16  LGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNMLAKGGHL-GI 74

Query: 88  IDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAM 147
           +    +   + N    +  ++EY S G L++ +  RL  RL E     I  Q+V  +  M
Sbjct: 75  VKLFCTFHDIEN----LYFVLEYVSGGELLALIQ-RL-GRLTEDLSRHITAQLVDTVDYM 128

Query: 148 HALQPPLIHRDIKIENVLIAENGDCKVCDFGSVC-GVIRPPKNTYEL-SYVQHDILKNTT 205
           H+    +IHRD+K ENVL+++ G   + DFG+ C    R  +NT    S+V        T
Sbjct: 129 HS--KGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVG-------T 179

Query: 206 AQYRAPEMIDLYR--GFSVDEKSDIWALGVFLYKLCYYTTPFEKTGE------VAILKAN 257
           A+Y +PE++ L+   GFS    SDIWALG  +Y+L     PF    E      +  L   
Sbjct: 180 AEYVSPELL-LHSQCGFS----SDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYK 234

Query: 258 FQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQV 291
           + F + PQ    + +++  +L  +P+ RP++ Q+
Sbjct: 235 WLFSNSPQ----VVSIVQSILVTDPLKRPSAAQL 264

>AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YJL095W (BCK1)
          Length = 1423

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 110/237 (46%), Gaps = 35/237 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVP-----DKQSLNTLRAEVDAMKLLRGNKH-- 83
            G F  +Y    ++      ++  +K+V VP     D+ ++N   A +  +  L+   H  
Sbjct: 1133 GSFGAVYLGLNVT----TGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDHLN 1188

Query: 84   IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQG 143
            IV Y+          N +    L +EY + G + S +  RL     E  +  +  QV++G
Sbjct: 1189 IVQYLG-------FENKNCIYSLFLEYVAGGSVGSLI--RLYGHFDEQLIRFLTTQVLEG 1239

Query: 144  ILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKN 203
            +  +H     ++HRD+K +N+L+  +G CK+ DF    G+ R   N Y  S    ++   
Sbjct: 1240 LAYLHLRG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNNIYSNS----EMTMR 1289

Query: 204  TTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQF 260
             T  + APEM+D  +G+S   K DIW+LG  + ++     P+     + ++ A FQ 
Sbjct: 1290 GTVFWMAPEMVDTTQGYSA--KVDIWSLGCVVLEMFAGKRPW---SNLEVVAAMFQI 1341

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 132/288 (45%), Gaps = 44/288 (15%)

Query: 18  GSH--KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAM 75
           G H  K +++K L  G F ++     IS   KV      K+V +        +  E+  +
Sbjct: 29  GQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKV-LAKSDMQGRIEREISYL 87

Query: 76  KLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLR 135
           +LLR + HI+   D   SK        E+++++EY     L  ++  R  D++ E E  R
Sbjct: 88  RLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAG-NELFDYIVQR--DKMPEQEARR 136

Query: 136 IMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSY 195
              Q++  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              LS 
Sbjct: 137 FFQQIISAVDYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG--------------LSN 180

Query: 196 VQHD--ILKNT--TAQYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTG 249
           +  D   LK +  +  Y APE+I   LY G  V    D+W+ GV LY +     PF+   
Sbjct: 181 IMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVILYVMLCRRLPFDDES 236

Query: 250 EVAILKANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEE 294
            + +L  N     Y  P + S    +LI  ML  NP++R    +++++
Sbjct: 237 -IPVLFKNISNGVYTIPNFLSQGAASLIKKMLIVNPVNRITVHEIMQD 283

>Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 113/242 (46%), Gaps = 38/242 (15%)

Query: 70  AEVDAMKLLRGNKHIVSYIDSHASKSVLNN-GSYEVVLLMEYCSRGGLISFMNTRLQDR- 127
            E++AMK    +K++V   +      +LN+  S +V L++EYCSRG +      +++ + 
Sbjct: 103 GEIEAMKRCH-HKNVVELYE------ILNDPESSKVYLVLEYCSRGPVRWCPENQMEIKA 155

Query: 128 ----LKEFEVLR-IMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCG 182
               +  FE  R I++ VV G+  +H+    + HRDIK  N+LI+ NG  K+ DFG    
Sbjct: 156 VGPSILTFEQSRKILSDVVSGLEHLHS--RGITHRDIKPSNLLISSNGTVKISDFGV--- 210

Query: 183 VIRPPKNTYELSYVQHDILKNTTA---QYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239
            I     +  +      ILK+ T     + APE+             DIW+LGV LY L 
Sbjct: 211 AILSTTGSTNIQSSHEQILKSKTLGTPAFLAPELCSTDSEHCCTFAIDIWSLGVTLYCLL 270

Query: 240 YYTTPFEKTGEVA----ILKANFQFPSYPQYSNR------------LKNLITVMLAENPI 283
           + T PF     +     I+  + + PSY +  NR             KNL+  +L +NP 
Sbjct: 271 FGTLPFNANSVLELFDKIINKSLEVPSYEEMLNRGTSDITIEEYSDAKNLLYKLLQKNPD 330

Query: 284 HR 285
            R
Sbjct: 331 KR 332

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 85/189 (44%), Gaps = 35/189 (18%)

Query: 100  GSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDI 159
            GS ++  L+E+ S               + EFE+  +  QVV G+  +H     ++HRDI
Sbjct: 1213 GSIDLFDLIEFTSN--------------MTEFEIKLLFKQVVSGVKHLH--DQGIVHRDI 1256

Query: 160  KIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLY 217
            K EN+++   G  K+ DFGS   V   P + +             T  Y APE++  + Y
Sbjct: 1257 KDENIIVDNKGFIKIIDFGSAAYVKSGPFDVFV-----------GTIDYAAPEVLGGNPY 1305

Query: 218  RGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVM 277
             G    +  DIWALG+ LY + +   PF    E  IL+ + +F      S     LI ++
Sbjct: 1306 EG----KPQDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLI 1359

Query: 278  LAENPIHRP 286
            L  N   RP
Sbjct: 1360 LNRNVFKRP 1368

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 124/277 (44%), Gaps = 54/277 (19%)

Query: 35  QIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASK 94
           Q+Y  +V++ DS+  +V  ++R              EV  +  L+   +I+ Y  S+   
Sbjct: 70  QVYAIKVLNLDSESDEVEDVQR--------------EVQFLSSLKQFPNIIRYFGSYLKD 115

Query: 95  SVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPL 154
           + L        ++M+YC+ G + + +      ++ E  +  IM +++  +  +H  +  +
Sbjct: 116 TNL-------WIIMDYCAGGSIRTLLR---PGKIDEKYIGIIMREILIALQYIH--KDNV 163

Query: 155 IHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQ---YRAP 211
           IHRDIK  NVL+   G  K+CDFG    +             Q  + + T A    + AP
Sbjct: 164 IHRDIKAANVLVTNEGKVKLCDFGVAAQL------------NQTKLRRQTMAGTPYWMAP 211

Query: 212 EMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA-NFQFPSYP------ 264
           E+I    G   D K+DIW+LG+  Y++     P+    E+  L+A      S P      
Sbjct: 212 EVI--MEGAYYDTKADIWSLGITAYEIATGNPPY---CEIEALRAMQLITKSKPARLEGR 266

Query: 265 QYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQ 301
            YS  LK  I + L E+P  R  S + L++   I+ Q
Sbjct: 267 SYSTSLKEFIALCLDEDPKERL-SAEELQKTKFIKSQ 302

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 96/197 (48%), Gaps = 30/197 (15%)

Query: 100 GSY----EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLI 155
           GSY    ++ ++MEYC+ G L + +      ++ E  +  IM +++  +L +H  +  +I
Sbjct: 90  GSYLYDTKLWIIMEYCAGGSLRTLLR---PGKIDEKYIGVIMRELLVALLYIH--KDNVI 144

Query: 156 HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMID 215
           HRDIK  NVLI  +G  K+CDFG    + +        S V+   +   T  + APE+I 
Sbjct: 145 HRDIKAANVLITNDGRVKLCDFGVAAQLTQ--------SNVRRQTMAG-TPYWMAPEVI- 194

Query: 216 LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA-NFQFPSYP------QYSN 268
              G   D K DIW+LG+  Y++     P+    +V  L+A      S P      QYS 
Sbjct: 195 -MEGVYYDTKVDIWSLGITTYEITTGNPPY---CDVEALRAMQLITKSKPPRLEGRQYSP 250

Query: 269 RLKNLITVMLAENPIHR 285
            LK  I + L E+P  R
Sbjct: 251 LLKEFIALCLDEDPKER 267

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 131/295 (44%), Gaps = 30/295 (10%)

Query: 9   FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTL 68
           F+  T++  G    K    L  G ++Q++     +  SK   V  L + ++  ++ +  +
Sbjct: 105 FRRQTIIRKGIKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYV 164

Query: 69  RAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRL 128
             E  A++ L+    +++        S        +  L+EY   G  +S +  +    L
Sbjct: 165 NIEKTALQNLKSVTGVINL-------SFTFQDEANLYFLLEYAPNGDFLSLI--KKFGTL 215

Query: 129 KEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPK 188
            E   +    Q++  I +MH+    +IHRDIK EN+L+  N   K+ DFG+   + +   
Sbjct: 216 NEECTIYYSAQIIDAIGSMHSHG--IIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSD 273

Query: 189 NTYELSYVQHDILKNT-----TAQYRAPEMI-DLYRGFSVDEKSDIWALGVFLYKLCYYT 242
              +  Y   ++L  +     TA+Y +PE++ D Y     D K DIWA G  +Y++    
Sbjct: 274 KNGKPHY---NLLTRSSSFVGTAEYVSPELLSDNY----TDYKCDIWAFGCLVYQMIAGK 326

Query: 243 TPFEKTGEV----AILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLE 293
            PF+ T E      ++K  F F +   +   +++L+  +L + P  R    Q+ E
Sbjct: 327 PPFKATNEYLTFQKVMKVQFAFTA--GFPTIIRDLVKNILVKQPEKRLTIPQIKE 379

>NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {ON}
           Anc_6.262 YPL236C
          Length = 367

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/346 (21%), Positives = 146/346 (42%), Gaps = 59/346 (17%)

Query: 13  TVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKD--VACLKRVHVP--DKQSLNTL 68
           +++++ +   K+ K L     +  Y    +  +   ++  +  LKR++ P  D +S++  
Sbjct: 21  SIISINARDYKIEKLLQDENLSYSYLVRTLDSEPPFENGPLFVLKRIYCPFGDIESVSAA 80

Query: 69  RAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMN------- 121
             E+   K   GN HI+S +D    +    +GS ++ +L  +   G +   +N       
Sbjct: 81  MNEISYYKKFAGNSHIISCLDYQLHQKY--DGSKQIDVLFPFYHYGSVQDDINRHLLSSS 138

Query: 122 TRLQDRLKEFEVLRIMNQVVQGILAMH------------------ALQPPLIHRDIKIE- 162
           T L   + E + ++IM  + +G+L +H                  +   PL+  D+ +E 
Sbjct: 139 TALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIMSYSENAPLLLNDLPMEL 198

Query: 163 -------------------NVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKN 203
                               +L++E G+  + D  S            +L+  Q  I ++
Sbjct: 199 SKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCFRTNITISTEIQLNRFQQWIEEH 258

Query: 204 TTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV--AILKANFQFP 261
            T Q+ APE++ L  G  +  K DIW+LG  LY + +  +PFE+  ++   ++K   +  
Sbjct: 259 CTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQLNGGVVKYCIKMG 318

Query: 262 SYP------QYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQ 301
            Y        YS  + +++   L  +P  RP+   +L  +  IQG+
Sbjct: 319 KYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILNNLQEIQGK 364

