Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_33212.283ON40940921970.0
SAKL0E07766g2.283ON39835112411e-170
Skud_14.2982.283ON38940912321e-168
ADL218C2.283ON40341112291e-168
Suva_14.3112.283ON38936112251e-167
Smik_14.2962.283ON38936312161e-166
KLTH0G10296g2.283ON42641212091e-164
Kwal_27.115502.283ON40735212051e-164
YNL035C2.283ON38936111761e-160
KLLA0E08449g2.283ON42235611611e-157
ZYRO0A01804g2.283ON37634211471e-156
Kpol_1003.342.283ON38834511301e-153
KAFR0H033402.283ON36734211101e-150
TDEL0G021402.283ON39234111031e-149
TBLA0B059202.283ON40336310881e-146
NCAS0G038702.283ON38934510861e-146
KNAG0H020402.283ON39934310871e-146
TPHA0C033702.283ON41335110821e-145
NDAI0G006302.283ON39735710781e-145
CAGL0G01628g2.283ON3763499501e-126
KNAG0E009806.9ON4141921471e-09
KLTH0C11550g6.9ON3981751462e-09
Ecym_30126.9ON3972531426e-09
TBLA0A071206.9ON4071871427e-09
KAFR0L003206.9ON3912061382e-08
SAKL0E00814g6.9ON3982571302e-07
Suva_5.126.9ON4011111231e-06
Smik_5.316.9ON4272671185e-06
Skud_5.336.9ON4012001185e-06
ACR017W6.9ON4231941178e-06
KLLA0D00814g6.9ON4082421161e-05
KLTH0E12694g8.548ON4181211161e-05
CAGL0B03575g6.9ON4191171151e-05
YEL056W (HAT2)6.9ON4011891151e-05
NDAI0K029006.9ON4381801132e-05
Kpol_1045.786.9ON3921191123e-05
ZYRO0F00462g6.9ON3931101123e-05
TBLA0H036508.548ON4191901088e-05
CAGL0G04345g1.247ON7112071053e-04
Kwal_55.220763.22ON1286651035e-04
Kwal_27.120708.548ON4181211017e-04
ZYRO0A09636g8.435ON8081281019e-04
KLTH0F19338g3.22ON1290651019e-04
KNAG0F038707.534ON465107990.001
SAKL0C13332g3.22ON135366980.002
Kwal_26.77362.469ON507143970.002
TDEL0G046206.9ON392120960.003
Skud_11.2711.247ON646157970.003
Kpol_1041.202.401ON515187960.003
Suva_10.3168.435ON818112960.003
KLTH0D05346g2.469ON507153950.004
Ecym_70428.548ON414131950.004
NCAS0B078401.247ON589124950.004
TPHA0M001906.9ON391131930.005
KAFR0B003707.534ON461139940.006
NCAS0F001906.9ON411107930.006
Smik_12.2798.435ON817112940.006
KLTH0A00880g7.534ON471151930.007
YLR222C (UTP13)8.435ON817112930.007
Skud_12.2858.435ON817103930.008
KNAG0A036708.548ON426112920.008
KLLA0E20967g3.22ON132162930.009
Ecym_20243.22ON131762920.010
Suva_11.2681.247ON64578920.011
Kpol_467.202.469ON581111910.012
KAFR0J009805.201ON480153910.013
TPHA0G026502.401ON516187910.013
TDEL0G033402.401ON514189910.014
Suva_7.519na 1ON205144870.017
KLLA0E04819g7.534ON459150890.018
Kpol_1013.377.534ON468150890.019
Kpol_2002.995.201ON487112890.019
CAGL0M13409g5.49ON1527132900.022
NCAS0E037507.310ON1276179890.024
Kpol_1016.111.247ON669149890.025
NDAI0B051901.247ON668162880.026
YKR036C (CAF4)1.247ON64378880.032
YCR057C (PWP2)6.325ON923191880.034
ZYRO0G03146g2.469ON510112870.040
TBLA0H030601.247ON73084870.041
Suva_6.1871.247ON714149860.046
Smik_13.2772.469ON513111860.051
SAKL0H07656g8.631ON42666850.055
ADL186C3.22ON136162860.064
Suva_7.5185.104ON593144850.068
CAGL0J01265g2.469ON517111840.074
TBLA0F005206.363ON663118850.076
TBLA0F042406.363ON727115850.076
ADR331C5.49ON1562126850.080
Smik_3.1576.325ON924191840.087
Skud_7.5615.104ON59362840.090
Smik_11.2981.247ON66279840.090
AAR057W6.325ON922191840.095
Skud_10.1021.247ON708112840.10
TPHA0G018408.631ON43169830.11
TPHA0B042501.107ON507161830.11
YJL112W (MDV1)1.247ON714129830.13
AEL314W1.247ON715122830.13
Kwal_23.62406.325ON913191830.14
KLTH0G13068g8.288ON110133830.14
Kpol_1038.203.22ON131355830.14
AEL250C8.548ON41775820.15
Skud_3.1336.325ON916191820.15
Ecym_71055.201ON484217810.17
Smik_13.3292.401ON509188810.17
TPHA0L010808.435ON835110810.20
KLLA0D06787g8.631ON43673810.20
Suva_3.936.325ON920191810.20
Skud_13.2492.469ON513111810.20
CAGL0H08932g6.239ON902162810.21
TBLA0H020005.201ON473151810.21
NDAI0H022402.469ON514104810.22
Skud_12.565.201ON489213800.23
Kwal_56.236858.288ON110233810.23
YMR131C (RRB1)2.401ON511188800.24
TBLA0F021407.310ON130096810.25
Smik_12.525.201ON48971800.26
ZYRO0A08690g2.401ON516188800.26
Suva_13.2702.469ON513111800.27
TDEL0H003707.534ON46592800.28
TBLA0I022806.325ON927191800.29
NCAS0B021708.548ON41463790.29
YMR093W (UTP15)2.469ON513111790.30
KAFR0H022608.324ON938105800.30
Kwal_56.223456.9ON39672790.32
Smik_2.3358.548ON42256790.32
Ecym_42558.324ON937104800.32
Ecym_42808.288ON113237800.33
Suva_13.3112.401ON510126790.33
NDAI0E034408.435ON857172790.33
Kpol_1072.418.631ON42067790.33
SAKL0H08932g8.585ON31477780.34
CAGL0E01485g3.22ON133683790.35
Kwal_56.244787.310ON129678790.37
NDAI0E015008.631ON42857780.38
Skud_13.2912.401ON509188780.39
Kpol_1048.388.585ON340142780.39
NCAS0F019702.401ON511188780.42
TDEL0B020108.435ON805103780.44
YLR129W (DIP2)8.324ON943112780.46
KLTH0A06380g6.325ON915191780.47
AGR180W8.435ON806172780.49
KLTH0C07634g3.259ON425132770.50
ZYRO0D08558g6.325ON912189780.50
KNAG0E024002.450ON910106780.51
KLTH0G12276g8.324ON937135780.54
Kwal_55.220673.25ON451115770.54
Kwal_23.53517.534ON474151770.59
TPHA0I016908.585ON340259760.61
Smik_16.795.104ON593144770.62
TDEL0D013101.247ON709131770.65
Skud_8.2525.49ON1556133770.69
KLLA0F13244g8.435ON814102770.72
SAKL0F15972g7.534ON470108760.73
YGR225W (AMA1)5.104ON593144760.78
KLTH0A07282g6.363ON725116760.83
Kwal_56.239208.324ON937136760.86
KAFR0A064804.122ON568131760.88
NCAS0D047806.363ON621114760.92
CAGL0M04081g3.25ON455123750.94
SAKL0E03080g2.469ON515104750.94
Suva_15.3895.49ON1555126760.95
Smik_15.163.22ON132682760.97
Skud_2.3218.548ON42256750.97
Kwal_26.87008.651ON38168750.98
YHR186C (KOG1)5.49ON1557131760.99
NCAS0D044806.325ON915204751.0
YLL011W (SOF1)5.201ON489132751.0
KLLA0A09471g5.49ON1506130751.1
Kwal_23.64296.363ON750116751.1
KLTH0E09394g2.401ON52260741.2
Smik_12.1928.324ON943112751.2
NCAS0C044303.22ON131191751.3
Ecym_25236.363ON646116741.3
SAKL0H01628g5.49ON1554197741.4
AGL234W6.363ON629116741.4
Smik_2.3158.585ON315108731.4
TDEL0E019605.429ON452132741.4
KLLA0F12694g8.180ON380144731.5
KNAG0E021802.401ON517144741.5
Suva_4.4498.548ON42474731.5
Smik_8.2755.49ON1556129741.5
TDEL0A024502.469ON510112741.5
TDEL0A074006.325ON901191741.5
Smik_4.3748.288ON115260741.6
Kwal_27.122398.585ON31665731.6
Suva_10.2228.324ON943115741.6
TBLA0B040708.631ON41766731.6
ACR097W8.631ON467133731.7
TPHA0D038306.325ON912189741.7
KAFR0A003802.401ON516111731.8
TDEL0A077806.363ON657116731.8
TBLA0B092502.401ON52692731.9
ABL044C2.469ON518141731.9
Suva_4.4278.585ON315108721.9
NCAS0C032608.324ON983117731.9
CAGL0B02013g8.288ON112034732.0
KNAG0I016501.359ON524135732.0
ZYRO0F14960g8.585ON319109722.1
NDAI0H027502.401ON512130722.1
SAKL0H16390g8.288ON114037732.2
NCAS0A105003.259ON47846722.2
TPHA0A003803.22ON131082732.3
AFR199C2.431ON334228722.3
Kwal_47.178272.401ON52360722.3
YCR084C (TUP1)6.363ON713116722.4
KAFR0A044806.143ON376167722.4
YBR175W (SWD3)8.585ON315108712.4
Ecym_83178.631ON423191722.4
Sklu_YGOB_Anc_2.4012.401ON520188722.4
CAGL0H03729g1.399ON303109712.4
NCAS0B036908.288ON114533722.5
Skud_15.163.22ON133283722.5
SAKL0A01738g6.325ON909204722.5
Kwal_27.115858.435ON823127722.5
SAKL0G07040g5.615ON345136712.5
TPHA0F005204.77ON713127722.5
Suva_10.645.201ON49094722.6
Skud_12.1988.324ON943112722.6
KLTH0H03608g6.239ON87559722.7
ADR242C2.401ON52161712.8
YBR195C (MSI1)8.548ON422252712.8
TDEL0A057708.631ON43357712.8
KAFR0A006902.469ON508113712.9
Skud_3.1566.363ON713116713.0
NCAS0C044503.25ON461122713.0
Ecym_28087.534ON465173713.0
Kpol_1028.546.325ON905190713.0
YDR128W (MTC5)8.288ON114833723.1
AEL269C7.534ON455166713.1
Skud_4.3898.288ON115133713.1
AGR067W8.288ON112533713.2
KNAG0I010508.288ON115933713.2
Suva_2.2918.288ON115133713.2
Kpol_1033.198.288ON113934713.4
KAFR0H017508.435ON783128713.5
SAKL0G01628gna 2ON95982713.6
Smik_10.1261.247ON71244713.6
NDAI0I004606.325ON917204713.6
CAGL0K03861g2.401ON513111703.7
Suva_3.1216.363ON700116713.7
CAGL0D05588g5.201ON477189703.9
NDAI0B056305.429ON435128703.9
ZYRO0G02618g2.450ON88045704.0
KLTH0G12430g8.316ON367173704.0
CAGL0G09845g7.534ON500107704.1
TBLA0I012202.469ON511100704.1
KAFR0C038302.663ON38170704.1
NDAI0J011808.288ON113433704.1
ZYRO0D06556g8.288ON114737704.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3321
         (409 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   850   0.0  
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   482   e-170
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   479   e-168
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   478   e-168
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   476   e-167
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   473   e-166
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   470   e-164
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   468   e-164
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   457   e-160
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   451   e-157
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   446   e-156
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   439   e-153
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   432   e-150
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   429   e-149
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   423   e-146
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    422   e-146
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   423   e-146
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   421   e-145
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   419   e-145
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   370   e-126
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    61   1e-09
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    61   2e-09
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    59   6e-09
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    59   7e-09
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    58   2e-08
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    55   2e-07
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    52   1e-06
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    50   5e-06
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    50   5e-06
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    50   8e-06
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    49   1e-05
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    49   1e-05
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    49   1e-05
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    49   1e-05
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      48   2e-05
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    48   3e-05
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    48   3e-05
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    46   8e-05
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    45   3e-04
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    44   5e-04
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    44   7e-04
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    44   9e-04
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    44   9e-04
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    43   0.001
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    42   0.002
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    42   0.002
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    42   0.003
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    42   0.003
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    42   0.003
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    42   0.003
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    41   0.004
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    41   0.004
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    41   0.004
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    40   0.005
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    41   0.006
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    40   0.006
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    41   0.006
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    40   0.007
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    40   0.007
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    40   0.008
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    40   0.008
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    40   0.009
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    40   0.010
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    40   0.011
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    40   0.012
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    40   0.013
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    40   0.013
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    40   0.014
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    38   0.017
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    39   0.018
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    39   0.019
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    39   0.019
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    39   0.022
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    39   0.024
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    39   0.025
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    39   0.026
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    39   0.032
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    39   0.034
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    38   0.040
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    38   0.041
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    38   0.046
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    38   0.051
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    37   0.055
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    38   0.064
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    37   0.068
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    37   0.074
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    37   0.076
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    37   0.076
ADR331C Chr4 complement(1285562..1290250) [4689 bp, 1562 aa] {ON...    37   0.080
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    37   0.087
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    37   0.090
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    37   0.090
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    37   0.095
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    37   0.10 
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    37   0.11 
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    37   0.11 
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    37   0.13 
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    37   0.13 
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    37   0.14 
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    37   0.14 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    37   0.14 
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    36   0.15 
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    36   0.15 
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    36   0.17 
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    36   0.17 
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    36   0.20 
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    36   0.20 
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    36   0.20 
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    36   0.20 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    36   0.21 
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    36   0.21 
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    36   0.22 
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    35   0.23 
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    36   0.23 
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    35   0.24 
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    36   0.25 
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    35   0.26 
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    35   0.26 
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    35   0.27 
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    35   0.28 
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    35   0.29 
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    35   0.29 
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    35   0.30 
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    35   0.30 
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    35   0.32 
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    35   0.32 
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    35   0.32 
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    35   0.33 
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    35   0.33 
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    35   0.33 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    35   0.33 
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    35   0.34 
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    35   0.35 
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    35   0.37 
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    35   0.38 
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    35   0.39 
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    35   0.39 
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    35   0.42 
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    35   0.44 
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    35   0.46 
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    35   0.47 
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    35   0.49 
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    34   0.50 
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    35   0.50 
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    35   0.51 
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    35   0.54 
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    34   0.54 
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    34   0.59 
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    34   0.61 
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    34   0.62 
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    34   0.65 
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    34   0.69 
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    34   0.72 
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    34   0.73 
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    34   0.78 
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    34   0.83 
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    34   0.86 
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    34   0.88 
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     34   0.92 
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    33   0.94 
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    33   0.94 
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    34   0.95 
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    34   0.97 
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    33   0.97 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    33   0.98 
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    34   0.99 
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    33   1.0  
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    33   1.0  
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    33   1.1  
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    33   1.1  
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    33   1.2  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    33   1.2  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    33   1.3  
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    33   1.3  
SAKL0H01628g Chr8 (168606..173270) [4665 bp, 1554 aa] {ON} simil...    33   1.4  
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    33   1.4  
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    33   1.4  
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    33   1.4  
KLLA0F12694g Chr6 complement(1174812..1175954) [1143 bp, 380 aa]...    33   1.5  
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    33   1.5  
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    33   1.5  
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    33   1.5  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    33   1.5  
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    33   1.5  
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    33   1.6  
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    33   1.6  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    33   1.6  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    33   1.6  
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    33   1.7  
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    33   1.7  
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    33   1.8  
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    33   1.8  
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    33   1.9  
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    33   1.9  
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    32   1.9  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    33   1.9  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    33   2.0  
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    33   2.0  
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    32   2.1  
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    32   2.1  
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    33   2.2  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    32   2.2  
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    33   2.3  
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    32   2.3  
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    32   2.3  
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    32   2.4  
KAFR0A04480 Chr1 (889486..890616) [1131 bp, 376 aa] {ON} Anc_6.1...    32   2.4  
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    32   2.4  
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    32   2.4  
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    32   2.4  
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    32   2.4  
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    32   2.5  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    32   2.5  
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    32   2.5  
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    32   2.5  
SAKL0G07040g Chr7 (577213..578250) [1038 bp, 345 aa] {ON} simila...    32   2.5  
TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.7...    32   2.5  
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    32   2.6  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    32   2.6  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    32   2.7  
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    32   2.8  
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    32   2.8  
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    32   2.8  
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    32   2.9  
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    32   3.0  
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      32   3.0  
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    32   3.0  
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    32   3.0  
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    32   3.1  
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    32   3.1  
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    32   3.1  
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    32   3.2  
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    32   3.2  
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    32   3.2  
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    32   3.4  
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    32   3.5  
SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {...    32   3.6  
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    32   3.6  
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       32   3.6  
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    32   3.7  
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    32   3.7  
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    32   3.9  
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    32   3.9  
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    32   4.0  
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    32   4.0  
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    32   4.1  
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    32   4.1  
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    32   4.1  
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    32   4.1  
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    32   4.2  
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    32   4.2  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    32   4.2  
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    32   4.2  
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    32   4.3  
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    32   4.3  
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    32   4.4  
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    32   4.4  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    31   4.6  
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    32   4.8  
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    32   4.9  
TDEL0G04280 Chr7 (777677..779650) [1974 bp, 657 aa] {ON} Anc_6.4...    32   4.9  
NCAS0G00690 Chr7 (116505..119162) [2658 bp, 885 aa] {ON} Anc_5.6...    32   5.2  
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    32   5.2  
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    31   5.2  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    31   5.2  
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    31   5.3  
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    31   5.4  
AFL055W Chr6 (332405..335893) [3489 bp, 1162 aa] {ON} Syntenic h...    31   5.4  
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    31   5.5  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    31   5.7  
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    31   5.8  
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    31   5.9  
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    31   5.9  
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    31   6.0  
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    31   6.0  
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    31   6.0  
YGL111W Chr7 (299978..301369) [1392 bp, 463 aa] {ON}  NSA1Consti...    31   6.1  
KLLA0C14476g Chr3 complement(1265344..1265934) [591 bp, 196 aa] ...    30   6.2  
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    31   6.2  
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    31   6.2  
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    31   6.2  
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    31   6.3  
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    31   6.4  
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    31   6.5  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    31   6.5  
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    31   6.5  
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    31   6.5  
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    31   6.6  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    31   6.7  
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    31   6.9  
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    31   7.0  
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    31   7.0  
TPHA0F00580 Chr6 complement(135765..137861) [2097 bp, 698 aa] {O...    31   7.4  
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    31   7.5  
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    31   7.5  
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    31   7.7  
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    31   7.8  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    31   7.9  
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    30   8.2  
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    31   8.4  
KAFR0B02320 Chr2 complement(453804..455621) [1818 bp, 605 aa] {O...    31   8.4  
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    30   8.4  
CAGL0K05269g Chr11 (513673..515958) [2286 bp, 761 aa] {ON} simil...    31   8.6  
SAKL0A05896g Chr1 complement(537150..538289) [1140 bp, 379 aa] {...    30   8.8  
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    30   8.8  
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    30   9.0  
KLTH0B01320g Chr2 (113672..114448) [777 bp, 258 aa] {ON} highly ...    30   9.1  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    30   9.3  
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    30   9.5  
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    30   9.6  
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    30   9.8  
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    30   9.8  
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    30   10.0 

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/409 (100%), Positives = 409/409 (100%)

Query: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA
Sbjct: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60

Query: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120
           LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL
Sbjct: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
           SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ
Sbjct: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180

Query: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240
           EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK
Sbjct: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240

Query: 241 PWNCDYVVDIFPGCIITGSTQEQSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHK 300
           PWNCDYVVDIFPGCIITGSTQEQSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHK
Sbjct: 241 PWNCDYVVDIFPGCIITGSTQEQSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHK 300

Query: 301 TTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDMTVEKDIAFES 360
           TTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDMTVEKDIAFES
Sbjct: 301 TTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDMTVEKDIAFES 360

Query: 361 EHGIPTDFNKTPETEAEFGIQKESKRRNHTHDRNNEKKRKLKSHRFTPY 409
           EHGIPTDFNKTPETEAEFGIQKESKRRNHTHDRNNEKKRKLKSHRFTPY
Sbjct: 361 EHGIPTDFNKTPETEAEFGIQKESKRRNHTHDRNNEKKRKLKSHRFTPY 409

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  482 bits (1241), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 217/351 (61%), Positives = 282/351 (80%), Gaps = 1/351 (0%)

Query: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           MSY+K  T SFG +NWCL+LQPLY+RGLL++LSNGH+HL+DW +   I +   H  SIS 
Sbjct: 1   MSYSKLHTASFGCENWCLQLQPLYNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISN 60

Query: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120
           LKVL+N+  + + F +AS+DSVKIFD+R + CVAT+ N K++PF+SLDSRH MLACGTEL
Sbjct: 61  LKVLNNEFTNSDLFASASKDSVKIFDVRTSSCVATLHNDKSAPFLSLDSRHDMLACGTEL 120

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
           SG DAE+H+YD+KK+  P+RSF DSHHDDITD KFH  DP VL+SGSTDGYVN+YDL   
Sbjct: 121 SGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNS 180

Query: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240
           +EE+ALHQVINFAS+HSCGWL+P+RI+ LSHMETF+IHELNDKSD+L EPKP+EFGD+R+
Sbjct: 181 DEEDALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVRQ 240

Query: 241 PWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299
           PW CDY+++I PG I  G +QE Q  L+L+ F++E+VDTTN + IP+AHGDE++RD LI 
Sbjct: 241 PWGCDYIININPGFIAAGRSQETQGELKLIAFNDEKVDTTNVLTIPQAHGDEIIRDVLIP 300

Query: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDM 350
             T+++ YS GEDG + +WKS  G LN+  +FW+Y ++ NV  D  +E+DM
Sbjct: 301 DQTTDMLYSCGEDGCLNIWKSQTGPLNISRDFWDYSKRFNVFEDTVVEVDM 351

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  479 bits (1232), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 232/409 (56%), Positives = 294/409 (71%), Gaps = 23/409 (5%)

Query: 2   SYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISAL 61
           SY+  ++ SFGS+NWCLKLQP Y  GLL+ LSNG + L+DWNS  S+Q I    TSI+ L
Sbjct: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62