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 126/307 (41%), Gaps = 46/307 (14%)

Query: 5    PQDSFQPGTVLTVGSHK-------VKVVKYLTSGGFAQIYCC-----EVISPDSKVKDVA 52
            PQ +F       +GS K         +++ +  G + ++  C     + I     +    
Sbjct: 1098 PQTTFLRKPAKKIGSEKHIKKFSDFLILQKMGEGAYGKVNMCIHKVKKYIVVIKMIFKER 1157

Query: 53   CLKRVHVPDKQSLNTLRAEVDAMKLLRGNKH--IVSYIDSHASKSVLNNGSYEVVLLMEY 110
             L    V D+Q L T+ +E+  M  L    H  I+S +D         +  Y  +    +
Sbjct: 1158 ILVDTWVRDRQ-LGTIPSEIQIMATLNKKPHDNILSLLD------FFEDDDYYYIETPVH 1210

Query: 111  CSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENG 170
               G +  F     +  + EFE   I  Q+V GI  +H     ++HRDIK ENV++   G
Sbjct: 1211 GETGCIDLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKG 1268

Query: 171  DCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDI 228
              K+ DFGS   V   P + +             T  Y APE++  + Y G    +  DI
Sbjct: 1269 CVKIIDFGSAAYVKSGPFDVFV-----------GTIDYAAPEVLSGEPYEG----KPQDI 1313

Query: 229  WALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNS 288
            WA+G+ LY + +   PF    E  IL+   +F +    S     LI  +L  +   RP  
Sbjct: 1314 WAIGILLYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRP-- 1369

Query: 289  CQVLEEV 295
              ++EE+
Sbjct: 1370 --LIEEI 1374

>Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AFL101C
          Length = 366

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 117/295 (39%), Gaps = 60/295 (20%)

Query: 26  KYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIV 85
           K L  G F ++YC   I P   +  +  +++  +         R EV+    LR      
Sbjct: 112 KILGKGKFGKVYCVRHI-PSGFICALKAMEKKEIIQYNIEKQFRREVEIQSSLRHPNLTQ 170

Query: 86  SYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTR--LQDRLKEFEVLRIMNQVVQG 143
            Y   H  K         V L+MEY   G L   +  R    D +  + V     Q+   
Sbjct: 171 LYGYFHDEK--------RVYLVMEYLVNGELYKHLKGRNHFSDEVASYYVY----QMAGA 218

Query: 144 ILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFG------------SVCGVIRPPKNTY 191
           +  MH  +  ++HRDIK EN++I  N   K+ DFG            ++CG         
Sbjct: 219 LDYMH--ERNILHRDIKPENIIIGFNNVIKLTDFGWSVINSKGFKRKTLCG--------- 267

Query: 192 ELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGE- 250
                        T  Y +PE+I   +    DEK D+WALGV  Y+L   + PFE+  + 
Sbjct: 268 -------------TVDYLSPELI---KSREYDEKVDVWALGVLTYELLVGSPPFEEESKE 311

Query: 251 ---VAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQP 302
                ILK N  FP +     R  +LI+ +L  +P +R     V      ++ QP
Sbjct: 312 LTYKRILKRNLVFPDHIDPDAR--HLISRLLEYDPANRIALKDVRGHSWILKNQP 364

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 111/241 (46%), Gaps = 49/241 (20%)

Query: 104 VVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIEN 163
           V + +EYC    L  ++   ++ R+   E   + +Q+V  +   H+++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 164 VLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNT--TAQYRAPEMIDL--YRG 219
           +L+ + G  K+ DFG            +        IL+    T  Y APE+I+   Y G
Sbjct: 159 ILLDKKGQAKLTDFG------------FTRECATKGILETVCGTTVYMAPELIERKPYEG 206

Query: 220 FSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQF-PSYPQYSNRL-----KNL 273
           + +    D W+LG+ LY + +   PF++  ++   K  ++   + P Y +       K+L
Sbjct: 207 YKI----DTWSLGIILYTMIHGAMPFDEEDDI---KTKYRIVNNEPFYDDNFIDANGKDL 259

Query: 274 ITVMLAENPIHRPNSCQVL----------------EEVCRIQGQPCPVKNFYLERSLKQQ 317
           I  +L ++P  RP+  QVL                ++  + Q Q C   +  LER L ++
Sbjct: 260 IMQLLQKDPSQRPSLTQVLQHPFMFPHGSSILEKTDKTIKRQSQGCKHFHSKLERRLLKK 319

Query: 318 I 318
           +
Sbjct: 320 L 320

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 114/258 (44%), Gaps = 47/258 (18%)

Query: 35  QIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASK 94
           QIY  +V++ DS   +V  ++R              EV  +  L+   +I  Y  S+   
Sbjct: 61  QIYAIKVLNLDSDEDEVEDVQR--------------EVQFLSSLKQIPNITRYYGSYLKD 106

Query: 95  SVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPL 154
           + L        ++MEYC+ G L S +      ++ E  +  IM +++  +  +H  +  +
Sbjct: 107 TSL-------WIIMEYCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKYIH--KDNV 154

Query: 155 IHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI 214
           IHRDIK  NVLI   G  K+CDFG    + +        S ++   +   T  + APE+I
Sbjct: 155 IHRDIKAANVLITNEGSVKLCDFGVAAQLNQ--------STLRRQTMAG-TPYWMAPEVI 205

Query: 215 DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA-NFQFPSYP------QYS 267
               G   D K DIW+LG+  Y++     P+    EV  L+A      S P       Y+
Sbjct: 206 --MEGVYYDTKVDIWSLGITAYEIATGNPPY---CEVEALRAMQLITKSKPPRLESRSYT 260

Query: 268 NRLKNLITVMLAENPIHR 285
             LK  I + L E+P  R
Sbjct: 261 PLLKEFIALCLDEDPKER 278

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 107/234 (45%), Gaps = 40/234 (17%)

Query: 71  EVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKE 130
           E+  MKLL  + +++   D   +KS L        +++EY  +G L + +  R    L E
Sbjct: 89  EIIIMKLL-NHTNVLRLYDVWETKSNL-------YMVLEYVEKGELFNLLVER--GPLPE 138

Query: 131 FEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNT 190
            E +R   Q++ GI   HAL   ++HRD+K EN+L+    + K+ DFG            
Sbjct: 139 NEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA--------- 187

Query: 191 YELSYVQHDILKNTTA---QYRAPEMIDL--YRGFSVDEKSDIWALGVFLYKLCYYTTPF 245
                   D L  T+     Y APE++    Y GF    +SD+W+ GV LY L     PF
Sbjct: 188 ----LESKDKLLETSCGSPHYAAPEIVSGLPYHGF----ESDVWSCGVILYALLTGRLPF 239

Query: 246 -EKTGEVAIL-----KANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLE 293
            E  G +  L        ++ P   + S+  ++LI  +L  +P  R  + ++L+
Sbjct: 240 DEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILK 293

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 131/298 (43%), Gaps = 59/298 (19%)

Query: 9   FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTL 68
           F    +  VG++K+  +K +  G F ++Y         KV    CLK     DK   N +
Sbjct: 30  FTSDELTEVGNYKI--LKQIGEGSFGKVYLALHRPTHRKV----CLK---TSDKNDPNIV 80

Query: 69  RAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRL 128
           R      ++    +    YI       V  +   +V + +EYC    L  + +     R+
Sbjct: 81  R------EVFYHRQFDFPYITKLYEVIVTES---KVWMALEYCPGKEL--YDHLLSLRRI 129

Query: 129 KEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPK 188
              E   +  Q+   +   H++    +HRD+K+EN+L+ +NG+ K+ DFG          
Sbjct: 130 SLLECGELFAQISGAVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG---------- 177

Query: 189 NTYELSYVQHDILKNT------TAQYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCY 240
                 + +  + K T      T  Y APE+I+   Y GF +    DIW+LGV LY L  
Sbjct: 178 ------FTRECMTKTTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLIT 227

Query: 241 YTTPFEKTGEVAILKANFQFPS-YPQYSNRL-----KNLITVMLAENPIHRPNSCQVL 292
              PF+   E    K  ++  +  P+Y  ++     ++LI+ +LA+NP  RP+  QVL
Sbjct: 228 GYLPFDDDDEA---KTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 131/283 (46%), Gaps = 35/283 (12%)

Query: 14  VLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVD 73
           V+  G +  K  + L  G ++ +     I  + K   V  L + ++  ++ +  +  E +
Sbjct: 147 VIKKGINDFKFGETLGDGSYSTVLLATSIESNKKYA-VKILNKEYLIKQKKVKYVNIEKN 205

Query: 74  AMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEV 133
            ++ L+  K I+S   +   +S L         L+EY   G L+S M  R    + E   
Sbjct: 206 TLQRLKNTKGIISLYFTFQDESSL-------YFLLEYAPNGDLLSLM--RKHGSVNEKCT 256

Query: 134 LRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYEL 193
                Q++  +  MH     +IHRD+K EN+L+  +   K+ DFG+     R   +T E 
Sbjct: 257 QYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTA----RLLDSTSE- 309

Query: 194 SYVQHDILKNT-----TAQYRAPEMI-DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEK 247
             +++D+L  +     TA+Y +PE++ D Y    VD + DIWA G  L+++     PF+ 
Sbjct: 310 DDLKYDLLTRSNSFVGTAEYVSPELLNDNY----VDFRCDIWAFGCILFQMIAGKPPFKA 365

Query: 248 TGEV----AILKANFQFPS-YPQYSNRLKNLITVMLAENPIHR 285
             E      ++K  F F + +P     +++L+  +L +NP  R
Sbjct: 366 NNEYLTFQKVMKVQFAFTAGFPM---TVRDLVKNILIKNPERR 405

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 96/201 (47%), Gaps = 26/201 (12%)

Query: 101 SYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIK 160
           S ++ +++EY  +G L + +  R    L E E +R   Q++ GI   HAL   ++HRD+K
Sbjct: 98  SKDLYMVLEYVEKGELFNLLVER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLK 153

Query: 161 IENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDL--YR 218
            EN+L+    + K+ DFG     +       E S          +  Y APE++    Y 
Sbjct: 154 PENLLLDHKFNVKLADFG--MAALESKDKLLETSC--------GSPHYAAPEIVSGLPYH 203

Query: 219 GFSVDEKSDIWALGVFLYKLCYYTTPF-EKTGEV-----AILKANFQFPSYPQYSNRLKN 272
           GF    +SD+W+ GV LY L     PF E+ G +      +    F+ P   + S+  ++
Sbjct: 204 GF----ESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQD 259

Query: 273 LITVMLAENPIHRPNSCQVLE 293
           LI  +L  +P  R  + ++L+
Sbjct: 260 LIARILTVDPEQRIKTREILK 280

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 135/295 (45%), Gaps = 44/295 (14%)

Query: 11  PGTVLTVGSH--KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTL 68
           P + L  G+H    ++VK L  G F ++      +   KV      K+V +        +
Sbjct: 42  PKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKV-LAKSDMQGRI 100

Query: 69  RAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRL 128
             E+  ++LLR + HI+   D   SK        E+++++EY     L  ++  R  D++
Sbjct: 101 EREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAG-NELFDYIVQR--DKM 149

Query: 129 KEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPK 188
            E E  R   Q++  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG          
Sbjct: 150 SEQEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG---------- 197

Query: 189 NTYELSYVQHD--ILKNT--TAQYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYT 242
               LS +  D   LK +  +  Y APE+I   LY G  V    D+W+ GV LY +    
Sbjct: 198 ----LSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCRR 249

Query: 243 TPFEKTGEVAILKANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEE 294
            PF+    + +L  N     Y  P++ S     LI  ML  NP++R +  +++++
Sbjct: 250 LPFDDES-IPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQD 303

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 99/192 (51%), Gaps = 21/192 (10%)

Query: 104 VVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIEN 163
           +  L+EY S G L++ +  +      E   +    Q++  I  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPEN 389

Query: 164 VLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNT-----TAQYRAPEMI-DLY 217
           +L+ ++   K+ DFG+   ++ P + +   S    ++L+ +     TA+Y +PE++ D Y
Sbjct: 390 ILLTKDFKIKLTDFGT-AKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY 448

Query: 218 RGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV----AILKANFQFPSYPQYSNRLKNL 273
                D + DIWA G  L++L     PF+ T E      I+K  + F +   +   L++L
Sbjct: 449 ----TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTA--GFPTILRDL 502

Query: 274 ITVMLAENPIHR 285
           I  +L +NP +R
Sbjct: 503 IKKILIKNPNNR 514

>TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {ON}
           Anc_8.140 YGL179C
          Length = 1130

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 88/322 (27%), Positives = 139/322 (43%), Gaps = 78/322 (24%)

Query: 82  KHIVSYIDSHASKSVLNN-GSYEVVLLMEYCSRGG-----------------LISFMNTR 123
           KH+V  I+      VL++  S ++ L++EYCS+G                  L++F  TR
Sbjct: 182 KHVVELIE------VLDDFKSRKIYLVLEYCSKGEVKWCPGDQMETEARGPPLLTFQRTR 235

Query: 124 LQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGV 183
                   E+LR    VV G+  +H     +IHRDIK  N+LI+E+   K+ DFG     
Sbjct: 236 --------EILR---GVVLGLEYLHYQG--VIHRDIKPANLLISEDNTVKISDFGVSLAA 282

Query: 184 IRPPKNTYELSYVQHDILKNT-TAQYRAPEMI--------------DLYRGFSVDEKSDI 228
                     S  + ++ K   T  + APE+               DL++G S+    DI
Sbjct: 283 TGAEDADNIESDDELELAKTAGTPAFFAPEICLGNEAFEKYQLKREDLFKGSSISFMIDI 342

Query: 229 WALGVFLYKLCYYTTPFEKTGEVA----ILKANFQFPSYPQY-SNRLK------------ 271
           WALGV LY L +   PF    E+     I+    +FPSY +   NR+             
Sbjct: 343 WALGVTLYCLLFGMLPFISDYELELFEKIVNDPVKFPSYEEVKGNRVSMLSSEEEYNMAL 402

Query: 272 NLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVKNF-YLERSLKQQIPSQLRHSVSQPM 330
           +L+  +L +NP+ R         +  I+  P    +F +L  +    I S+LR  V +  
Sbjct: 403 DLVNRLLEKNPMKRIT-------IAEIKQHPFACWDFDHLASTEDDYIDSKLRE-VKEFQ 454

Query: 331 IAMNPQQAKIPIVIPQVQNSVL 352
           +    Q  +I I   +++N+VL
Sbjct: 455 LDKEEQFKQISISRHELKNAVL 476

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 115/262 (43%), Gaps = 33/262 (12%)

Query: 104 VVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIEN 163
           + L MEYC  G     + TR   R+ E +     ++VV  +  +H L    I+RD+K EN
Sbjct: 393 LYLCMEYCMGGEFFRALQTRKSKRITEEDAKFYASEVVAALEYLHLLG--FIYRDLKPEN 450

Query: 164 VLIAENGDCKVCDFG---SVCGVIRPP--KNTYELSYVQHDILKNT----TAQYRAPEMI 214
           +L+ ++G   + DF       G   P    +TY  + V  D  +      T +Y APE+I
Sbjct: 451 ILLHQSGHVMLSDFDLSIQATGSRDPTMKDSTYLDTKVCSDGFRTNSFVGTEEYLAPEVI 510

Query: 215 DLYRGFSVDEKSDIWALGVFLYKLCYYTTPF--EKTGEV--AILKANFQFPSYPQYSNRL 270
              RG       D W LG+ +Y++ +  TPF  + + E    IL  + +FP   + S   
Sbjct: 511 ---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGDNSNETFSKILTEDVKFPHDKEISKHC 567

Query: 271 KNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVKNFYLERSLKQQIPSQLRHSVSQPM 330
           K+LI  +L +N   R  S     ++ R      P         L+ Q P         P+
Sbjct: 568 KDLIKRLLNKNESKRLGSKLGASDIKR-----HPFFKKVQWSFLRNQYP---------PL 613

Query: 331 I-AMNPQQAKIPIVIPQVQNSV 351
           I A+N    ++P+++   +NS 
Sbjct: 614 IPALNDDGCELPLILSSNKNST 635

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 91/363 (25%), Positives = 165/363 (45%), Gaps = 59/363 (16%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNK 82
           ++VK L  G F ++     I+   KV      K++ +        +  E+  ++LLR + 
Sbjct: 50  QIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKI-LAKSDMQGRIEREISYLRLLR-HP 107

Query: 83  HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
           HI+   D   SK        E+++++E+ S   L  ++  R  D++ E E  R   Q++ 
Sbjct: 108 HIIKLYDVIKSKD-------EIIIVIEFAS-NELFDYIIQR--DKMSENEARRFFQQIIS 157

Query: 143 GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD--I 200
            +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              LS +  D   
Sbjct: 158 AVEYCH--RHKIVHRDLKPENLLLDEDLNVKIADFG--------------LSNIMTDGNF 201

Query: 201 LKNT--TAQYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA 256
           LK +  +  Y APE+I   LY G  V    D+W+ GV LY +     PF+    + +L  
Sbjct: 202 LKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCRRLPFDDES-IPVLFK 256

Query: 257 NFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVKNFYLERS 313
           N     Y  P++ S    +LI  ML  NP++R +  +++++       P      YL   
Sbjct: 257 NISNGVYILPKFLSPGASSLIKRMLIVNPLNRISIHEIMQDEWFRVDLPE-----YL--- 308

Query: 314 LKQQIPSQLRHSVSQPMIAMNPQQ--AKIPIVIPQVQNSVLPSNTMNMGYVTGAFQPASQ 371
               IP++L+ + ++   + N ++  AK P    ++ N ++ + +  MGY       + +
Sbjct: 309 ----IPAELKKNDNKSEESRNGEERKAKQP---EEIDNDLVDALSRTMGYEKEEIYESLE 361

Query: 372 PNE 374
            NE
Sbjct: 362 SNE 364

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 131/276 (47%), Gaps = 46/276 (16%)

Query: 28  LTSGGFAQIYCCEVIS-PDSKVKDVAC--LKRVHVPDKQSLNTLR--AEVDAMKLLRGNK 82
           L  G F ++      S P+   K+VA   ++R  +P K S   ++   E++A+K L  + 
Sbjct: 71  LGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRRDTIP-KHSEKEVKIYREINALKHL-NHP 128

Query: 83  HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
           +IV        + VL N  Y + ++++Y S G    ++  +   RLKE    R+  Q++ 
Sbjct: 129 NIVRL------EEVLQNSKY-IGIVLQYASGGEFYKYIQKKR--RLKEPPACRLFAQLIS 179

Query: 143 GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILK 202
           G+  MH     L HRD+K+EN+L+ E+ +  + DFG V              + ++D++K
Sbjct: 180 GVYYMH--HKGLAHRDLKLENLLLDEHENLMITDFGFVN------------EFHKNDLMK 225

Query: 203 NTTAQ--YRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGE------VA-- 252
            +     Y APE++   R +    K+D+W+ GV LY +     P++   E      +A  
Sbjct: 226 TSCGSPCYAAPELVVTARPYEA-RKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKL 284

Query: 253 ---ILKANFQFPSYPQYSNRLKNLITVMLAENPIHR 285
              I K+  +FP Y +   R  +L+  +L  NP  R
Sbjct: 285 YHYITKSALKFPEYIKPLPR--DLLRRILVSNPDTR 318

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 135/295 (45%), Gaps = 44/295 (14%)

Query: 11  PGTVLTVGSH--KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTL 68
           P + L  G+H    ++VK L  G F ++      +   KV      K+V +        +
Sbjct: 42  PKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKV-LAKSDMQGRI 100

Query: 69  RAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRL 128
             E+  ++LLR + HI+   D   SK        E+++++EY     L  ++  R  D++
Sbjct: 101 EREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAG-NELFDYIVQR--DKM 149

Query: 129 KEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPK 188
            E E  R   Q++  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG          
Sbjct: 150 SEQEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG---------- 197

Query: 189 NTYELSYVQHD--ILKNT--TAQYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYT 242
               LS +  D   LK +  +  Y APE+I   LY G  V    D+W+ GV LY +    
Sbjct: 198 ----LSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCRR 249

Query: 243 TPFEKTGEVAILKANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEE 294
            PF+    + +L  N     Y  P++ S     LI  ML  NP++R +  +++++
Sbjct: 250 LPFDDES-IPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQD 303

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 126/296 (42%), Gaps = 47/296 (15%)

Query: 17  VGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMK 76
           +G  K  VV          +Y  +V++ DS              D+  +  ++ E+  + 
Sbjct: 41  IGRGKFGVVYKGYHLNTKHVYAIKVLNLDS--------------DEDEVEDVQKEIQFLA 86

Query: 77  LLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRI 136
            L+   +I  Y  S+     L N S  + ++MEYC  G L S +      ++ E  +  I
Sbjct: 87  SLKQLPNITRYYGSY-----LKNTS--LWIIMEYCGGGSLRSLLR---PGKIDEKYIGVI 136

Query: 137 MNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYV 196
           M +++  +  +H  +  +IHRDIK  NVLI  +G  K+CDFG    + +       ++  
Sbjct: 137 MREILIALKYIH--KDNVIHRDIKAANVLINNDGSIKLCDFGVAAQLNQTKSRRQTMA-- 192

Query: 197 QHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA 256
                   T  + APE+I    G   D K+DIW+ G+  Y++     P+    +V  L+A
Sbjct: 193 -------GTPYWMAPEVI--MEGVYYDTKADIWSTGITAYEVTTGNPPY---CDVEALRA 240

Query: 257 -NFQFPSYP------QYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPV 305
                 S P       YS  +K  I   L E+P  RP + ++L+       +P P 
Sbjct: 241 MQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLKTAFIKTYKPLPT 296

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 97/417 (23%), Positives = 184/417 (44%), Gaps = 81/417 (19%)

Query: 8   SFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSL-- 65
           S+ P +   + +H  ++VK L +G   ++     ++ D +   +  +K V+  +K++   
Sbjct: 80  SYDPVSKTQILNH-YEIVKELGNGQHGKVK----LAKDIRANQLVAIKMVNRYEKKTYFA 134

Query: 66  -------NTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNN-GSYEVVLLMEYCSRGGLI 117
                  N ++ E+  MK    NKH+V  I+      +L++  S ++ L++EYC +G ++
Sbjct: 135 GPKRNDPNKIKKEIAIMKKC-NNKHVVKLIE------ILDDLSSRKIYLVLEYCEKGPIL 187

Query: 118 SF------MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGD 171
                   +++R   +L       I   V+ G+  +H+    +IHRDIK  N+L+ +NG 
Sbjct: 188 WCPRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLHS--QGIIHRDIKPANLLMDKNGV 245

Query: 172 CKVCDFG---SVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI-------------- 214
            K+ DFG   +  G I    +  EL+          T  + APE+               
Sbjct: 246 VKISDFGVSLAANGNIDTNDDELELTKTV------GTPVFYAPEICLGAAAMERFNLDKD 299

Query: 215 DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV----AILKANFQFPSYPQYSN-- 268
           +L+ G  +  K DIWALG+ LY L +   PF    E+     I+    +FP++    +  
Sbjct: 300 ELFNGSCISFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNH 359