Query: 62  KVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELS 121
           KV+D+D  +G+   +AS D+VK+FD+R N CVA + N  NSPFISLDSRHG+LACGTEL 
Sbjct: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122

Query: 122 GTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
           G DA +++YD+++ DAP+RS  DSHHDD+T IKFH SD +VLLSGSTDGY N+YDLKQ E
Sbjct: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182

Query: 182 EEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKP 241
           EE+ALHQVIN+ASIHSCGWLS KRI+ LSHMETF+IHELNDKSDE  EP+P +FGDIR+ 
Sbjct: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242

Query: 242 WNCDYVVDIFPGCIITGSTQEQS-MLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHK 300
           WNCDYVVD++PG I TG TQE +  L+LLPF +E+VD  N I+IPRAHGDEVVRD  I  
Sbjct: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302

Query: 301 TTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDMTVEKDIAFES 360
             S+L YS GEDG + +WK+N G LN P  FW+Y EKLNVL + + +  +++++ I  + 
Sbjct: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDEDHKQSSISLKEPIIIQK 362

Query: 361 EHGIPTDFNKTPETEAEFGIQKESKRRNHTHDRNNEKKRKLKSHRFTPY 409
           E  +                   +K R   H ++N+   K    RF PY
Sbjct: 363 ESAV-------------------TKPRKEKHKKSNKLSTK---SRFKPY 389

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  478 bits (1229), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/411 (55%), Positives = 295/411 (71%), Gaps = 10/411 (2%)

Query: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           MSY     +SFG+DNWCL+L+PLY  G+L+ALSNGHVHL+DW +  S+ D+  H +SI+ 
Sbjct: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60

Query: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120
           L+VLD+  D G  F TA++D VK+FD+R   CVAT+ +A  +P +SLDSRHGMLA GTEL
Sbjct: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
            G DA + L+ L +   P+R+F DSHHDD+TD+KFH +D ++LLSGSTDGYVNVYDLKQ 
Sbjct: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180

Query: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240
           EE+EALHQVINFASIHSCGWLSPKRIW+LSHMETF+IHELNDKS+   EP+P  FGD+R+
Sbjct: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240

Query: 241 PWNCDYVVDIFPGCIITGSTQEQSM-LQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299
           PW CDYVVD++PG I  GST+E +  L+LLP  +E VD  N+I++P+AHGDEVVRD L+ 
Sbjct: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300

Query: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHD-PNIEIDMTVEKDIAF 358
            ++ EL YS GEDGN+ +WKS  G LNVP +FW+Y +K  VL D P+  +D T     A 
Sbjct: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLEDLPSSGLDDTHS---AQ 357

Query: 359 ESEHGIPTDFNKTPETEAEFGIQKESKRRNHTHDRNNEKKRKLKSHRFTPY 409
            ++          PE +    +Q +  RRN +      K  K  S RFTPY
Sbjct: 358 HNDQASSLSGQSQPEQQEYRQVQSDGMRRNRS-----SKHSKKHSARFTPY 403

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  476 bits (1225), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 222/361 (61%), Positives = 281/361 (77%), Gaps = 1/361 (0%)

Query: 2   SYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISAL 61
           SY+  D  SFGS+NWCLKLQP Y  GLL+ LSNG + L+DWN+   +Q I    T+I+ +
Sbjct: 3   SYSLVDLNSFGSENWCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAINDM 62

Query: 62  KVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELS 121
           K++D+D  +GN   +AS DSVK+FD+R N CVA + N  NSPF+SLDSRHG+LACGTEL 
Sbjct: 63  KIIDSDFVAGNLISSASIDSVKVFDIRSNDCVAKINNETNSPFLSLDSRHGLLACGTELQ 122

Query: 122 GTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
           G DA IH+YD++K DAP+RS  DSHHDD+T IKFH SD +VLLSGSTDGY N+YDLKQ +
Sbjct: 123 GIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDD 182

Query: 182 EEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKP 241
           EE+ALHQVIN+ASIHSCGWLSPKRI+ LSHMETFSIHELNDKSDEL EP+PL+FGDIRK 
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGDIRKA 242

Query: 242 WNCDYVVDIFPGCIITGSTQEQS-MLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHK 300
           WNCDYVVD++PG I TG TQE +  L+LLPF +E++DT N I+IP AHGDEVVRD  + +
Sbjct: 243 WNCDYVVDVYPGFIATGKTQEGAGELRLLPFKDEKIDTGNGIVIPHAHGDEVVRDVFVSE 302

Query: 301 TTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDMTVEKDIAFES 360
             +++ YS GEDG + +WK++ G LN P  FW+Y E+++VL D N E   ++E+ +  + 
Sbjct: 303 QNTDVLYSCGEDGCVKIWKNSLGCLNTPASFWDYSERISVLEDENKEAPTSLEEPLIIQK 362

Query: 361 E 361
           E
Sbjct: 363 E 363

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  473 bits (1216), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 220/363 (60%), Positives = 280/363 (77%), Gaps = 7/363 (1%)

Query: 2   SYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISAL 61
           SY+  ++  FGS+NWCLKLQP Y  GLL+ LSNG + L+DW +  S+Q+I    T+I+ L
Sbjct: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62

Query: 62  KVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELS 121
           KV+D+D  +G+   +AS D+VK+FD+R N C+AT+QN  NSPF+SLDSRHG+LACGTEL 
Sbjct: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122

Query: 122 GTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
           G DA +H+YD++K D P+RS  DSHHDD+T IKFH SD ++LLSGSTDGY N+YDLKQ E
Sbjct: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182

Query: 182 EEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKP 241
           EE+ALHQVIN+ASIHSCGWLSPKRI+ LSHMETF+IHELNDKSDEL EP+PL+FGD+RK 
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242

Query: 242 WNCDYVVDIFPGCIITGSTQEQS-MLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHK 300
           W+CDYVVDI+PG I TG TQE +  L+L+PF NE++ T    +IP AHGDEVVRD  I  
Sbjct: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302

Query: 301 TTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHD------PNIEIDMTVEK 354
             S++ YS GEDG + +WKS +G LN P  FW+Y EK+NVL D       N+E  + ++K
Sbjct: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGDDSKEAFTNLEEPLIIQK 362

Query: 355 DIA 357
           D+A
Sbjct: 363 DLA 365

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  470 bits (1209), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 225/412 (54%), Positives = 300/412 (72%), Gaps = 8/412 (1%)

Query: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           MSY+K ++I FG +NWCLKLQP+Y+ GLL++LSNG V LIDW +  SI  I  H TS++ 
Sbjct: 20  MSYSKLESIEFGPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVND 79

Query: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120
           + +++ND  +G+   TA+ED+VKI+DL+ N CVAT++N K++PF+SLDSRHG+L CGTEL
Sbjct: 80  MVIINNDRMNGSLIATAAEDAVKIYDLKSNDCVATLKNGKSAPFLSLDSRHGLLGCGTEL 139

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
           SG DAE+H+YD++    P+RS  DSHHDDIT IKFH SDP+VLLSGSTDGYVN+YDL QQ
Sbjct: 140 SGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQ 199

Query: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240
           EE++ALHQVINFASIHSCGWLSPKRI+ LSHMET+ IHELNDK DE  EPKP++FGD+RK
Sbjct: 200 EEDDALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVRK 259

Query: 241 PWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299
           PW+C+YV+D++PG I TG ++E +  L+L+P  +E+ +  ++I IP AH DEVVRD L+ 
Sbjct: 260 PWDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLVP 319

Query: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDMTVEK--DIA 357
               +L YS GEDG++ +WKS+ G LNVP EFW Y EK++V      E++M   +  DI 
Sbjct: 320 FQHEDLLYSCGEDGSLKVWKSSAGPLNVPQEFWQYSEKIDVFSGTVAEVEMMDSEVPDIE 379

Query: 358 FESEHGIPTDFNKTPETEAEFGIQKESKRRNHTHDRNNEKKRKLKSHRFTPY 409
              E   P+D +   + + E   +K    R       ++ K   K HR+ PY
Sbjct: 380 LRQE---PSDVDAVSKDQDEK--RKRKHERRSKDKSKSKTKSSSKDHRYQPY 426

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  468 bits (1205), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 219/352 (62%), Positives = 277/352 (78%), Gaps = 1/352 (0%)

Query: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           MSY+K D+I+FG+DNWCLKLQPLY+RGLL++LSNG V LIDW     I  I  HGT+IS 
Sbjct: 1   MSYSKVDSINFGADNWCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISD 60

Query: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120
           + VL+ND ++G    TA+EDSVKIFDLR +  VAT++N K++PF+SLDSRHGMLACGTEL
Sbjct: 61  MVVLNNDRNNGFLIATAAEDSVKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLACGTEL 120

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
           SG DAE+H+YD+K    P+RS  DSHHDDIT+IKFH +DP+VLLSGSTDGYVN+YDL Q 
Sbjct: 121 SGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQP 180

Query: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240
           EE++ALHQVINFASIHS GW +PKRI+ LSHMETF IHELNDK +E  EP P +FGDIR+
Sbjct: 181 EEDDALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDFGDIRQ 240

Query: 241 PWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299
            W CDYVVD++PG I TG +QE Q  ++L+PF+ E++D  +++ IP AHGDEVVRD L+ 
Sbjct: 241 SWGCDYVVDVYPGFIATGKSQEGQGEVKLIPFTGEDLDLDSAVTIPSAHGDEVVRDVLVP 300

Query: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDMT 351
               ++ Y+ GEDG +  WKSNRG LNVP EFW+Y ++++V      E++MT
Sbjct: 301 FQHEDMLYTCGEDGCVNAWKSNRGPLNVPQEFWSYADQIDVFSGSVAEVEMT 352

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  457 bits (1176), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 214/361 (59%), Positives = 278/361 (77%), Gaps = 1/361 (0%)

Query: 2   SYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISAL 61
           SY+  ++ SFGS+NWCLKLQP Y  GLL+ LSNG + L+DW++  S+Q I    T+I+ +
Sbjct: 3   SYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAINDM 62

Query: 62  KVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELS 121
           KV+ +D  +G+   +AS D+VK+FD+R N  +A +QN  NSPFISLDSRHG+LACGTEL 
Sbjct: 63  KVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRHGLLACGTELQ 122

Query: 122 GTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
           G DA +++YD++K D P+RS  DSHHDD+T IKFH SD ++LLSGSTDGY N+YDLKQ E
Sbjct: 123 GIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182

Query: 182 EEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKP 241
           EE+ALHQVIN+ASIHSCGWLSPKRI+ LSHMETF+IHELNDKSDEL EP+PL+FGD+R+ 
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDVREI 242

Query: 242 WNCDYVVDIFPGCIITGSTQEQ-SMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHK 300
           WNCDYVVDI+PG I TG TQE    L LLPF +E+VDT N I+IP AHGDEVVRD  I  
Sbjct: 243 WNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDIFIPA 302

Query: 301 TTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDMTVEKDIAFES 360
             S + YS GEDG + +W++ +G L++P  FW+Y +K+NVL D + E  + +++ +  + 
Sbjct: 303 QHSNMLYSCGEDGCVKIWENKQGPLDIPENFWDYSKKMNVLGDDDREGSINLDEPLIIQK 362

Query: 361 E 361
           E
Sbjct: 363 E 363

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  451 bits (1161), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 208/356 (58%), Positives = 267/356 (75%), Gaps = 1/356 (0%)

Query: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           MS+ K     F  +NWCLKLQPLY  GL++++S+G VHL+DW +L +I  I  H TSI+ 
Sbjct: 1   MSFNKYKCRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSIND 60

Query: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120
           +KV+++D D+G  F TA+ED VK++D+R    VA++QN K SPF SLDSRH MLACGTEL
Sbjct: 61  MKVINSDFDTGAVFATAAEDGVKVWDIRARNNVASLQNDKASPFFSLDSRHNMLACGTEL 120

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
              DAE+H+YD++    P+RSF DSHHDDITDIKFH  D ++L+SGSTDGYVN+YDL Q 
Sbjct: 121 KDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQD 180

Query: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240
           +EE+ALHQVINFASIHSCGWL PKRIW+LSHMETF IHELNDKSDE++EPKPLEFGD+R 
Sbjct: 181 DEEDALHQVINFASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDVRD 240

Query: 241 PWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299
            W CDYV+DI+P  I TG T E Q  L+++PF NE+VD +++++IP AHG+EV+RD LI 
Sbjct: 241 KWGCDYVIDIYPSFIATGKTHESQGELKIIPFQNEQVDVSSALVIPDAHGNEVIRDVLIP 300

Query: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDMTVEKD 355
           K  + L YS GEDG + +WK    SLNVP  FW+Y        +   EI+M + ++
Sbjct: 301 KNQTSLLYSCGEDGYVNVWKDTTNSLNVPHNFWDYTLPFTAFENSVREIEMDMGQE 356

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  446 bits (1147), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 206/342 (60%), Positives = 267/342 (78%), Gaps = 1/342 (0%)

Query: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           MSY+  ++ SFG++NWCL LQP Y   LL++LSNG VH +DW +  SI  I     +++ 
Sbjct: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60

Query: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120
           LK+++ND ++ +T+ TA+  +VKI+D+R N C+AT+ N KN+PF+SLDSRH MLACGTEL
Sbjct: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
           SG+DAE+H+YD++K D+P+RS  DSHHDDITDI FH SDP+VL+SGSTDGY N+YDL+Q 
Sbjct: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180

Query: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240
           EEE+ALHQVINFASIHSCGWL+P+RI+ LSHMETFSIHELNDKSDE  EP+P+EF D+R+
Sbjct: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240

Query: 241 PWNCDYVVDIFPGCIITGSTQEQ-SMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299
            W CDYVVDI PG +  G++QE    L++LPF  E+VDT N+I I  AHGDEVVRD  + 
Sbjct: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300

Query: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVL 341
              S+L YS GEDG++  W++  G LNV  EFW+Y + LNVL
Sbjct: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVL 342

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  439 bits (1130), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/345 (60%), Positives = 261/345 (75%), Gaps = 3/345 (0%)

Query: 2   SYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISAL 61
           SY+   + S G  +WCL+LQPLY  GLLS+LSNG V+L+DWN+   I+ +    TSI+ +
Sbjct: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62

Query: 62  KVLDNDVDSGNTFVTASEDSVKIFDLRL--NQCVATVQNAKNSPFISLDSRHGMLACGTE 119
           +VLD+D D+G+ F  A  D+VK+ DLR+  N  VA + N K +PF+SLDSRHGMLACGTE
Sbjct: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122

Query: 120 LSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179
           LSG DAEIH+YD++  D P+R   DSHHDD+TDIKFH SDP+VLLSGSTDGY NVYDL Q
Sbjct: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182

Query: 180 QEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIR 239
            EEE+ALHQVIN+ S+HSCGWLSPKRI+ LSHMETF+IHELN+KSDEL EPKPL+FGDIR
Sbjct: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242

Query: 240 KPWNCDYVVDIFPGCIITGSTQEQSM-LQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALI 298
             W+CDYVVD++PG I  G ++E +  L+++PF NE ++  +SI IP AHGDEVVRD  I
Sbjct: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302

Query: 299 HKTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHD 343
              +  + YS GEDG++  WK    SL VP  FW+Y  ++NVL D
Sbjct: 303 SPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDD 347

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  432 bits (1110), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 197/342 (57%), Positives = 259/342 (75%), Gaps = 1/342 (0%)

Query: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           MSY+     SFGSDNWCLK QPLY+ GLL++LSNG V L+DW +L  +++  +   SI++
Sbjct: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60

Query: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120
           +K+++ND ++ + F TA+ +SVKI+D++ N C+AT+ N K SPF+SLDSRH MLACGTEL
Sbjct: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
            G DAE+++YD++   +P++SF DSHHDDITDIKFH SD + LLSGSTDGY NVYDL QQ
Sbjct: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180

Query: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240
           EE++AL+QVIN+ASIHSCGWLSP+RI+ LSHMETFSI ELND++DEL EP+PL+FGDIR 
Sbjct: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240

Query: 241 PWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299
            WNCDYV+DI+PG I TG +QE    LQ++P   E V+++ +I I RAH DEV+RD  I 
Sbjct: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300

Query: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVL 341
           +    + YS GEDG +  WKS         EFW+Y ++ NV 
Sbjct: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVF 342

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  429 bits (1103), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 197/341 (57%), Positives = 261/341 (76%), Gaps = 1/341 (0%)

Query: 2   SYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISAL 61
           SY+   T  FGSDNWCL LQP Y+  LL++LSNG VH IDW +  S++      +SI+ L
Sbjct: 3   SYSNLHTQDFGSDNWCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSINKL 62

Query: 62  KVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELS 121
           K++D++ + G+++  AS DSV I D+R    +A+++N KN+PF+SLDSRHGMLACGTELS
Sbjct: 63  KIIDSNFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRHGMLACGTELS 122

Query: 122 GTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
           G DAE+H+YD++    P+RSF DSHHDD+TDI+FH SD +VLLSGSTDGY NVYDLKQQE
Sbjct: 123 GVDAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQQE 182

Query: 182 EEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKP 241
           E++ALHQVIN+ASIHSCGWLSPKRI+ LSHMET ++HELNDKSDEL EP+PL+FGDIR+ 
Sbjct: 183 EDDALHQVINYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGDIREK 242

Query: 242 WNCDYVVDIFPGCIITGSTQEQ-SMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHK 300
           W C YVVD++PG +  GS+QE+ S L+L+   NE+++T  S++IP AHG+EVVRD LI  
Sbjct: 243 WGCSYVVDLYPGYVAVGSSQERSSFLKLMALENEQIETEKSLVIPSAHGEEVVRDVLIPP 302

Query: 301 TTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVL 341
               + YS GEDG + +WK+     ++   FW+Y +K++V 
Sbjct: 303 QNCNMLYSCGEDGTVKIWKTKDTGFHIEPGFWDYSKKMDVF 343

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  423 bits (1088), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 271/363 (74%), Gaps = 10/363 (2%)

Query: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           MS    +  SFGS+NWCLK +PLY+ GLL++LSNG + ++DW +      I +  TSI+ 
Sbjct: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60

Query: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120
            ++++N+ + G+  VTA+ +SVKI+DL+ N C+ T+ N KNSPF+SLDS H M+ACGTEL
Sbjct: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
           SG DAE+++YD++  D P+RSF DSHHDDITDIKFH +D  VL+SGSTDGY N+YDL + 
Sbjct: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180

Query: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240
           EEE++LHQVIN++SIHSCGWLS +RI+ LSHMETF+IH+LNDKS+ L EPKP+EFGDIR 
Sbjct: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240

Query: 241 PWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTT--NSIIIPRAHGDEVVRDAL 297
            W C+YV+D++PG I TG T+E +  L++ PF+NE++D    N+IIIP+AHGDEV+RD  
Sbjct: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300

Query: 298 IHKTTSELFYSGGEDGNIVLWK--SNRGSLNVPTEFWNYQEKLNVL-----HDPNIEIDM 350
           I+       YS GEDGN+ LWK  +   SL +P  F++Y  +LNVL     +D +IE+DM
Sbjct: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRLNVLDEINENDDDIEVDM 360

Query: 351 TVE 353
             E
Sbjct: 361 GTE 363

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  422 bits (1086), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 199/345 (57%), Positives = 266/345 (77%), Gaps = 3/345 (0%)

Query: 2   SYTKCDTISFGSDNWCLKLQPLY--SRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSIS 59
           SY+  ++ SFGS+NW LKLQPL   + GLL++LSNG VH +D ++LT+IQ   +  TSI+
Sbjct: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63

Query: 60  ALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTE 119
            L++++++  S   F TA+ +SVKIFD+   + VAT+ +  N PF SLDSRHG+LACGTE
Sbjct: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTE 123

Query: 120 LSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179
           L G DA I++YD++K D P+RS  DSHHDD+T +K+H +DP++LLSGSTDGY NVYDL +
Sbjct: 124 LKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183

Query: 180 QEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIR 239
            EEE++LHQVINFASIHSCGWLSP+RI+ LSHMETF+IHELNDKSD L EP+P++ GD+R
Sbjct: 184 AEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVR 243

Query: 240 KPWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALI 298
           + W CDYVVD++PG I TG +QE Q  L+L+P  +E +D TNSI+IP AH DEV+RD  I
Sbjct: 244 EKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYI 303

Query: 299 HKTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHD 343
               S + Y+ GEDGN+ LWK+N G LNVP + W+Y +++N+L D
Sbjct: 304 PSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLED 348

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  423 bits (1087), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 195/343 (56%), Positives = 257/343 (74%), Gaps = 5/343 (1%)

Query: 4   TKCDTIS---FGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           ++C  I    FGS+NWC ++QPLY  G+L++LSNG VHL+DW S  SI       T+I+A
Sbjct: 2   SQCSQIGSYFFGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINA 61

Query: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120
           L++++ D  +   F+TAS  +VK+FD+R N C+ T+ N   +PF+SLDSR+  +ACGTEL
Sbjct: 62  LQIVNTDWHNETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTEL 121

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
            G DA++H++DL+K+D P +S  DSHHDDIT IKFH SD +VLLSGSTDGY N+YDL Q+
Sbjct: 122 KGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQE 181

Query: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240
           EE+++LHQVINF SIHSCGW++PKRI+ LSHMETF+IHELN+KSDEL EP+PL+FGDIR 
Sbjct: 182 EEDDSLHQVINFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRA 241

Query: 241 PWNCDYVVDIFPGCIITGSTQEQSM--LQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALI 298
            W CDYVVDI+PG + TG + E+    L+L+P   E V   N+I IP AHGDEV+RD  I
Sbjct: 242 AWGCDYVVDIYPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFI 301

Query: 299 HKTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVL 341
            +  SE+ YS GEDG + +W++N G LNVP +FWNY   +NVL
Sbjct: 302 PEQNSEVVYSCGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVL 344

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  421 bits (1082), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 206/351 (58%), Positives = 266/351 (75%), Gaps = 8/351 (2%)

Query: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           MS    + I+FG+DNWCL+L+PLYSRGLL + SNG V+LIDWNS + I+   V  T+I++
Sbjct: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60

Query: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQC-VATVQNAKNSPFISLDSRHGMLACGTE 119
           L+V++ND ++G  F   S  SVKI+D+R     VAT++N KNS F+SL+SRH ML CGTE
Sbjct: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120

Query: 120 LSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179
           L+G DAE+ +YD++    P+R+F DSHHDDITDIKFH SD ++LLSGSTDGY N+YDL Q
Sbjct: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180