Query: 269 -----------RLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVKNFYLERSLKQ- 316
                        K+L+  +L +NP  R +       +  I+  P    +F   + L + 
Sbjct: 360 ISEISHIREFVHAKDLLNKLLEKNPAKRIS-------IPDIKVHPFVCWDFKHTKLLSED 412

Query: 317 QIPSQLR-HSVSQPMIAMNPQQAKIPIVIPQVQNSVLPSNTMNMGYVTGAFQPASQP 372
           Q+ S+L+ +S+ Q     + +Q  I I    + +++L  N  N  +  GA   +++P
Sbjct: 413 QLESKLKENSLFQSRQDKDFKQ--ILISNKDINSAILDINEGNFSFENGADDLSTKP 467

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 100/201 (49%), Gaps = 33/201 (16%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           +V + +EYC    L  ++   +  R+   E  R+  Q+V  +   H+L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 163 NVLIAENGDCKVCDFGSV--CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYR 218
           N+L+   G+ K+ DFG    C      KN       Q + +  TT  Y APE++  D Y 
Sbjct: 158 NILLDMQGNAKLADFGFTRECAT----KN-------QLETICGTTV-YMAPELLRRDTYD 205

Query: 219 GFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQ-FPSYPQYSNRLKN----- 272
           GF +    DIW+LGV LY L   + PF++  E    +  ++     P Y+ ++ N     
Sbjct: 206 GFKI----DIWSLGVILYTLINGSMPFDEEDET---RTEWKIINEEPDYNEKIFNANSIE 258

Query: 273 LITVMLAENPIHRPNSCQVLE 293
           LI  +L ++P  RP+  ++L+
Sbjct: 259 LIKSLLIKDPKKRPSMTEILK 279

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 131/283 (46%), Gaps = 42/283 (14%)

Query: 21  KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRG 80
           K +++K L  G F ++     ++   KV      K+V +        +  E+  ++LLR 
Sbjct: 30  KYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKV-LAKSDMQGRIEREISYLRLLR- 87

Query: 81  NKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQV 140
           + HI+   D   SK        E+V+++EY     L  ++  R  D++ E E  R   Q+
Sbjct: 88  HPHIIKLYDVVKSKD-------EIVMVIEYAG-NELFDYIVQR--DKMSENEARRFFQQI 137

Query: 141 VQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD- 199
           +  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              LS +  D 
Sbjct: 138 ISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG--------------LSNIMTDG 181

Query: 200 -ILKNT--TAQYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAIL 254
             L+ +  +  Y APE+I   LY G  V    D+W+ GV LY +     PF+    + +L
Sbjct: 182 NFLRTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVILYVMLCRRLPFDDES-IPVL 236

Query: 255 KANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEE 294
             N     Y  P++ S    NLI  ML  NP++R    +++++
Sbjct: 237 FKNISNGIYTLPKFLSPGAANLIKRMLIVNPLNRITIHEIMQD 279

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/207 (31%), Positives = 95/207 (45%), Gaps = 29/207 (14%)

Query: 103 EVVLLMEYCSRGGLISFM--NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIK 160
            V LLMEY   G L   +  N    D L  + V    NQ+   +  MH     ++HRDIK
Sbjct: 212 RVYLLMEYLVNGELYRHLRVNGPFNDILASYYV----NQMADALNYMHDRN--VLHRDIK 265

Query: 161 IENVLIAENGDCKVCDFG-SVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRG 219
            EN+LI      K+ DFG SV       + T              T  Y +PE++  YR 
Sbjct: 266 PENILIGFQNTLKLTDFGWSVISTTGAKRKTL-----------CGTLDYLSPELVK-YRE 313

Query: 220 FSVDEKSDIWALGVFLYKLCYYTTPFEKTGE----VAILKANFQFPSYPQYSNRLKNLIT 275
           +  DEK D+WALGV  Y+L   T PFE+  +      I++ + +FP   Q S   ++LI 
Sbjct: 314 Y--DEKVDVWALGVLAYELLVGTPPFEEASKELTYKRIVRRDLRFPD--QMSIDARDLIG 369

Query: 276 VMLAENPIHRPNSCQVLEEVCRIQGQP 302
            +L  +P  R +   VL     ++ +P
Sbjct: 370 RLLENDPSTRISLKDVLSHPWIVKNKP 396

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 98/200 (49%), Gaps = 37/200 (18%)

Query: 98  NNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHR 157
           NN  Y   L++EY  +G L + +  R    L E E ++   Q++  +   HAL   ++HR
Sbjct: 99  NNNLY---LILEYAEKGELFNLLVDR--GALPEREAMKCFRQIIIAVSYCHALG--IVHR 151

Query: 158 DIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD--ILKNT--TAQYRAPEM 213
           D+K EN+L+  + + KV DFG              ++ +Q D  +L+ +  +  Y APE+
Sbjct: 152 DLKPENLLLDSDYNIKVADFG--------------MAALQTDAALLETSCGSPHYAAPEI 197

Query: 214 IDL--YRGFSVDEKSDIWALGVFLYKLCYYTTPF-EKTGEVAIL-----KANFQFPSYPQ 265
           +    Y GFS    SD+W+ GV L+ L     PF E+ G +  L     +  F+ P   +
Sbjct: 198 VSGLPYEGFS----SDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTE 253

Query: 266 YSNRLKNLITVMLAENPIHR 285
            S   ++LI+ +L  +P  R
Sbjct: 254 ISKDAQDLISKILVVDPAQR 273

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 134/293 (45%), Gaps = 34/293 (11%)

Query: 6   QDSFQPGT------VLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVH 58
           Q+S  P T      V+  G    K  + L  G ++ +      S DS  K  V  L + +
Sbjct: 152 QESINPETGQKMRHVVKKGIKDFKFGEMLGDGAYSTVMLA--TSNDSGKKYAVKVLNKEY 209

Query: 59  VPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLIS 118
           +  ++ +  +  E  A++ L  ++ I+    +   ++ L         L+EY   G L+S
Sbjct: 210 LIRQKKVKYVNIEKLALQRLNNSRSIIRLFFTFQDEASL-------YFLLEYAPNGDLLS 262

Query: 119 FMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFG 178
            M  +    L E        Q++  I  MH+    +IHRDIK EN+L+ ++   K+ DFG
Sbjct: 263 LM--KKFGSLNEECCCYYGAQIIDAIKFMHS--KGIIHRDIKPENILLDKDMKVKITDFG 318

Query: 179 SVCGVI-RPPKNTYELSYVQHDILKNTTAQYRAPEMI-DLYRGFSVDEKSDIWALGVFLY 236
           +   +  +PP  +Y+L       +   TA+Y +PE++ D Y     D +SDIWA G  ++
Sbjct: 319 TAKILDNKPPGTSYDLLTRSKSFV--GTAEYVSPELLNDNY----TDARSDIWAFGCIVF 372

Query: 237 KLCYYTTPFEKTGEV----AILKANFQFPSYPQYSNRLKNLITVMLAENPIHR 285
           ++     PF+ T E      ++K  + F +   +   +++L+  +L + P  R
Sbjct: 373 QMIAGKPPFKATNEYLTFQKVMKVQYAFTA--GFPTVVRDLVKRILIKAPEQR 423

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 136/295 (46%), Gaps = 44/295 (14%)

Query: 11  PGTVLTVGSH--KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTL 68
           P + L  G+H    ++VK L  G F ++      +   KV      K+V +        +
Sbjct: 41  PKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKV-LAKSDMQGRI 99

Query: 69  RAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRL 128
             E+  ++LLR + HI+   D   SK        E+++++EY     L  ++  R  D++
Sbjct: 100 EREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAG-NELFDYIVQR--DKM 148

Query: 129 KEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPK 188
            E E  R   Q++  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG          
Sbjct: 149 SEDEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG---------- 196

Query: 189 NTYELSYVQHD--ILKNT--TAQYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYT 242
               LS +  D   LK +  +  Y APE+I   LY G  V    D+W+ GV LY +    
Sbjct: 197 ----LSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCRR 248

Query: 243 TPFEKTGEVAILKANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEE 294
            PF+    + +L  N     Y  P++ S    +LI  ML  NP++R +  +++++
Sbjct: 249 LPFDDES-IPVLFKNISNGVYSLPKFLSPGAASLIKRMLIVNPLNRISIHEIMQD 302

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 136/297 (45%), Gaps = 45/297 (15%)

Query: 9   FQPGTVLTVGSH-KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNT 67
           ++ G  L +GS  KV++    T+G  A I   +VIS      + A    +  PD      
Sbjct: 18  WKLGETLGLGSTGKVQLAHNKTTGKQAAI---KVISKSVFNNNSAQSSSLTTPDALPYGI 74

Query: 68  LRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDR 127
            R E+  MKLL  + +++   D   + S L        +++EY  +G L + +  +    
Sbjct: 75  ER-EIIIMKLL-NHPNVLRLYDVWETNSNL-------YMVLEYAEKGELFNLLVEK--GP 123

Query: 128 LKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPP 187
           L+E E +R   Q++ GI   HAL   ++HRD+K EN+L+    + K+ DFG         
Sbjct: 124 LQEQEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGMAA------ 175

Query: 188 KNTYELSYVQHDILKNTTA---QYRAPEMIDL--YRGFSVDEKSDIWALGVFLYKLCYYT 242
                      D L  T+     Y APE++    Y GF+    SD+W+ GV L+ L    
Sbjct: 176 -------LETEDKLLETSCGSPHYAAPEIVSGIPYHGFA----SDVWSCGVILFALLTGR 224

Query: 243 TPF-EKTGEVA--ILK---ANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLE 293
            PF E+ G +   +LK     F+ PS  + S+  ++L+  +L  +P  R  +  +L+
Sbjct: 225 LPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILK 281

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 135/295 (45%), Gaps = 44/295 (14%)

Query: 11  PGTVLTVGSH--KVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTL 68
           P + L  G+H    ++VK L  G F ++      +   KV      K+V +        +
Sbjct: 43  PKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKV-LAKSDMQGRI 101

Query: 69  RAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRL 128
             E+  ++LLR + HI+   D   SK        E+++++EY     L  ++  R  D++
Sbjct: 102 EREISYLRLLR-HPHIIKLYDVIKSKD-------EIIMVIEYAG-NELFDYIVQR--DKM 150

Query: 129 KEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPK 188
            E E  R   Q++  +   H  +  ++HRD+K EN+L+ E+ + K+ DFG          
Sbjct: 151 SEQEARRFFQQIISAVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG---------- 198

Query: 189 NTYELSYVQHD--ILKNT--TAQYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYT 242
               LS +  D   LK +  +  Y APE+I   LY G  V    D+W+ GV LY +    
Sbjct: 199 ----LSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCRR 250

Query: 243 TPFEKTGEVAILKANFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEE 294
            PF+    + +L  N     Y  P++ S     LI  ML  NP++R +  +++++
Sbjct: 251 LPFDDES-IPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQD 304

>KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {ON}
           Anc_6.262 YPL236C
          Length = 366

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/339 (22%), Positives = 145/339 (42%), Gaps = 63/339 (18%)

Query: 13  TVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVA----CLKRVHVP--DKQSLN 66
           T++TV + K +VV+ L     +  Y  E  SP S   + A     +K +  P  D  +++
Sbjct: 26  TLITVNARKYQVVRLLGEKSLSFTYLVERTSPTSDASNDATRLFAMKVISCPFGDIDTIS 85

Query: 67  TLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQD 126
               E++  K    + HI++   S  S+ +  +GS  +++L+ Y   G L   ++  L D
Sbjct: 86  NALQEIELYKYFH-SAHIINLYGSQVSQEL--DGSRTILILLPYYPLGSLQDMIDRNLLD 142

Query: 127 --RLKEFEVLRIMNQVVQGILAMH------------------------------------ 148
              + E + ++IM  + +G+  +H                                    
Sbjct: 143 GSTVSESQCIKIMVSLCKGLDILHNSSSRAVGNMKASFDSVSITVSDDAASLLADTPLEL 202

Query: 149 ALQPPLIHRD-------IKIENVLIAENGDCKVCDFGSVCGVIR-PPKNTYELSYVQHDI 200
           A+  P  + +       +    VL   +G   + D  S+C  ++     + +L   +  I
Sbjct: 203 AVMSPTNYTEESFALLNMSPTTVLFRSDGTPLIGDL-SICSKVKFEITESADLLAFKERI 261

Query: 201 LKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV-------AI 253
            +N +  Y APE++ L +G  + ++ DIW+LG  LY L Y  +PFE+  ++       AI
Sbjct: 262 QENCSLPYLAPELVSLKKGSLITKEVDIWSLGAILYFLMYGVSPFEREEQLNGTPIKYAI 321

Query: 254 LKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVL 292
            K  + FP   +YS+ L ++I   L  +P  R +  Q++
Sbjct: 322 KKGQYSFPQESEYSSSLNDIIISCLQVDPSMRSSPIQLI 360

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 81/153 (52%), Gaps = 19/153 (12%)

Query: 96  VLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLI 155
           VL N  Y + +++EY S G    ++  + + RLKE    R+  Q++ G+  MH+    L+
Sbjct: 121 VLQNSKY-IGIVLEYASGGEFYKYI--QRKRRLKESTACRLFAQLISGVTYMHSKN--LV 175

Query: 156 HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQ--YRAPEM 213
           HRD+K+EN+L+ +N +  + DFG V   +  P N Y         +K +     Y APE+
Sbjct: 176 HRDLKLENLLLDKNENLVITDFGFVNEFL--PDNEY---------MKTSCGSPCYAAPEL 224

Query: 214 IDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFE 246
           +   R + V  K+D+W+ G+ LY +     P++
Sbjct: 225 VISTRPY-VARKADVWSCGIILYAMLAGYLPWD 256

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/321 (23%), Positives = 141/321 (43%), Gaps = 66/321 (20%)

Query: 15  LTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKD----------VACLKRVHVPDKQS 64
           +T+G     + K +  G FA ++   ++    ++KD          +  + R  + +K+ 
Sbjct: 30  ITIGPDTYMIDKEIGKGSFATVHRAHLLR--KQIKDDLTSPPLNFAIKIVSRSKLKNKKL 87

Query: 65  LNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRL 124
           L  L  E+  +K +  + HIV  ID   + +       +  L+MEYC+ G L +F+  + 
Sbjct: 88  LENLEIEIAILKKI-NHPHIVKLIDCERTTT-------DFYLIMEYCALGDL-TFLIKKR 138

Query: 125 QDRLKEFEVLR--------------------IMNQVVQGILAMHALQPP-LIHRDIKIEN 163
            + +K   +L                     I+N + Q   A+  L+   L+HRDIK +N
Sbjct: 139 HELIKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRSKNLVHRDIKPQN 198

Query: 164 VLI----AENGDCKVCDFGSVCGVIR-PPKNTYELSYVQHDILKNTTAQ--------YRA 210
           +L+        D K        G+   P     +  + +   L NT+          Y A
Sbjct: 199 LLLLTPLINYNDSKAFKKLGFIGIYELPILKIADFGFAR--FLPNTSMAETLCGSPLYMA 256

Query: 211 PEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA------NFQFPSYP 264
           PE+++ Y+ ++   K+D+W++G  LY++CY T PF+ +  + + K          FP+Y 
Sbjct: 257 PEILN-YQKYNA--KADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNYI 313

Query: 265 QYSNRLKNLITVMLAENPIHR 285
           Q  N +K LI+ +L  +P  R
Sbjct: 314 QIQNDMKILISKLLTFDPQRR 334

>Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON}
            similar to Ashbya gossypii AFR092W
          Length = 1397

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 110/237 (46%), Gaps = 35/237 (14%)

Query: 31   GGFAQIYCCEVISPDSKVKDVACLKRVHVP-----DKQSLNTLRAEVDAMKLLRGNKH-- 83
            G F  +Y    ++      ++  +K+V VP     D+ ++  + A +  +  L+   H  
Sbjct: 1107 GSFGAVYLGLNVT----TGEMMAVKQVEVPKFGSQDQITVTNVEALISEVSTLKNLDHLN 1162

Query: 84   IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQG 143
            IV Y+          NG Y   L +EY + G + S +  RL     E  +  +  QV++G
Sbjct: 1163 IVQYLGFEN-----KNGIYS--LFLEYVAGGSVGSLI--RLYGHFDEQLIRFLTKQVLEG 1213

Query: 144  ILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKN 203
            +  +H  +  ++HRD+K +N+L+  NG CK+ D     G+ R   N Y       ++   
Sbjct: 1214 LAYLH--RRGILHRDMKADNLLLDNNGVCKISDL----GISRKSNNIYS----NAEMTMR 1263

Query: 204  TTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANFQF 260
             T  + APEM+D  +G+S   K DIW+LG  + ++     P+     + ++ A FQ 
Sbjct: 1264 GTVFWMAPEMVDTTQGYSA--KVDIWSLGCVVLEMFAGKRPW---SNLEVVAAMFQI 1315

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 113/247 (45%), Gaps = 28/247 (11%)

Query: 51  VACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEY 110
           V  +K V   + + LN + AE+  +K L  N +IV Y   H         SYE+ +L+EY
Sbjct: 50  VVAIKEVVYENDEELNDIMAEISLLKNLNHN-NIVKY---HG----FIRKSYELYILLEY 101

Query: 111 CSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENG 170
           C+ G L   + +R    L E E    + Q + G+  +H     +IHRDIK  N+L++ + 
Sbjct: 102 CANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADN 158

Query: 171 DCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWA 230
             K+ DFG V  ++     T              T  + APE++   RG S    SDIW+
Sbjct: 159 TVKLADFG-VSTIVNSSALTLA-----------GTLNWMAPEILG-NRGAST--LSDIWS 203

Query: 231 LGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYP--QYSNRLKNLITVMLAENPIHRPNS 288
           LG  + ++     P+    +  I  A      YP   +S  LK+ ++    +N   RP +
Sbjct: 204 LGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTA 263

Query: 289 CQVLEEV 295
            Q+L+ V
Sbjct: 264 DQLLKHV 270

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/248 (28%), Positives = 113/248 (45%), Gaps = 30/248 (12%)

Query: 51  VACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKH-IVSYIDSHASKSVLNNGSYEVVLLME 109
           V  +K +   + + LN + AE+  +K L  N H IV Y   H         SYE+ +L+E
Sbjct: 50  VVAIKEIVYENDEELNDIMAEISLLKNL--NHHNIVKY---HG----FIRKSYELYILLE 100

Query: 110 YCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAEN 169
           YC+ G L   + +R    L E E    + Q + G+  +H     +IHRDIK  N+L++ +
Sbjct: 101 YCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSAD 157

Query: 170 GDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIW 229
              K+ DFG V  ++     T              T  + APE++   RG S    SDIW
Sbjct: 158 NTVKLADFG-VSTIVNSSALTLA-----------GTLNWMAPEILG-NRGAST--LSDIW 202

Query: 230 ALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYP--QYSNRLKNLITVMLAENPIHRPN 287
           +LG  + ++     P+    +  I  A      YP   +S  LK+ ++    +N   RP 
Sbjct: 203 SLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPT 262

Query: 288 SCQVLEEV 295
           + Q+L+ V
Sbjct: 263 ADQLLKHV 270

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 117/266 (43%), Gaps = 47/266 (17%)

Query: 35  QIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASK 94
           QIY  +V++ DS   +V  ++R              E+  +  L+   +I  Y  S+   
Sbjct: 66  QIYAIKVLNLDSDEDEVEDVQR--------------EIQFLASLKQLPNITRYYGSYLKD 111

Query: 95  SVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPL 154
           + L        ++MEYC+ G L + +      ++ E  +  I  +++  +  +H  +  +
Sbjct: 112 TSL-------WIIMEYCAGGSLRTLLR---PGKIDEKYIGVITREILIALKYIH--KDNI 159

Query: 155 IHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI 214
           IHRDIK  NVLI   G  K+CDFG    + +  K    ++          T  + APE+I
Sbjct: 160 IHRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKRRQTMA---------GTPYWMAPEVI 210

Query: 215 DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA-NFQFPSYP------QYS 267
               G   D K DIW+LG+  Y++     P+    E+  L+A      S P       YS
Sbjct: 211 --MEGVYYDTKVDIWSLGITTYEIATGNPPY---CEIEALRAMQLITKSKPPRLEGRNYS 265

Query: 268 NRLKNLITVMLAENPIHRPNSCQVLE 293
             LK  + + L E+P  R ++  +L+
Sbjct: 266 PLLKEFVALCLDEDPKERMSAEDLLK 291

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 102/233 (43%), Gaps = 29/233 (12%)

Query: 63   QSLNTLRAEVDAMKLLRGNKH--IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM 120
            + L T+ +E+  M  L    H  I+  +D         +  Y  +    + + G +  F 
Sbjct: 1008 RKLGTIPSEIQIMATLNTKPHENILMLLD------FFEDDEYYYIETPIHGTSGSVDLFD 1061

Query: 121  NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV 180
               L+  + E E   I  Q+V GI  +H     ++HRDIK ENV++  NG  K+ DFGS 
Sbjct: 1062 LIELKTDMTEHEAKLIFKQIVSGIKHLH--DNGIVHRDIKDENVIVDSNGFVKIIDFGSA 1119

Query: 181  CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLYKL 238
              V   P + +             T  Y APE++  + Y G    +  DIWA+GV LY +
Sbjct: 1120 AYVKSGPFDVFV-----------GTIDYAAPEVLGGEPYEG----KPQDIWAIGVLLYTI 1164

Query: 239  CYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQV 291
             +   PF    E  IL A+ +  S  + S+    LI  +L      RP+  ++
Sbjct: 1165 IFKENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 130/307 (42%), Gaps = 63/307 (20%)

Query: 45  DSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEV 104
           D  V+ + C       D +S++    E+D  +  + + +I+  +DS   +    +GS  V
Sbjct: 85  DMVVRQIMC----PFGDIESVSNALKEIDNYRYFK-SPYIMQCLDSQVIQR--RDGSKTV 137

Query: 105 VLLMEYCSRGGLISFMNTRLQD--RLKEFEVLRIMNQVVQGILAMH----------ALQP 152
           ++L+ Y   G L   ++  L D  R+ E EV+R+M    +G+L +H          ++ P
Sbjct: 138 LILLPYLPLGSLRDAIDRNLLDGIRMSESEVIRVMIGTCRGLLYLHDPTSRGNLGSSMGP 197

Query: 153 -------------------------------------PLIHRDIKIENVLIAENGDCKVC 175
                                                   H +IK  N+L + +G   + 
Sbjct: 198 QNGMDAVSMTLSDDAAMLLDGTPFEMDMLSSHSMKMDSYAHMNIKPSNILFSSDGLPVIT 257

Query: 176 DFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFL 235
           + GS+  +    +N   L  ++    ++ T  Y  PE+++L  G  +D   DIW+LG  L
Sbjct: 258 ELGSLQKLDLKIENVKMLKSIKEWTEEHCTVYYMPPELLNLKVGTVLDCSVDIWSLGCTL 317

Query: 236 YKLCYYTTPFEKTGEV-------AILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNS 288
           Y L +  +PF++  +V        I KA + FP    YS +L ++I   L  NP  RP  
Sbjct: 318 YTLLFGISPFKREEQVNEVPLKYGISKARYSFPEGHVYSKKLVSVIETCLQVNPTMRPTV 377