Query: 180 QEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIR 239
           ++E+EALHQVIN+ASIHSCGWLSPKRI+ LSHMETF+IHELNDKSDEL EP+PL+FGDIR
Sbjct: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240

Query: 240 KPWNCDYVVDIFPGCIITGSTQEQS-MLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALI 298
             W+CDYVVD++PG +  G + E +  L++  F NE ++T N IIIP AHGDEV+RD  I
Sbjct: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300

Query: 299 HKTT----SELFYSGGEDGNIVLWKSNRGS--LNVPTEFWNYQEKLNVLHD 343
                   S++ YS GEDGN+ +W + R S  LNV  +FWN  E+L+VL D
Sbjct: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSD 351

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  419 bits (1078), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 204/357 (57%), Positives = 271/357 (75%), Gaps = 5/357 (1%)

Query: 3   YTKCDTISFGSDNWCLKLQPL-YSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISAL 61
           Y+  ++ SFGS+NWC K QPL  + GLL +LSNG +H +D+ +  S Q I V   SI+ L
Sbjct: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDL 65

Query: 62  KVLDNDVDSGNTFVTASEDSVKIFDLRLNQC-VATVQNAKNSPFISLDSRHGMLACGTEL 120
           K+L++D   G+ F TA+ +SVKIFD+  N   +AT+ N KN PF+SLDSRHG+LA GTEL
Sbjct: 66  KILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTEL 125

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
            G DA+I++YD++K D P+RS  DSHHDD+T +KFH SDP+VLLSGSTDGY NVYDL QQ
Sbjct: 126 QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185

Query: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240
           +E++ALHQV+N+ASIHSCGWLSP RI+ LSHMETF+IHELNDKS+EL EP+PL+FGD+R+
Sbjct: 186 DEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVRE 245

Query: 241 PWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299
            W CDYV+D++PG I  G +QE    L+L+P + E +   +S++IP AHGDEV+RD  I 
Sbjct: 246 KWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIP 305

Query: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEK-LNVL-HDPNIEIDMTVEK 354
            + SEL YS GEDG + LWK+N G+LNVP +FW+Y ++ ++VL  D ++E    VEK
Sbjct: 306 PSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKRTMHVLDGDFSLESGNEVEK 362

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  370 bits (950), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 181/349 (51%), Positives = 252/349 (72%), Gaps = 7/349 (2%)

Query: 3   YTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALK 62
           Y+   + +FGS+NWCLKLQP+++ G+L+++S+G VHL+  + L+      V  TSI+AL 
Sbjct: 2   YSLAGSCNFGSNNWCLKLQPVHN-GILTSVSSGEVHLLGLD-LSKQDSFKVGETSINALS 59

Query: 63  VLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSG 122
            +D      N F  ++ + VK+FDLR N+ VAT++    +  +SL S HGMLA G+E  G
Sbjct: 60  RVDG---QENLFAASNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQQG 116

Query: 123 TDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
            DA +HL+D++    P+RSF DSH DDIT I FH +D +VLLSGSTDGY NVYDL + EE
Sbjct: 117 VDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEPEE 176

Query: 183 EEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKPW 242
           E+ALHQVIN+ASIHSCGWL+P+RI+ LSHMETF+IHELNDKS+EL EP+PL+FGDIR+PW
Sbjct: 177 EDALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIRQPW 236

Query: 243 NCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHKT 301
           +C+YVVDI+PG I  G ++E +  L+++PF NE V   ++I I +AHGDE+VRD  I  +
Sbjct: 237 DCNYVVDIYPGYISAGVSEEGKGALRIIPFRNEHVQAKDTITISQAHGDEIVRDTYILPS 296

Query: 302 TSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHDPNIEIDM 350
            S++ YS GEDG +  W+ N   L++P  FW+Y  K+++L D   E+ +
Sbjct: 297 QSDMLYSCGEDGQVKAWR-NDIKLDIPETFWDYSTKMSLLSDEVPEVQL 344

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 93/192 (48%), Gaps = 20/192 (10%)

Query: 4   TKCDTISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALK 62
           T   T+ + +DN + L   PL    LLS   + +V L D   +TS ++ PV         
Sbjct: 167 TASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWD---VTSDRNEPVQKWENIHSD 223

Query: 63  VLDNDVDSGN----TFVTASEDS-VKIFDLRLNQCVATVQNAKNSPFISLDSRH---GML 114
           ++ ND    N     F T SEDS ++I D R ++ VAT+   K  PF +L   H    +L
Sbjct: 224 IV-NDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLL 280

Query: 115 ACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNV 174
           A G    G ++E++LYD + ++ P+      H D +T + F + D  ++LS   D  V +
Sbjct: 281 ATG----GVNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVII 335

Query: 175 YDLKQQEEEEAL 186
           +D+     E+ L
Sbjct: 336 WDINDIGAEQVL 347

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 90/175 (51%), Gaps = 28/175 (16%)

Query: 74  FVTASEDSVKIF-DLRLNQCVATVQNAKNSPFISLD-SRHG--MLACGTELSGTDAEIHL 129
           F + S+DS  I  D R+++ V  +   ++ P+ +L  S+H   + A     +GTD+++ L
Sbjct: 222 FGSVSDDSTLIIHDKRIDKPVVKI--LQSEPYNTLAFSKHSSNLFAA----AGTDSQVQL 275

Query: 130 YDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ----QEEEEA 185
           YDL+K +AP+ S    HHD +T ++F      +L SGS+D  V ++DL Q    Q++E+A
Sbjct: 276 YDLRKPEAPIHSMS-GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDA 334

Query: 186 LHQVINFASIH----------SCGWLSPKRIWALSHMETFSIHELNDKSDELVEP 230
              V     +H          SC   SP   W ++ +E  ++ ++   S +L  P
Sbjct: 335 DDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVVQIWKASKKLTSP 386

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 114/253 (45%), Gaps = 30/253 (11%)

Query: 6   CDTISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSI---SAL 61
           C T+S+  DN + L   P     LLSA  +  V L D NS      I ++ T I   S  
Sbjct: 153 CKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSKW 212

Query: 62  KVLDNDVDSGNTFVTASED-SVKIFDLRL---NQCVATVQNAKNSPFISLDSRHGMLACG 117
              D      N F T SED ++++ D R    +  V  V+   N+   S  S++ + A G
Sbjct: 213 HEFDE-----NIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAG 267

Query: 118 TELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177
           T     D  ++LYDL+++  P+ +    H D +T I+F +    +L S  +D  + ++DL
Sbjct: 268 T-----DTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDL 321

Query: 178 KQ----QEEEEALHQVINFASIHSCGW-------LSPKRIWALSHMETFSIHELNDKSDE 226
            Q    Q +E+A   V     +H+           +P+  W ++  E  ++ ++   S +
Sbjct: 322 TQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAEEDNVVQVWKISKK 381

Query: 227 LVEPKPLEFGDIR 239
           LV     E+ D++
Sbjct: 382 LVSNIIPEYTDLK 394

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 89/187 (47%), Gaps = 27/187 (14%)

Query: 16  WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVD----SG 71
           + L   PL    LLS+  +G V    WN   SI  + +  TSI       NDV     + 
Sbjct: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSII------NDVRWNQFNQ 224

Query: 72  NTFVTASEDS-VKIFDLRLNQC-VATVQN-------AKNSPFISLDSRHGMLACGTELSG 122
           N F   +E S + + D+R N   +  V N       A N+   S  S + M A     SG
Sbjct: 225 NLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA-----SG 279

Query: 123 TDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
            D+ I+LYD + ++ P+  +   H D +T + FHA +  +++SG +D  V V+DLKQ  +
Sbjct: 280 EDSLIYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQ 338

Query: 183 EEALHQV 189
           E+   ++
Sbjct: 339 EQTSDEI 345

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 97/206 (47%), Gaps = 21/206 (10%)

Query: 4   TKCDTISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALK 62
           +   T S+  DN + L   P+    LLSA  +G++ + D N+ +   + PV  T  S   
Sbjct: 142 SPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAES---EDPVE-TWQSTDN 197

Query: 63  VLDNDVD----SGNTFVTASED--SVKIFDLRLNQCVATVQNAKNSPFISLD-SRHGMLA 115
            + ND+         F T SE+  ++ I+DLR    V +++  +  PF SL  S+H    
Sbjct: 198 CIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFNSLAFSKHSKNL 255

Query: 116 CGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVY 175
                +GTD  ++LYDL+     + S    H   +T+++FH S   +L+S S D  + ++
Sbjct: 256 FSA--AGTDQNVYLYDLRNTRKTLHSMS-GHEGPVTNLEFHDSVDGILVSSSEDRRIIIW 312

Query: 176 DL----KQQEEEEALHQVINFASIHS 197
           DL     +Q  E+A         IH+
Sbjct: 313 DLMEIGSEQVNEDAQDATPELMMIHA 338

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 127 IHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEE 183
           + ++D    D+P++++   H D+   + F+      LLS + DGY+ +YD+  + E+
Sbjct: 132 VSIFDRNSSDSPVKTYS-YHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/257 (27%), Positives = 110/257 (42%), Gaps = 46/257 (17%)

Query: 10  SFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDV 68
           +F  DN + L   P     LLS   +G + L  WN         V GT+ S  K +    
Sbjct: 158 AFHKDNGYGLSFNPRTKGELLSCSDDGTIAL--WN---------VMGTNTSPSKAVTTHE 206

Query: 69  D----------SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLD-SRHGMLAC 116
           D          + N F + SED +++I D R N  V  +    +SPF +LD S+H     
Sbjct: 207 DIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRL--TLSSPFNTLDFSKHSQNLF 264

Query: 117 GTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD 176
               +GTD+ ++LYDL+     + +    H D +T ++F      +L S  +D  V ++D
Sbjct: 265 AA--AGTDSLVYLYDLRNTADALHTMS-GHEDSVTSLEFSPHKDGILCSSGSDRRVLLWD 321

Query: 177 LKQ----QEEEEALHQVINFASIH----------SCGWLSPKRIWALSHMETFSIHELND 222
           L Q    Q +E+A   V     +H          S  W  P   W ++ +E  +I  +  
Sbjct: 322 LMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIP---WLMASVEEDNIVHVWK 378

Query: 223 KSDELVEPKPLEFGDIR 239
            S +L  P  ++  DIR
Sbjct: 379 VSKKLTSPGLIQDYDIR 395

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 12/111 (10%)

Query: 74  FVTASEDSV-KIFDLRLNQCVATVQNAK-NSPFISLDSRH---GMLACGTELSGTDAEIH 128
           F T SEDS+ KI DLR+     T   AK   PF +L   H    +LA     +GTD+ ++
Sbjct: 224 FGTVSEDSLLKINDLRVENT--TTGTAKCPEPFNTLAFSHHSSNLLAA----AGTDSHVY 277

Query: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179
           LYDL+ +  P+      H D +T+++F      V++S  +D  + ++DLKQ
Sbjct: 278 LYDLRNMKEPLHHMS-GHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQ 327

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 70/267 (26%), Positives = 116/267 (43%), Gaps = 51/267 (19%)

Query: 8   TISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLD- 65
           T+ F  DN + L    L    LLS  S+ H          ++ ++  + TSIS ++  + 
Sbjct: 181 TLKFHKDNGYALSFNALVEGQLLSG-SDDHT--------VALWEVGSNSTSISPVRTWND 231