Query: 289 CQVLEEV 295
            ++L ++
Sbjct: 378 NELLGQL 384

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 104/209 (49%), Gaps = 32/209 (15%)

Query: 96  VLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLI 155
           VL N  Y + +++EY S G    ++  +   RLKE    R+  Q+V G+  MH+    L+
Sbjct: 117 VLQNSKY-IGIVLEYASGGEFYRYIQRKR--RLKETAGCRLFTQLVSGVNYMHS--KGLV 171

Query: 156 HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQ--YRAPEM 213
           HRD+K+EN+L+ ++ +  + DFG V   ++            +D++K +     Y APE+
Sbjct: 172 HRDLKLENLLLDKHENLVITDFGFVNEFLK-----------DNDLMKTSCGSPCYAAPEL 220

Query: 214 IDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFE------KTGEVA-----ILKANFQFPS 262
           +   + +    K+DIW+ G+ LY +     P++      +  ++A     I + + +FP 
Sbjct: 221 VISTKPYEA-RKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSLKFPE 279

Query: 263 YPQYSNRLKNLITVMLAENPIHRPNSCQV 291
           Y   S   ++L+  +L  +P  R N  Q+
Sbjct: 280 Y--ISPIPRDLLRRLLVSDPRKRLNIRQI 306

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 95/207 (45%), Gaps = 47/207 (22%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           +V +  EYC    L   +   LQ R+     + +  Q+V  +   H+L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 163 NVLIAENGDCKVCDFG------------SVCGVIRPPKNTYELSYVQHDILKNTTAQYRA 210
           N+L+ +NG+ K+ DFG            ++CG                      T  Y A
Sbjct: 159 NILLDKNGNAKLTDFGFTRECMTKTSLETICG----------------------TTVYMA 196

Query: 211 PEMI--DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAI-LKANFQFPSYPQ-- 265
           PE+I  + Y GF +    DIW+LGV LY +   + PF++  E     K   + P +    
Sbjct: 197 PELIKRESYDGFKI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTI 252

Query: 266 YSNRLKNLITVMLAENPIHRPNSCQVL 292
            S   K+L+  +L+++P  RP+  ++L
Sbjct: 253 LSEDAKDLLIKLLSKDPNERPSMQEIL 279

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 138/298 (46%), Gaps = 50/298 (16%)

Query: 26  KYLTSGGFAQIY-CCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNKHI 84
           K +  G FA +Y       P+ K+  V  + +  + +K+ L  L  E+  +K L  +KHI
Sbjct: 136 KEIGKGSFAVVYRGYSNEDPNFKLA-VKSVPKSKLKNKKILENLEIEISILKKL-NHKHI 193

Query: 85  VSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTR---------LQDRLKEF---- 131
           V+ ID   +K+       + +L+MEYCS G L   +  R         L    ++F    
Sbjct: 194 VNLIDCQRNKN-------DFLLIMEYCSLGDLTFLIKKRNELIINHPLLNQIFQKFPSPN 246

Query: 132 ------EVLRIMNQVVQGILAMHALQPP-LIHRDIKIENVLIA--------ENGDCKVCD 176
                  +  ++N + Q   A+  L+   LIHRDIK +N+L++        +    K+  
Sbjct: 247 PDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYTDYHDQQTFKKLGY 306

Query: 177 FGSVCGVIRPPKNTYELSYVQHDILKNT---TAQYRAPEMIDLYRGFSVDEKSDIWALGV 233
            G  C  I    +     ++ +  L  T   +  Y APE+++ Y+ ++   K+D+W++G 
Sbjct: 307 IGISCLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILN-YQKYNA--KADLWSVGT 363

Query: 234 FLYKLCYYTTPFEKTGEVAILKA------NFQFPSYPQYSNRLKNLITVMLAENPIHR 285
            LY++ Y   PF+    + +LK       N  FPSY +  + +K LI+ +L  +PI R
Sbjct: 364 VLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKFDPIKR 421

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 110/234 (47%), Gaps = 34/234 (14%)

Query: 68  LRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDR 127
           +  E+  MKLLR + +++S  D   + S L        +++EY  +G L + +  R    
Sbjct: 77  IEREIIIMKLLR-HPNVLSLYDVWETNSKL-------YMILEYAEKGELFNLLVER--GP 126

Query: 128 LKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPP 187
           L E E +R   Q++ GI   HAL   ++HRD+K EN+L+    + K+ DFG     +   
Sbjct: 127 LPEKEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKLNIKIADFG--MAALETK 182

Query: 188 KNTYELSYVQHDILKNTTAQYRAPEMIDL--YRGFSVDEKSDIWALGVFLYKLCYYTTPF 245
               E S          +  Y APE++    Y GF    +SD+W+ GV L+ L     PF
Sbjct: 183 DKMLETSC--------GSPHYAAPEIVSGVPYHGF----QSDVWSCGVILFALLTGRLPF 230

Query: 246 -EKTGEVA--ILK---ANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLE 293
            E+ G +   +LK     ++ P   + S   ++LI  +L  +P  R  +  +L+
Sbjct: 231 DEEDGNIRNLLLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILK 284

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 88/181 (48%), Gaps = 30/181 (16%)

Query: 96  VLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLI 155
           VL N  Y + +++EY S G    ++  +   RLKE    R+  Q++ G+  MH+    L+
Sbjct: 113 VLQNSKY-IGIVLEYASGGEFYKYIQKKR--RLKEGPACRLFAQLISGVYYMHSKG--LV 167

Query: 156 HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQ--YRAPEM 213
           HRD+K+EN+L+ +N +  + DFG V   +  P+N         +++K +     Y APE+
Sbjct: 168 HRDLKLENLLLDKNENLLITDFGFVNEFL--PEN---------ELMKTSCGSPCYAAPEL 216

Query: 214 IDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGE-----------VAILKANFQFPS 262
           +   R +    K+D+W+ GV LY +     P++   E             I +   +FP 
Sbjct: 217 VVTARPYEA-RKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPD 275

Query: 263 Y 263
           Y
Sbjct: 276 Y 276

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 121/246 (49%), Gaps = 37/246 (15%)

Query: 62  KQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMN 121
           K+S   L  E++A+K+L  + +IV        + VL N  Y + +++EY S G    ++ 
Sbjct: 117 KESEIKLYREINALKML-THPNIVKL------EEVLQNSKY-IGIVLEYASGGEFYKYI- 167

Query: 122 TRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVC 181
            + + RLKE +   I  Q++ G+  +H+    L+HRD+K+EN+L+ + G+  + DFG V 
Sbjct: 168 -KFKKRLKESKACTIFAQLISGVSYIHS--KGLVHRDLKLENLLLDKAGNLLITDFGFVN 224

Query: 182 GVIRPPKNTYELSYVQHDILKNT---TAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKL 238
            V +  K            L +T   +  Y APE++     ++   K+DIW+ GV LY +
Sbjct: 225 EVTKTNK------------LMHTPCGSPCYAAPELVTSVEPYNA-RKADIWSCGVILYAM 271

Query: 239 CYYTTPFEK-------TGEVAILKANFQFP-SYPQYSNRL-KNLITVMLAENPIHRPNSC 289
                P++        T  V + K     P  +P+Y N + ++L+  ML  +P  R +  
Sbjct: 272 LAGYLPWDDDPKNINGTDIVKLYKYIENQPLKFPEYINMVPRDLLRRMLEIDPAKRMSMK 331

Query: 290 QVLEEV 295
            +L+  
Sbjct: 332 HILQHA 337

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 122/248 (49%), Gaps = 27/248 (10%)

Query: 50  DVACLKRVHVPDKQS-LNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLM 108
           +V  +K +++ + Q  ++ L  E+  +  LR    + +Y      K+ + + S  +V  M
Sbjct: 63  EVVAIKIINLEETQDDIDVLAQEIYFLSELRA-PFVTTYF-----KTFVEDVSMWIV--M 114

Query: 109 EYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAE 168
           E+C  G     +    + RL E +V  I+ +V+ G+  +H+ +   IHRDIK  N+L+ +
Sbjct: 115 EFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAANILLTD 172

Query: 169 NGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDI 228
           +G+ K+ DFG    ++   K T   ++V        T  + APE+I   +    +EK+DI
Sbjct: 173 DGEVKLGDFGVSGQIMATLKRT---TFV-------GTPYWMAPEII-AKKDNGYNEKADI 221

Query: 229 WALGVFLYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRL----KNLITVMLAENPIH 284
           W+LG+   +L     P+ K   + +L  N      P+   R     ++ I + L ++P  
Sbjct: 222 WSLGITAIELLTGQPPYAKHDPMKVL-VNIPLRKPPKLQGRFTGSARDFIALCLIKDPDL 280

Query: 285 RPNSCQVL 292
           RP++ ++L
Sbjct: 281 RPSAAELL 288

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 103/238 (43%), Gaps = 33/238 (13%)

Query: 63   QSLNTLRAEVDAMKLLRGNKH--IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM 120
            + L T+ +E+  M  L+   H  I+  +D         +  Y  +    +   G +  F 
Sbjct: 1110 RKLGTIPSEIQIMATLQKKPHENIMKLLD------FFEDDQYYYIESPMHGETGSIDLFD 1163

Query: 121  NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV 180
               L+  + E+E   +  Q+  G+  +H     ++HRDIK ENV++   G  K+ DFGS 
Sbjct: 1164 LIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVKLIDFGSA 1221

Query: 181  CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLYKL 238
              V R P + +             T  Y APE++  D Y G    +  DIWA+GV LY +
Sbjct: 1222 AYVKRGPFDVFV-----------GTIDYAAPEVLEGDPYEG----KPQDIWAIGVLLYTI 1266

Query: 239  CYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVC 296
             Y   PF    E  IL  + +       S     LIT++L  +   RP     ++++C
Sbjct: 1267 IYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRP----TVDDIC 1318

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 132/283 (46%), Gaps = 46/283 (16%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNK 82
           ++VK L  G F ++     ++   KV  +  + R  +        +  E+  ++LLR + 
Sbjct: 43  QIVKTLGEGSFGKVKLAFHVTTGQKVA-LKIINRKVLSKSDMQGRIEREIAYLRLLR-HP 100

Query: 83  HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
           HI+   D   SK        E+++++EY +   L  ++  R  D++ E E  +   Q++ 
Sbjct: 101 HIIRLYDVIKSKD-------EIIMIIEY-AHHELFDYIVQR--DKMSENEARKFFQQIIS 150

Query: 143 GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD--I 200
            +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              LS +  D   
Sbjct: 151 AVDYCH--RHMIVHRDLKPENLLLDEHYNVKITDFG--------------LSNIMTDGNF 194

Query: 201 LKNTTA--QYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA 256
           LK +     Y APE+I   LY G  V    D+W+ GV LY +     PF+    + IL  
Sbjct: 195 LKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCRRLPFDDES-IPILFK 249

Query: 257 N-----FQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEE 294
           N     +  P++   S+   +LI  ML  NPI+R +  +++++
Sbjct: 250 NISNGIYTLPNF--LSDGAASLIKKMLIVNPINRISISEIMQD 290

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 98/199 (49%), Gaps = 29/199 (14%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           +V + +EYC    L   +  RL  R+   E  R+  Q+   +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHL-LRLH-RIPVDECSRLFAQISGAMYYAHSLN--CVHRDLKLE 157

Query: 163 NVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNT--TAQYRAPEMI--DLYR 218
           N+L+ + G+ K+ DFG            +       +IL+    T  Y APE+I  + Y 
Sbjct: 158 NILLDKVGNAKLTDFG------------FTRECASKNILETICGTTVYMAPELIKRERYD 205

Query: 219 GFSVDEKSDIWALGVFLYKLCYYTTPFE----KTGEVAILKANFQFPSYPQYSNRLKNLI 274
           GF +    D+W+LGV LY L     PF+    K  E  I+     F S     + + +L+
Sbjct: 206 GFKI----DVWSLGVILYTLLNGFMPFDEEQQKNTEWKIVNEMPSFDSTLLGPDAV-DLL 260

Query: 275 TVMLAENPIHRPNSCQVLE 293
           + +LA++PI RP+  +VLE
Sbjct: 261 SKLLAKDPIDRPSMKEVLE 279

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 93/203 (45%), Gaps = 36/203 (17%)

Query: 104 VVLLMEYCSRGGLISFMNTRLQDR--LKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKI 161
           + +++EY  +G L +     L DR  L E E +R   Q++ GI   HAL   ++HRD+K 
Sbjct: 112 LYMVLEYVEKGELFNL----LVDRGPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKP 165

Query: 162 ENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA---QYRAPEMIDL-- 216
           EN+L+    + K+ DFG                    D L  T+     Y APE++    
Sbjct: 166 ENLLLDHKFNIKIADFGMAA-------------LESKDKLLETSCGSPHYAAPEIVSGLP 212

Query: 217 YRGFSVDEKSDIWALGVFLYKLCYYTTPF-EKTGEV-----AILKANFQFPSYPQYSNRL 270
           Y GF    +SD+W+ G+ L+ L     PF E+ G +      +    F+ P   + S   
Sbjct: 213 YHGF----ESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEA 268

Query: 271 KNLITVMLAENPIHRPNSCQVLE 293
           ++LI  +L  +P  R  S  +L+
Sbjct: 269 QDLIAKILTVDPAARIKSRGILK 291

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 75.9 bits (185), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 138/281 (49%), Gaps = 41/281 (14%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPD-KQSLNTLRAEVDAMKLLRGN 81
           ++++ +  G F  +Y    ++ +    ++  +K V++ D  + ++ L  E+  +  LR  
Sbjct: 21  EILQCIGRGNFGDVYKARYLATN----EIVAIKVVNLEDTDEPIDLLAQEIFFLSELRS- 75

Query: 82  KHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVV 141
                YI ++ +  +++   +   ++MEYC  G     +    + +L E +   I+++V+
Sbjct: 76  ----PYITNYKTAFLVDVSMW---IVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVL 128

Query: 142 QGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCG--VIRPPKNTYELSYVQHD 199
            G+  +H+ +   IHRDIK  N+L+ +NG  K+ DFG V G  ++   ++T+        
Sbjct: 129 VGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTFV------- 178

Query: 200 ILKNTTAQYRAPEMIDL-YRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKANF 258
                T  + APE+ID   +G+  +E +DIW+LG+ + +L     P +K      +KA  
Sbjct: 179 ----GTPFWMAPEVIDRNKKGY--NEMADIWSLGITVIELLMGHPPLDKYDA---MKALM 229

Query: 259 QFPSY------PQYSNRLKNLITVMLAENPIHRPNSCQVLE 293
             P         ++S+  K+ +   L ++P  RP + ++L+
Sbjct: 230 AIPKRDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 94/202 (46%), Gaps = 32/202 (15%)

Query: 103 EVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIE 162
           ++ L++EY  +G L + +  R    L E E +R   Q++ GI   H+L   ++HRD+K E
Sbjct: 103 DLYLVLEYAEKGELFNMLVER--GPLPENEAVRAFRQIIIGISYCHSL--GVVHRDLKPE 158

Query: 163 NVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTA---QYRAPEMIDL--Y 217
           N+L+    + K+ DFG                    D L  T+     Y APE+I    Y
Sbjct: 159 NLLLDNKLNIKIADFGMAA-------------LESEDKLLETSCGSPHYAAPEIISGLPY 205

Query: 218 RGFSVDEKSDIWALGVFLYKLCYYTTPF-EKTGEV-----AILKANFQFPSYPQYSNRLK 271
            GFS    SD+W+ GV L+ L     PF E+ G +      + K  F+ P   + +   +
Sbjct: 206 EGFS----SDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQ 261

Query: 272 NLITVMLAENPIHRPNSCQVLE 293
           +L+  +L  +P  R    ++L+
Sbjct: 262 DLLARLLTVDPSKRITIREILK 283

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 100/232 (43%), Gaps = 30/232 (12%)

Query: 59   VPDKQSLNTLRAEVDAMKLLRGNKH--IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGL 116
            V D+Q L T+ +E+  M  L  + H  I+  +D         +  Y  +    +   G +
Sbjct: 1079 VRDRQ-LGTILSEIQIMSTLNKHPHDNILRLLD------FFEDDDYYYIETPMHGETGCI 1131

Query: 117  ISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCD 176
              F     +  + E E   I  QVV  I  +H     ++HRDIK ENV++   G  K+ D
Sbjct: 1132 DLFDLIEFKTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQGFIKLID 1189

Query: 177  FGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVF 234
            FGS   V   P + +             T  Y APE++  + Y G    +  DIWA+G+ 
Sbjct: 1190 FGSAAYVKSGPFDVFV-----------GTIDYAAPEVLGGEPYVG----KPQDIWAIGIL 1234

Query: 235  LYKLCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRP 286
            LY + +   PF    E  IL+A  +F +         +LI  +L  NP  RP
Sbjct: 1235 LYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRP 1284

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 101/214 (47%), Gaps = 26/214 (12%)

Query: 106 LLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVL 165
           +L EY S G L+ ++       L+E    +    V   +  +HA    ++HRD+KIEN++
Sbjct: 202 MLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLKIENIM 257

Query: 166 IAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGFSVD 223
           I+ +G+ K+ DFG          N ++     H      +  + APE++  + Y G  V 
Sbjct: 258 ISTSGEIKIIDFGL--------SNVFDTRKQLHTFC--GSLYFAAPELLKANPYIGPEV- 306

Query: 224 EKSDIWALGVFLYKLCYYTTPFEKTGEVA----ILKANFQFPSYPQYSNRLKNLITVMLA 279
              DIW+ GV LY L     PF+          I +   ++P++   S  + +L++ ML 
Sbjct: 307 ---DIWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPNH--LSIEVISLLSKMLV 361

Query: 280 ENPIHRPNSCQVLEEVCRIQGQPCPVKNFYLERS 313
            +P+ R N  +V+E    I+G   P  ++  +RS
Sbjct: 362 VDPLKRANLTKVIEHPWMIRGYDFPPPSYLPKRS 395

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 130/292 (44%), Gaps = 46/292 (15%)

Query: 18  GSHKV--------KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHV-PDKQSLNTL 68
            SH+V        K  + +  G F  +Y        S+ K V  +K +++  D+  +  +
Sbjct: 14  ASHRVEQDVGSIFKRTEIIGRGKFGVVYKGY----HSRTKQVFAIKVLNLDSDEDEVEDV 69

Query: 69  RAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRL 128
           + EV  +  ++   +I  Y  S+   + L        +++EYC+ G L + +      ++
Sbjct: 70  QREVQFLASMKQVPNITQYYGSYLKDTTL-------WIIIEYCAGGSLRTLLR---PGKI 119

Query: 129 KEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPK 188
            E  +  IM +++  +  +H  +  +IHRD+K  NVLI  +G  K+CDFG    + +   
Sbjct: 120 DEKYIGVIMRELLIALKFIH--RDNVIHRDLKAANVLITNDGQVKLCDFGVAAQLNQSNS 177

Query: 189 NTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKT 248
             + ++          T  + APE+I    G   D K DIW+LG+  Y+      P+   
Sbjct: 178 RRHTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEAATGNPPY--- 223

Query: 249 GEVAILKA-NFQFPSYP------QYSNRLKNLITVMLAENPIHRPNSCQVLE 293
            EV  L+A      S P       YS  LK  I + L E+P  R ++ ++L+
Sbjct: 224 CEVEALRAMQLITKSKPPRLEGRSYSPLLKEFIALCLDEDPKERLSAEELLK 275

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 98/228 (42%), Gaps = 29/228 (12%)

Query: 63   QSLNTLRAEVDAMKLLRGNKH--IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM 120
            + L T+ +E+  M  L    H  I+  +D         +  Y  +    +   G +  F 
Sbjct: 1141 RKLGTIPSEIQIMATLNKKPHENILRLLD------FFEDDDYYYIETPVHGETGCIDLFD 1194

Query: 121  NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV 180
                +  + EFE   I  QVV GI  +H     ++HRDIK ENV++   G  K+ DFGS 
Sbjct: 1195 LIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSA 1252

Query: 181  CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLYKL 238
              V   P + +             T  Y APE++  + Y G    +  DIWA+G+ LY +
Sbjct: 1253 AYVKSGPFDVFV-----------GTIDYAAPEVLGGNPYEG----QPQDIWAIGILLYTV 1297

Query: 239  CYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRP 286
             +   PF    E  IL+ + +F +  + S     LI  +L     +RP
Sbjct: 1298 VFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRRVPNRP 1343

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 137/306 (44%), Gaps = 46/306 (15%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNK 82
           ++VK L  G F ++     ++   KV      K+V +        +  E+  ++LLR + 
Sbjct: 43  QIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKV-LAKSDMQGRIEREISYLRLLR-HP 100

Query: 83  HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
           HI+   D   SK        E+++++EY     L  ++  R  D++ E E  R   Q++ 
Sbjct: 101 HIIKLYDVIKSKD-------EIIMVIEYAG-NELFDYIVQR--DKMSEKEARRFFQQIIS 150

Query: 143 GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD--I 200
            +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              LS +  D   
Sbjct: 151 AVEYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG--------------LSNIMTDGNF 194

Query: 201 LKNTTA--QYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILKA 256
           LK +     Y APE+I   LY G  V    D+W+ GV LY +     PF+    + +L  
Sbjct: 195 LKTSCGSPNYAAPEVISGKLYAGPEV----DVWSSGVILYVMLCRRLPFDDES-IPVLFK 249

Query: 257 NFQFPSY--PQY-SNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQPCPVKNFYLERS 313
           N     Y  P++ S     LI  ML  NP++R +    + E+ + +     + ++ +   
Sbjct: 250 NISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRIS----IHEIMQDEWFKVDLPDYLIPAD 305

Query: 314 LKQQIP 319
           LK Q P
Sbjct: 306 LKHQQP 311

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 119/286 (41%), Gaps = 47/286 (16%)

Query: 24   VVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVH---------VPDKQSLNTLRAEVDA 74
            V++ +  G + ++  C       K K V  +K +          V D++ L T+ +E+  
Sbjct: 1001 VLQKMGEGAYGKVDLCM----HKKEKYVVVIKLIFKERILVDTWVRDRK-LGTIPSEIQI 1055

Query: 75   MKLLRGNKH--IVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFE 132
            M  L    H  I+  +D         +  Y  +    +   G +  F    L+  + E E
Sbjct: 1056 MATLNKKPHENIMRLLD------FFEDDEYYYIESPMHGETGSIDLFDLIELKTNMTEHE 1109

Query: 133  VLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYE 192
               +  QV  G+  +H  +  ++HRDIK ENV++   G  K+ DFGS   V R P + + 
Sbjct: 1110 AKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVKIIDFGSAAYVKRGPFDVFV 1167

Query: 193  LSYVQHDILKNTTAQYRAPEMI--DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGE 250
                        T  Y APE++  D Y G    +  D+WA+GV LY + Y   PF    E
Sbjct: 1168 -----------GTIDYAAPEVLGGDPYEG----KPQDVWAVGVLLYTIIYKENPFYNIDE 1212

Query: 251  VAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVC 296
              IL  + +       S     LIT +L  +   RP     ++++C
Sbjct: 1213 --ILDGDLRISPAVVVSEECVALITRILNRSVNRRP----TVDDIC 1252

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 92/210 (43%), Gaps = 21/210 (10%)

Query: 104 VVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIEN 163
           V L MEYC  G     + TR    + E +     ++V   +  +H L    I+RD+K EN
Sbjct: 509 VYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLLG--FIYRDLKPEN 566