Query: 66  ------NDVDSGN----TFVTASEDSV-KIFDLRLNQCVATVQNAK-NSPFISLDSRH-- 111
                 ND+   N     F T SEDS+ KI D+R +    T+   K   PF +L   H  
Sbjct: 232 LHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRAHNI--TIDAVKCPQPFNTLAFSHHS 289

Query: 112 -GMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDG 170
             +LA     +G D+ ++LYDL+ +  P+      H D +T+I+F      V++S  +D 
Sbjct: 290 SNLLAA----AGMDSHVYLYDLRNMREPLHHMS-GHEDAVTNIEFSTHVDGVVVSSGSDN 344

Query: 171 YVNVYDLKQ----QEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDE 226
            + ++DLKQ    Q  ++A   V     +H+             H  + +  +LN +   
Sbjct: 345 RLIMWDLKQIGAEQTPDDAEDGVPELIMVHA------------GHRSSVNDFDLNAQIPW 392

Query: 227 LVEPKPLEFGDIRKPWNCDYVVDIFPG 253
           LV     E  +I + W C + + I  G
Sbjct: 393 LVASSEEE--NILQVWKCSHNLPIVGG 417

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 92/200 (46%), Gaps = 31/200 (15%)

Query: 3   YTKCD----TISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTS 57
           Y++ D    T+ F  DN + L   PL    LLS   +  V L D +  +         T 
Sbjct: 146 YSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSD------STTP 199

Query: 58  ISALKVLDNDV--DSG------NTFVTASEDSV-KIFDLRLNQCVATVQNAK-NSPFISL 107
           I     L +D+  DS       + F T SEDS+ KI D+R      T+  AK   PF +L
Sbjct: 200 IRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAENT--TIDTAKCPQPFNTL 257

Query: 108 DSRH---GMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLL 164
              H    +LA     +G D+ ++LYDL+ +  P+      H D +T+++F      V++
Sbjct: 258 AFSHHSSNILAA----AGMDSHVYLYDLRNMKEPLHHMS-GHEDAVTNLEFSPHVDGVVV 312

Query: 165 SGSTDGYVNVYDLKQQEEEE 184
           S  +D  + ++DLKQ   E+
Sbjct: 313 SSGSDNRLIMWDLKQIGAEQ 332

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 93/194 (47%), Gaps = 23/194 (11%)

Query: 2   SYTKCDTISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60
           S  +  T++F  +N + L   P  S  LLS   +  V L D  +    + I      +++
Sbjct: 175 SKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSI------LTS 228

Query: 61  LKVLDNDVD----SGNTFVTASED-SVKIFDLRLN-QCVATVQNAKNSPFISLD-SRHG- 112
              + NDV       N F T SED ++++ D R+  + V  +  A  SPF +L  S+H  
Sbjct: 229 HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA--SPFNTLSFSKHSR 286

Query: 113 -MLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGY 171
            +LA     +G D++I+LYD++ + +P+      H D +T ++F      ++ S  +D  
Sbjct: 287 NLLAA----AGVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRR 341

Query: 172 VNVYDLKQQEEEEA 185
             ++DL Q   E++
Sbjct: 342 AIIWDLTQIGAEQS 355

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 10/107 (9%)

Query: 81  SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGML----ACGTELSGTD-AEIHLYDLKKI 135
           ++ IFD  L +  A V           ++ +G+       G  LSG+D   + L+D++  
Sbjct: 164 TISIFDRTLEESKAQVSTLA----FHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAA 219

Query: 136 DAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
             P +S   SH D + D+K+H  + +V  + S D  + V+D + + E
Sbjct: 220 KKP-KSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLE 265

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 109/242 (45%), Gaps = 30/242 (12%)

Query: 14  DNWCLKLQPLYSRGLLSALSNGHVHLIDWNSL---TSIQDIPVHGTSISALKVLDNDVDS 70
           + + L   P  S  LLSA  +G V L D  S    +  Q   VH   ++  K  +     
Sbjct: 171 NGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEF---Q 227

Query: 71  GNTFVTASED-SVKIFDLRLNQCVA--TVQNAKNSPFISLDSRHGMLACGTELSGTDAEI 127
            + F T SED ++ I D   ++ +   +V +A N+   S  S + + A GT     D+ +
Sbjct: 228 SSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGT-----DSNV 282

Query: 128 HLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL----KQQEEE 183
           +LYDL+++  P+ S    H D +T ++F      +L S  +D  + ++DL     +Q+ +
Sbjct: 283 YLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPD 341

Query: 184 EALHQVINFASIHSCGWLSP--------KRIWALSHMETFSIHELNDKSDELVEP--KPL 233
           +A   V     +H  G  SP           W +  +E  ++ ++   ++++V P   P 
Sbjct: 342 DAYDGVPELFMMHG-GHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPA 400

Query: 234 EF 235
           +F
Sbjct: 401 DF 402

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 63/121 (52%), Gaps = 8/121 (6%)

Query: 113 MLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTD-GY 171
           ML C  + +G    I+L+D++    P+++    H+D I+ ++++  +P+VL +G  D G 
Sbjct: 304 MLLCSADSAG---RINLWDIRNFTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGGL 358

Query: 172 VNVYDLKQQEEEEALH-QVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEP 230
           V ++DL Q E +E +     +   ++   W  P   W +  +   +  ++   S+ LVEP
Sbjct: 359 VKIWDLSQPEGQELIFTHGGHMLGVNDISW-DPHDTWMMCSVANDNSIQVWRPSNSLVEP 417

Query: 231 K 231
           K
Sbjct: 418 K 418

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 74  FVTASEDS-VKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDL 132
           F + SEDS +K+FD R +Q +  +   K    ++       L      +GTD  ++LYD+
Sbjct: 243 FGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSSNLFAA---AGTDNLVYLYDI 299

Query: 133 KKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQV 189
           + +  P+ +    H D +T I+F  ++  +L S  +D    V+DL++   E+   ++
Sbjct: 300 RDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEI 355

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 120 LSGTD-AEIHLYDLKKIDA---PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVY 175
           LSG+D + I L+D+   +    P  +F D+H D I D+K+H+S+  +  S S D  + ++
Sbjct: 196 LSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLF 255

Query: 176 DLKQQE 181
           D +  +
Sbjct: 256 DKRSSQ 261

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 85/189 (44%), Gaps = 30/189 (15%)

Query: 74  FVTASEDSV-KIFDLRLNQCVATVQNAK-NSPFISLDSRH---GMLACGTELSGTDAEIH 128
           F T SEDS+ KI D+R N    T+   K   PF +L   H    +LA     +G D+ ++
Sbjct: 224 FGTVSEDSLLKINDVRANNT--TIDTVKCPQPFNTLAFSHHSSNLLAA----AGMDSYVY 277

Query: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ----QEEEE 184
           LYDL+ +  P+      H D + +++F      V++S  +D  + ++DLKQ    Q  ++
Sbjct: 278 LYDLRNMKEPLHHMS-GHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDD 336

Query: 185 ALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKPWNC 244
           A   V     +H+             H  + +  +LN +   LV     E  +I + W C
Sbjct: 337 AEDGVPELIMVHA------------GHRSSVNDFDLNPQIPWLVASAEEE--NILQVWKC 382

Query: 245 DYVVDIFPG 253
            + + I  G
Sbjct: 383 SHSLPIVGG 391

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 87/180 (48%), Gaps = 18/180 (10%)

Query: 8   TISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIP------VHGTSISA 60
           T+ F  +N + L   P     LLS   +G + L D    +++   P      VH   ++ 
Sbjct: 191 TLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVND 250

Query: 61  LKVLDNDVDSGNTFVTASEDS-VKIFDLR-LNQCVATVQNAKNSPFISLD-SRHGMLACG 117
            K   N+ +S N F + SEDS +++ D R  N  + +++     PF +L  S+H      
Sbjct: 251 CKW--NEFNS-NVFASVSEDSTLQLHDQREQNTIINSIKTT--DPFNTLAFSKHSQYLMA 305

Query: 118 TELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177
              +GTD+ ++LYD + +  P+ S  + H D IT+++F      VL+S   D  V ++D+
Sbjct: 306 A--AGTDSLVYLYDSRNLSVPLYSM-NGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDI 362

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 58/119 (48%), Gaps = 8/119 (6%)

Query: 72  NTFVTASEDS-VKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLY 130
           N F + SEDS +K+ D R    V     AK +      S+H   A     +G D  I+LY
Sbjct: 213 NLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHS--ANLFAAAGLDTNIYLY 270

Query: 131 DLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL----KQQEEEEA 185
           D ++   P+      H D IT ++FH  +  +L+SG  D  V ++DL     +Q+ +EA
Sbjct: 271 DRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEA 328

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 6/110 (5%)

Query: 72  NTFVTASEDS-VKIFDLRL-NQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHL 129
           N F + SEDS +++ D R+ +  V  VQ  K    ++  +    L      +GTD+ ++L
Sbjct: 214 NIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAA---AGTDSMVYL 270

Query: 130 YDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179
           YD ++   P+      H D +T ++FH  +  VL+S  +D    ++DL +
Sbjct: 271 YDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 117 GTELSGTD-AEIHLYDLK-KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNV 174
           G  LSG+D + I L+D+  K   P+ +F D H D + D K+H  D ++  S S D  + +
Sbjct: 168 GKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL 227

Query: 175 YDLKQQEEEEALHQV 189
           +D  Q+  + A+ +V
Sbjct: 228 HD--QRIRDAAVEKV 240

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 88/190 (46%), Gaps = 30/190 (15%)

Query: 17  CLKL--QPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDS---- 70
           CL +   P     LLS  SNG++HL D+    S ++  ++ T      + D + D     
Sbjct: 198 CLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNT------IWDTNFDDLGCN 251

Query: 71  --------GNTFVTASEDS-VKIFDLRLNQCVATVQNAKNSPFIS---LDSRHGMLACGT 118
                    + F T  E++ + +FD R    V +++   ++  I+    +  + ML    
Sbjct: 252 EVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLASG 311

Query: 119 ELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGST-DGYVNVYDL 177
           + +G    I+L+D++K++ P+R+    H   I+ I++      ++ SG   DG V ++D+
Sbjct: 312 DSNGI---INLWDIRKLNKPIRNL--YHGSSISTIEWSPLMNEMIASGGQEDGLVKLWDI 366

Query: 178 KQQEEEEALH 187
             +EE   +H
Sbjct: 367 SNEEEPIFIH 376

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 93/207 (44%), Gaps = 38/207 (18%)

Query: 19  KLQPLYSRG--LLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVT 76
           ++  LY  G  L++A  +  +   D  S   IQ   V+  S+SA K         ++F+ 
Sbjct: 501 EVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYK---------SSFMK 551

Query: 77  ASEDSVKIFDLRLNQCVATVQNAKNSPFI-SLDSRHGMLACGTELSGTDAEIHLYDLKKI 135
           ++EDS+          + TV    N+P I S+ S    LA GT+    D  I L+D++  
Sbjct: 552 SNEDSM---------ILKTV----NTPIIGSIQSFDAALATGTK----DGLIRLWDMRT- 593

Query: 136 DAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASI 195
              +    + H D IT +KF   D + ++SGS DG + ++DL+       L  +I++   
Sbjct: 594 -GEVVRVLEGHMDAITSLKF---DATTIISGSLDGTIRLWDLRSNN----LTDIISYEKP 645

Query: 196 HSCGWLSPKRIWALSHMETFSIHELND 222
            S      K I   S+     I++ ND
Sbjct: 646 ISSLDFDAKHIVVASNEHNTHIYDRND 672

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 120 LSGTDAEIHLYDLKK---IDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD 176
           + GT   + +YD+ K   ++ P+ +    H   I  + F+ +  S+L+SGS DG + V+D
Sbjct: 183 ICGTSTSVSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGCIKVWD 242

Query: 177 LKQQE 181
           L+  +
Sbjct: 243 LRSSQ 247

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 59/121 (48%), Gaps = 8/121 (6%)

Query: 113 MLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLL-SGSTDGY 171
           +L C  + +G    I+L+D++   +P+RS    HH  ++ ++++   P++L  +G  DG 
Sbjct: 304 LLLCSADSAG---RINLWDIRDFSSPIRSL--DHHGSVSALQWNPHHPTILATAGQDDGL 358

Query: 172 VNVYDLKQQEEEE-ALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEP 230
           V ++DL Q  ++E       +   ++   W  P   W +  +   +  +L   S  L+ P
Sbjct: 359 VKIWDLSQPVDQELKFTHGGHMLGVNDISW-DPNDPWMMCSVSNDNSIQLWKPSQNLMTP 417

Query: 231 K 231
           K
Sbjct: 418 K 418

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 64/128 (50%), Gaps = 14/128 (10%)

Query: 58  ISALKVLDNDVDSGNTFVTASEDSV-KIFDLRLNQCVATVQNAKNSPFISLDSRHGMLAC 116
           I+ALK+  +    G     AS+  + KIFDLR  + V +++ +  S  +  DS   +LA 
Sbjct: 63  ITALKLTAD----GRYLCFASQAQLLKIFDLREGKIVRSMKISSPSYVVDSDSTSTLLAI 118

Query: 117 GTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPS---VLLSGSTDGYVN 173
           G    GTD  I + D++  +  +      H   I+ +KF+        +L SG T+G V 
Sbjct: 119 G----GTDGSITVVDVE--NGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVK 172

Query: 174 VYDLKQQE 181
           ++DL +++
Sbjct: 173 IWDLVKRK 180

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 120 LSGTDAEIHLYDLKK---IDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD 176
           + GT   + +YD+ +   +D P       H   I  + F+ +  S+L+SGS DG + V+D
Sbjct: 183 ICGTSTSVSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCIKVWD 242

Query: 177 LKQQE 181
           L+  +
Sbjct: 243 LRSSQ 247

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 7/107 (6%)

Query: 71  GNTFVTASEDSVK-IFDLRLNQCVATVQN-AKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           G    +   DS+  ++DLR  + + T+Q  AK    +   S    LA G    G D  ++
Sbjct: 320 GALICSGGLDSLAMVWDLRSGKNIVTLQGHAKPVYCVDWSSNSHQLATG----GGDGVVN 375

Query: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVY 175
           ++DL+K++ P      +H   ++ ++F  +   VL+SG  D  +NVY
Sbjct: 376 VWDLRKLEQPATKLL-AHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 3/66 (4%)

Query: 120 LSGTDAEIHLYDLKK---IDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD 176
           + GT   + +YD+ K   ID P+ +    H   I  + F+ S  ++L+SG  DG + V+D
Sbjct: 199 ICGTSTSVSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCIKVWD 258

Query: 177 LKQQEE 182
           L+  + 
Sbjct: 259 LRSSQR 264

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 60/143 (41%), Gaps = 8/143 (5%)

Query: 42  WNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKN 101
           W +  S Q +  H +  S    +  + +  N F   S   V++F  R  Q + T    K+
Sbjct: 27  WRAYGSTQLVKEHNSVTS----IAFNPNHPNDFAITSSTRVQLFSSRTRQVIKTFSRFKD 82

Query: 102 SPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPS 161
             + +   + G L    + +G    + +YD     A + S   S H      KFH +D  
Sbjct: 83  VVYSASFRQDGKLLAMGDATG---RVSVYDSYNPRAQLVSIAASSHPTHV-AKFHPADSR 138

Query: 162 VLLSGSTDGYVNVYDLKQQEEEE 184
            L++ S D  V V+D+ Q +E +
Sbjct: 139 TLVTASDDRVVRVWDITQAQEPQ 161

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 62/120 (51%), Gaps = 10/120 (8%)

Query: 70  SGNTFVTASED-SVKIFDLRLNQCVA---TVQNAKNSPFISLDSRHGMLACGTELSGTDA 125
           +GNTF + SED ++++ D R+   V        A N+   S  S +   A     +GTD+
Sbjct: 211 NGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAA-----AGTDS 265

Query: 126 EIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEA 185
            I+LYD ++    + +    H  ++T+++F+A+   +++S   D  V ++DL +   E+ 
Sbjct: 266 LIYLYDSRRTGNVLHTMS-GHESNVTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQV 324

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 69/157 (43%), Gaps = 42/157 (26%)

Query: 48  IQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIF--DLRLNQCV------------ 93
           I +  +H   I+AL             ++ S+D  KIF  DL   +CV            
Sbjct: 420 IHNFELHNDEITALSF------DSEALISGSKDK-KIFHWDLATGKCVQELNLIFTPTHN 472

Query: 94  ---ATVQNAKNSPFI---------SLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRS 141
               + ++ KN  ++         +L   +  LA GT+    D  + L+DL+ I  P+RS
Sbjct: 473 DTKTSTRSGKNGTYLLGTEAPMIGALQCYNSALATGTK----DGVVRLWDLR-IGKPVRS 527

Query: 142 FCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
             + H D IT +KF   D   L++GS D  V ++DL+
Sbjct: 528 L-EGHTDGITSLKF---DSEKLVTGSMDNSVRIWDLR 560

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 84/187 (44%), Gaps = 16/187 (8%)

Query: 14  DNWCLKLQPLYSRG-LLSALSNGHVHLIDWNSLTSIQDI-PVHGTSISALKVLDNDVDSG 71
           + + L   PL   G LL+   +G V+    ++   + D  P   ++  +++ +       
Sbjct: 280 EGYALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEA 339

Query: 72  NTFVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEI 127
             F TA  D  ++++D R  +    ++T  +  +   IS + + G L    + +GT    
Sbjct: 340 TVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGT---W 396

Query: 128 HLYDLKKIDA------PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
            ++DL++         P+  + D H   IT I FH +D S++   S D  V ++DL  + 
Sbjct: 397 GVWDLRQFSPSNENAQPVAQY-DFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEA 455

Query: 182 EEEALHQ 188
           ++E + Q
Sbjct: 456 DDEEIKQ 462

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/61 (21%), Positives = 32/61 (52%)

Query: 140 RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCG 199
           + F  S++  I DI++  ++ +V  +   DGY+ V+D + ++ + A+    +   ++   
Sbjct: 319 QPFTVSNNKSIEDIQWSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVIS 378

Query: 200 W 200
           W
Sbjct: 379 W 379

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 59/112 (52%), Gaps = 10/112 (8%)

Query: 73  TFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDL 132
           T+V+ ++  +KIF L+  + V +++ +  S  +  DS   +LA G    GTD  I + D+
Sbjct: 77  TYVSQAQ-LLKIFQLKTGKVVRSMKISSPSYILDTDSTSTLLAVG----GTDGSIIVVDI 131

Query: 133 KKIDAPMRSFCDSHHDDITDIKFHASDPS---VLLSGSTDGYVNVYDLKQQE 181
           +  +  +      H   I+ +KF+    S   +L SG T+G V V+DL +++
Sbjct: 132 E--NGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRK 181

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 61/153 (39%), Gaps = 21/153 (13%)

Query: 33  SNGHVHLI-DWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQ 91
           S G   L+ + NS+TSI   P H                 N F   S   V++F  R  Q
Sbjct: 29  SYGSTQLVKEHNSVTSISFNPTHP----------------NDFAITSSTRVQLFSSRTRQ 72

Query: 92  CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDIT 151
            + T    K+  + +   + G L    + +G    + +YD       + S   S H    
Sbjct: 73  VIKTFSRFKDVVYSASFRQDGKLLAMGDATG---RVSIYDSYNPRTQLVSIAASSHPTHV 129

Query: 152 DIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
             KFH +D   L++ S D  V V+D+ Q +E +
Sbjct: 130 -AKFHPADSRTLVTASDDRVVRVWDITQAQEPQ 161

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 64/131 (48%), Gaps = 17/131 (12%)

Query: 53  VHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHG 112
           VH +SI A+         GN        +   F  + + C     NA     +  +  + 
Sbjct: 250 VHHSSILAV------CGEGNGLTILDTRTPTTFSTKRHSCHTGGINA-----VQFNYDND 298

Query: 113 MLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLS-GSTDGY 171
            L C  +  GT   +++ D+++++ P++++  SH D ++ I+++   P+V+ S G  DG 
Sbjct: 299 FLLCSADSEGT---LNICDIRQLEHPVKTW--SHLDAVSTIQWNPKFPTVIASAGQNDGL 353

Query: 172 VNVYDLKQQEE 182
           V ++DL Q+++
Sbjct: 354 VKIWDLAQEDD 364

>NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa]
           {ON} Anc_1.247
          Length = 589

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 19/124 (15%)

Query: 74  FVTASED-SVKIFDLRLNQCVATVQ---------NAKNSPFISLDSRHGMLACGTELSGT 123
            ++AS D S++ +DL    CV T++         N K+S   +L S    LA G++    
Sbjct: 404 LLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSK---- 459

Query: 124 DAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEE 183
           D  I L+DL+     +R+    H   IT ++F   D + +++GSTD  ++V DL+     
Sbjct: 460 DGIIRLWDLRS-GKVVRTLL-KHQGPITSLQF---DSTKIITGSTDANISVSDLRTGNIL 514

Query: 184 EALH 187
           E  H
Sbjct: 515 ETYH 518

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 65/131 (49%), Gaps = 8/131 (6%)

Query: 72  NTFVTASEDS-VKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLY 130
           N F + SEDS +++FD R N   + V+ +    + S+ +  G        +GT   I+LY
Sbjct: 212 NMFGSVSEDSTLQLFDKR-NGGKSDVKISSKGQYNSI-AFSGFSENLFAAAGTTNNIYLY 269

Query: 131 DLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL----KQQEEEEAL 186
           D++     + S    H + +T ++F      +L+SGS+D  V ++DL     +Q+ +EA 
Sbjct: 270 DIRNTGKILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEAD 328

Query: 187 HQVINFASIHS 197
             +     IH+
Sbjct: 329 DGLPEVMMIHA 339

>KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}
           Anc_7.534 YPR178W
          Length = 461

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 67/139 (48%), Gaps = 15/139 (10%)

Query: 79  EDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAP 138
           +++  ++D+R  + + T+ N  + P   +D         T   G D  I+++D++K +  
Sbjct: 326 DNTALLWDIRCGKSIMTL-NGHSKPVYCVDWSCNGYNVAT--GGGDGLINIWDIRKTN-- 380

Query: 139 MRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD----LKQQEEEEALHQVI---- 190
           + +   +H++ I+D++F   D   L+S S D  +N+Y     LK +  E   H ++    
Sbjct: 381 LVNTILAHNNIISDLRFAKQDSKCLVSCSYDKKINIYSSDNWLKVKTLEGHSHNILSVDM 440

Query: 191 --NFASIHSCGWLSPKRIW 207
             N  ++ S GW    ++W
Sbjct: 441 TNNAKALISGGWDRSVKLW 459

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 4/107 (3%)