Query: 164 VLIAENGDCKVCDFG---SVCGVIRPPKN-TYELSYVQHDILKNT--------TAQYRAP 211
           +L+ ++G   + DF          +P K    + S V   +            T +Y AP
Sbjct: 567 ILLHKSGHIMLSDFDLSVQANDAAKPVKRVATQSSMVDTKVFSEGFRTNSFVGTEEYIAP 626

Query: 212 EMIDLYRGFSVDEKSDIWALGVFLYKLCYYTTPF--EKTGEV--AILKANFQFPSYPQYS 267
           E+I   RG       D W LG+ +Y++ +  TPF  E T E    ILK    FP + + S
Sbjct: 627 EVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFKGENTNETFCNILKNEVTFPEHHEIS 683

Query: 268 NRLKNLITVMLAENPIHRPNSCQVLEEVCR 297
              K+LI  +L++N   R  S     ++ R
Sbjct: 684 RHCKDLIRKLLSKNESKRLGSKMGAADIKR 713

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 128/280 (45%), Gaps = 40/280 (14%)

Query: 23  KVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDAMKLLRGNK 82
           +++K L  G F ++      +   KV  +  + R  +        +  E+  ++LLR + 
Sbjct: 45  QIIKTLGEGSFGKVKLAYHATTGQKVA-LKIINRKVLAKSDMQGRIEREISYLRLLR-HP 102

Query: 83  HIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQ 142
           HI+   D   SK        E+++++EY     L  ++  R  D++ E E  R   Q++ 
Sbjct: 103 HIIKLYDVIKSKD-------EIIMVIEYAD-NELFDYIVQR--DKMSEQEARRFFQQIIS 152

Query: 143 GILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHD--I 200
            +   H  +  ++HRD+K EN+L+ E+ + K+ DFG              LS +  D   
Sbjct: 153 AVDYCH--RHKIVHRDLKPENLLLDEHLNVKIADFG--------------LSNIMTDGNF 196

Query: 201 LKNTTA--QYRAPEMID--LYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK- 255
           LK +     Y APE+I   LY G  V    D+W+ GV LY +     PF+      + K 
Sbjct: 197 LKTSCGSPNYAAPEVISGKLYAGPEV----DVWSCGVILYVMLCRRLPFDDESIPVLFKN 252

Query: 256 ANFQFPSYPQY-SNRLKNLITVMLAENPIHRPNSCQVLEE 294
            N    + P++ S    +LI  ML  NP++R +  +++++
Sbjct: 253 INNGIYTLPRFLSEGASSLIKKMLIVNPLNRISIHEIMQD 292

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 94/201 (46%), Gaps = 26/201 (12%)

Query: 101 SYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIK 160
           S ++ +++EY  +G L + +  R    L E E +R   Q++ GI   HAL   ++HRD+K
Sbjct: 101 STDLYMVLEYVEKGELFNLLIER--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLK 156

Query: 161 IENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDL--YR 218
            EN+L+    + K+ DFG     +       E S          +  Y APE++    Y 
Sbjct: 157 PENLLLDHKFNIKLADFG--MAALESKDKLLETSC--------GSPHYAAPEIVSGLPYH 206

Query: 219 GFSVDEKSDIWALGVFLYKLCYYTTPF-EKTGEVAIL-----KANFQFPSYPQYSNRLKN 272
           GF    +SD+W+ GV LY L     PF E  G +  L        F+ P   + S   ++
Sbjct: 207 GF----ESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEISIEAQD 262

Query: 273 LITVMLAENPIHRPNSCQVLE 293
           LI  +L  +P  R  + ++L+
Sbjct: 263 LIAKILTVDPSGRIKTREILK 283

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 130/284 (45%), Gaps = 26/284 (9%)

Query: 14  VLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVD 73
           V+  G    K  + L  G ++ +     I    K   V  L + ++  ++ +  +  E +
Sbjct: 155 VIKKGIKDFKFGEVLGDGSYSTVMLARSIDSGKKYA-VKVLNKEYLIRQKKVKYVNIEKN 213

Query: 74  AMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEV 133
            ++ L   + I+    +   ++ L         L+EY   G  +S +  +    L +   
Sbjct: 214 TLQRLNDGRGIIKLYFTFQDEASL-------YFLLEYAPNGDFLSVI--KKYGSLNQDCS 264

Query: 134 LRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYEL 193
           +    Q++  I  +H  Q  +IHRDIK EN+L+ ++   K+ DFG+   ++   + T   
Sbjct: 265 VYYSAQILDAIDYLH--QKGVIHRDIKPENILLDKDMKVKLTDFGT-AKLVEKDETTQTY 321

Query: 194 SYVQHDILKNTTAQYRAPEMI-DLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEKTGEV- 251
           + ++       TA+Y +PE++ D Y    VD K DIWA G  L+++     PF+ T E  
Sbjct: 322 NLLERSKSFVGTAEYVSPELLNDNY----VDYKCDIWAFGCILFQMIAGKPPFKATNEYL 377

Query: 252 ---AILKANFQFPS-YPQYSNRLKNLITVMLAENPIHRPNSCQV 291
               ++K  + F + +P     +++LI  +L +NP  R ++ QV
Sbjct: 378 TFQKVMKVQYAFTAGFPLI---IRDLIKQILVKNPEQRLDTLQV 418

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 113/231 (48%), Gaps = 45/231 (19%)

Query: 71  EVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKE 130
           E++A+KLL  + +IV        + VL N  Y + +++E+ S G    ++  + + RLKE
Sbjct: 103 EINALKLL-THPNIVRL------EEVLQNSKY-IGIVLEFASGGEFYKYL--QRKRRLKE 152

Query: 131 FEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNT 190
               ++  Q++ G+  MH+    L+HRD+K+EN+L+ +N +  + DFG V        N 
Sbjct: 153 PHACQLFAQLISGVTYMHS--KGLVHRDLKLENLLLDKNENLIITDFGFV--------NE 202

Query: 191 YELSYVQHDILKNTTAQ--YRAPEMI---DLYRGFSVDEKSDIWALGVFLYKLCYYTTPF 245
           +   +  ++++K +     Y APE++   + YR      K DIW+ G+ LY +     P+
Sbjct: 203 F---FGSNELMKRSCGSPCYAAPELVLSTEPYRA----RKVDIWSCGIILYAMLAGYLPW 255

Query: 246 EKTGE-----------VAILKANFQFPSYPQYSNRLKNLITVMLAENPIHR 285
           +   +             I K   +FP+Y   S   ++LI  +L  NP  R
Sbjct: 256 DDDSQNPNGDDIGKLYQYITKTALKFPAY--ISPLARDLIRKILTANPSRR 304

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 102/209 (48%), Gaps = 32/209 (15%)

Query: 96  VLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLI 155
           VL N  Y + +++EY S G    ++  +   RLKE    R+  Q++ G+  MH+    ++
Sbjct: 114 VLQNSKY-IGIVLEYASGGEFYKYVQRKR--RLKEATACRLFAQLISGVSYMHS--KGIV 168

Query: 156 HRDIKIENVLIAENGDCKVCDFGSVCGVIRPPKNTYELSYVQHDILKNTTAQ--YRAPEM 213
           HRD+K+EN+L+ ++ +  + DFG V        N +   Y  ++++K +     Y APE+
Sbjct: 169 HRDLKLENLLLDKHENLIITDFGFV--------NEF---YADNELMKTSCGSPCYAAPEL 217

Query: 214 IDLYRGFSVDEKSDIWALGVFLYKLCYYTTPFEK-----TGEVA------ILKANFQFPS 262
           +     +    K+DIW+ G+ LY +     P++       GE        I K   +FP 
Sbjct: 218 VITTEPYKA-RKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYITKTPLKFPE 276

Query: 263 YPQYSNRLKNLITVMLAENPIHRPNSCQV 291
           Y   +   ++L+  +L  NP+ R +S  +
Sbjct: 277 Y--ITPLPRDLLRHILVSNPVRRMSSRHI 303

>Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 139/311 (44%), Gaps = 54/311 (17%)

Query: 15  LTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTLRAEVDA 74
           L + +      K +  G FA +Y   +IS  S+   +  + R  + +K+ L  L  E+  
Sbjct: 17  LMISAGNYTAEKEIGKGSFATVYRGHLISDKSQHIAIKEVSRAKLKNKKLLENLEIEIAI 76

Query: 75  MKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRLKEFEVL 134
           +K ++ + HIV  ID   +       S +  L+MEYC+ G L +F+  R ++ ++   +L
Sbjct: 77  LKKIK-HPHIVGLIDCERT-------STDFYLIMEYCALGDL-TFLLKRRKELMENHPLL 127

Query: 135 R--------------------IMNQVVQGILAMHALQPP-LIHRDIKIENVLIAE----N 169
           R                    +++ + Q   A+  L+   L+HRDIK +N+L++      
Sbjct: 128 RTVFEKYPPPSESHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGY 187

Query: 170 GDCKVCDFGSVCGVIRPP-KNTYELSYVQHDILKNTTAQ--------YRAPEMIDLYRGF 220
            D K        G+   P     +  + +   L NT+          Y APE+++ Y+ +
Sbjct: 188 HDSKTFHELGFVGIYNLPILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILN-YQKY 244

Query: 221 SVDEKSDIWALGVFLYKLCYYTTPFEKTGEVAILK----AN--FQFPSYPQYSNRLKNLI 274
           +   K+D+W++G  ++++C  T PF  +  + + K    AN    FPSY      LK LI
Sbjct: 245 NA--KADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDAITFPSYCNIEPELKKLI 302

Query: 275 TVMLAENPIHR 285
             +L  +P  R
Sbjct: 303 CSLLTFDPAKR 313

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 132/288 (45%), Gaps = 48/288 (16%)

Query: 9   FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVPDKQSLNTL 68
           F+ G  L  GS+    V   TS    + Y  +V+S +  ++            ++ +  +
Sbjct: 167 FKFGETLGDGSYST--VMLATSKESGKKYAVKVLSKEYLIR------------QKKVKYV 212

Query: 69  RAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNTRLQDRL 128
             E +A++ L  ++ IV    +   +S L         L+EY   G  +S M  +    L
Sbjct: 213 NIEKNALQRLNNSRGIVKLYFTFQDESSL-------YFLLEYAPNGDFLSIM--KKYGSL 263

Query: 129 KEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCGVIRPPK 188
            E        Q++  I  +H+    ++HRDIK EN+L+ ++   K+ DFG+   ++ P  
Sbjct: 264 NEDCACYYSAQIIDAIDFLHS--KGIVHRDIKPENILLDKDFKVKLTDFGT-AKILEPKP 320

Query: 189 NTYELSYVQHDILKNT-----TAQYRAPEMI-DLYRGFSVDEKSDIWALGVFLYKLCYYT 242
           NT +     +D+L  +     TA+Y +PE++ D Y    VD + DIWA G  L+++    
Sbjct: 321 NTTD----SYDLLSRSKSFVGTAEYVSPELLNDNY----VDYRCDIWAFGCILFQMIAGK 372

Query: 243 TPFEKTGEV----AILKANFQFPS-YPQYSNRLKNLITVMLAENPIHR 285
            PF+ T E      ++K  + F + +P     +++L+  +L + P  R
Sbjct: 373 PPFKATNEYLTFQKVMKVQYAFTAGFPLV---VRDLVKGILIKQPAQR 417

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,989,225
Number of extensions: 2885617
Number of successful extensions: 13402
Number of sequences better than 10.0: 1848
Number of HSP's gapped: 12352
Number of HSP's successfully gapped: 1899
Length of query: 748
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 631
Effective length of database: 40,065,477
Effective search space: 25281315987
Effective search space used: 25281315987
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)