Query: 72  NTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLD-SRHGMLACGTELSGTDAEIHLY 130
           N F + SEDS      +  +   T Q   ++PF +L  S+H         +GTD+ ++L+
Sbjct: 232 NVFGSVSEDSTLQLHDQREKDTFTSQFKVDAPFNTLAFSKHSQYLFAA--AGTDSHVYLF 289

Query: 131 DLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177
           D + I  P+ S    H   +T+++F      +L++   D    ++D+
Sbjct: 290 DRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 59/112 (52%), Gaps = 10/112 (8%)

Query: 73  TFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDL 132
           T+V+ ++  +KIF L+  + V +++ +  S  +  DS   +LA G    GTD  I + D+
Sbjct: 77  TYVSQAQ-LLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDI 131

Query: 133 KKIDAPMRSFCDSHHDDITDIKFHASDPS---VLLSGSTDGYVNVYDLKQQE 181
           +  +  +      H   I+ +KF+    S   +L SG T+G V V+DL +++
Sbjct: 132 E--NGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDLVKRK 181

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 72/151 (47%), Gaps = 18/151 (11%)

Query: 71  GNTFVTASEDSV-KIFDLRLNQCVATVQN-AKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           G+   +A  DS+ +I+D+R  Q +  ++  AK    +S       +A G+     D  + 
Sbjct: 322 GSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGS----ADGTVK 377

Query: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD----LKQQEEEE 184
           ++D++K+  P      +H++ ++D+KF       L+S S D  V+V+     L+    + 
Sbjct: 378 VWDIRKVGNPFSIL--AHNNIVSDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLASLKG 435

Query: 185 ALHQVI------NFASIHSCGWLSPKRIWAL 209
              +V+      +F+ ++S GW    ++W L
Sbjct: 436 HTDKVMSIDISHDFSHLYSSGWDRSVKLWKL 466

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 59/112 (52%), Gaps = 10/112 (8%)

Query: 73  TFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDL 132
           T+V+ ++  +KIF L+  + V +++ +  S  +  DS   +LA G    GTD  I + D+
Sbjct: 77  TYVSQAQ-LLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDI 131

Query: 133 KKIDAPMRSFCDSHHDDITDIKFHASDPS---VLLSGSTDGYVNVYDLKQQE 181
           +  +  +      H   I+ +KF+    S   +L SG T+G V V+DL +++
Sbjct: 132 E--NGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRK 181

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 53/103 (51%), Gaps = 9/103 (8%)

Query: 82  VKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRS 141
           +KIF L+  + V +++ +  S  +  D    +LA G    GTD  I + D++  +  +  
Sbjct: 85  LKIFQLKTGRIVRSLKISSPSYILDTDPTSTLLAVG----GTDGSIVIVDIE--NGYITH 138

Query: 142 FCDSHHDDITDIKFHA---SDPSVLLSGSTDGYVNVYDLKQQE 181
               H   I+ +KF+    S+  +L SG T+G V V+DL +++
Sbjct: 139 SLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKRK 181

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 60/112 (53%), Gaps = 10/112 (8%)

Query: 80  DSVKIFDLRLNQCVATVQNAKNSPFIS---LDSRHGMLACGTELSGTDAEIHLYDLKKID 136
           DS+ +FD R    VA ++N   S  I+    +  + +L   T+ +G     +L+D++K+ 
Sbjct: 272 DSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLASTDSTG---RTNLWDVRKLS 328

Query: 137 A-PMRSFCDSHHDDITDIKFHASDPSVLL-SGSTDGYVNVYDLKQQEEEEAL 186
           A P+  F   H   ++ ++++  D SVL  +G +DG + ++D   + E++ +
Sbjct: 329 AEPIVHF--DHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTSLEIEDKTI 378

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 120 LSGTDAEIHLYDLKK---IDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD 176
           + GT   + +YD+ K   ID P+ +    H   I  + F+    S+L+SG  DG + ++D
Sbjct: 195 ICGTSTSVAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCIKIWD 254

Query: 177 LK 178
           L+
Sbjct: 255 LR 256

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 120 LSGTDAEIHLYDLKK---IDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD 176
           + GT   + +YD+ +   I +P+ +    H   I  + F+    ++++SG  DGY+ V+D
Sbjct: 211 ICGTSTSLSIYDINRTSDIGSPLVATYSEHSRSINSVDFNMGQTNLIISGGQDGYIKVWD 270

Query: 177 LK 178
           L+
Sbjct: 271 LR 272

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 10/78 (12%)

Query: 102 SPFI-SLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDP 160
           +P I +L   +  LA GT+    D  + L+DL+ I  P+R+  + H D IT +KF   D 
Sbjct: 491 APMIGALQCYNSALASGTK----DGVVRLWDLR-IGKPVRAL-EGHTDGITSLKF---DS 541

Query: 161 SVLLSGSTDGYVNVYDLK 178
             L++GS D  V ++DL+
Sbjct: 542 EKLVTGSMDNSVRIWDLR 559

>Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,
           581 aa] {ON} complement(43262..43506,43751..45251) [1746
           nt, 582 aa]
          Length = 581

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 48/111 (43%), Gaps = 4/111 (3%)

Query: 74  FVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK 133
           F   S   V+IF  R  Q V T    K+  + +     G L C  + +G  +    Y+ +
Sbjct: 55  FAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYSASFRNDGKLLCAGDATGLVSVYDSYNPR 114

Query: 134 KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
            +   +++   +H   +T  KFH  DP  L++ S D    ++D+    E +
Sbjct: 115 VLLLSIKA--STHPTHVT--KFHTQDPKTLITASDDRVTRLWDISHAYEPQ 161

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 66/153 (43%), Gaps = 7/153 (4%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVA 94
             +HL D N    I ++     +I+++K   N+VD   +  T S++++ ++DLR N    
Sbjct: 192 AQIHLWDSNRSKPISNLSWGADNITSVKFNQNEVDILAS--TGSDNAIVLYDLRTNSPTQ 249

Query: 95  TVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIK 154
            +     +  I  +    M A    ++  D   + YD++ +   +  F D H   + D+ 
Sbjct: 250 KIIQTMRTNAICWNP---MEAFNFVIANEDHNAYYYDMRNMSRALHVFKD-HVSAVMDVD 305

Query: 155 FHASDPSVLLSGSTDGYVNVYDLKQQEEEEALH 187
           F  +   + ++GS D  + ++        E  H
Sbjct: 306 FSPTGDEI-VTGSYDKTIRIFKTNHGHAREVYH 337

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 2/71 (2%)

Query: 125 AEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
           A+IHL+D  +   P+ +      D+IT +KF+ ++  +L S  +D  + +YDL+     +
Sbjct: 192 AQIHLWDSNR-SKPISNLSWGA-DNITSVKFNQNEVDILASTGSDNAIVLYDLRTNSPTQ 249

Query: 185 ALHQVINFASI 195
            + Q +   +I
Sbjct: 250 KIIQTMRTNAI 260

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 83/187 (44%), Gaps = 16/187 (8%)

Query: 14  DNWCLKLQPLYSRG-LLSALSNGHVHLIDWNSLTSIQD-IPVHGTSISALKVLDNDVDSG 71
           + + L   PL   G LL+   +G V+L   ++   + D  P    +  +++ +       
Sbjct: 281 EGYGLDWSPLIKTGALLTGDCSGMVYLTQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTES 340

Query: 72  NTFVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEI 127
             F TA  D  ++I+D R  +    ++TV +  +   IS + + G L    +  GT    
Sbjct: 341 TVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGT---W 397

Query: 128 HLYDLKKIDA------PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
            ++DL++         P+  + D H   IT I F+  D S++   S D  V ++DL  + 
Sbjct: 398 GIWDLRQFSPNSEKALPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEA 456

Query: 182 EEEALHQ 188
           ++E + Q
Sbjct: 457 DDEEIKQ 463

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/59 (18%), Positives = 31/59 (52%)

Query: 142 FCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGW 200
           F   ++  I DI++  ++ +V  +   DGY+ ++D + ++ +  +  V++   ++   W
Sbjct: 322 FTVGNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISW 380

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 87/189 (46%), Gaps = 19/189 (10%)

Query: 14  DNWCLKLQPLYSRG-LLSALSNGHVHLIDWNSLTSIQDI-PVHGTSISALKVLDNDVDSG 71
           + + L   PL   G LL+   +G V+L   ++   + D  P   ++  +++ +       
Sbjct: 278 EGYGLDWSPLIKTGALLTGDCSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTES 337

Query: 72  NTFVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHG-MLACGTELSGTDAE 126
             F T+  D  ++I+D R  +    ++T  +A +   IS + + G +LA G +    D  
Sbjct: 338 TVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDD----DGR 393

Query: 127 IHLYDLKKIDA-------PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179
             ++DL+++         P+  + D H   IT I F+  D S++   S D  V ++DL  
Sbjct: 394 WGVWDLRQLSPNNSENVQPVAQY-DFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSV 452

Query: 180 QEEEEALHQ 188
           + ++E + Q
Sbjct: 453 EADDEEIKQ 461

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/61 (19%), Positives = 32/61 (52%)

Query: 140 RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCG 199
           + F  S++  I DI++  ++ +V  +   DGY+ ++D + ++ + A+    +   ++   
Sbjct: 317 QPFTFSNNKSIEDIQWSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVIS 376

Query: 200 W 200
           W
Sbjct: 377 W 377

>Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W
           (REAL)
          Length = 205

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 57/144 (39%), Gaps = 21/144 (14%)

Query: 105 ISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLL 164
           ISL+    +LA G    G D    L+D+  +D P++ F   H   +  I F     S+L 
Sbjct: 8   ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 63

Query: 165 S--GSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELND 222
           +  GS D  +  +          L ++     + S        IW+L H +  +     D
Sbjct: 64  TGGGSKDRCIKFW---HTSTGTLLDEIYTSGQVTSL-------IWSLRHKQIVATFGFGD 113

Query: 223 KSDELV-----EPKPLEFGDIRKP 241
             + ++      PK L+  ++R P
Sbjct: 114 TKNPVLITLYSYPKLLKLLEVRSP 137

>KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 459

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 76/150 (50%), Gaps = 18/150 (12%)

Query: 71  GNTFVTASEDSVK-IFDLRLNQCVATVQNAKNSPFISLD-SRHG-MLACGTELSGTDAEI 127
           G+   TA  D++  I+D+R  + + ++Q   + P  S+D S++G  LA G+     D  I
Sbjct: 317 GSLVSTAGLDAIALIWDIRSGKNIMSLQ-GHSKPIYSVDWSQNGYQLASGS----GDGTI 371

Query: 128 HLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD----LKQQEEE 183
            ++D++K    + +   +H+  ++ +KF+  +   L+S   D  VN+++    +K++  E
Sbjct: 372 KVWDIRK-KGNVETIL-AHNSIVSQVKFNKQNGGYLVSSGYDKKVNIFNDGNWIKERSLE 429

Query: 184 EALHQVINF----ASIHSCGWLSPKRIWAL 209
             L +V++       I+S GW      W +
Sbjct: 430 GHLDKVMSIDIVGPDIYSAGWDRSVNKWGV 459

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 67/150 (44%), Gaps = 17/150 (11%)

Query: 71  GNTFVTASEDSVKI-FDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHL 129
           G+   TA  D V I +DLR  + + ++       + S  S++G     +     D  I +
Sbjct: 322 GSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXS----GDGTIKI 377

Query: 130 YDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD--------LKQQE 181
           +DL+K+D         H + +TD+KF   +   L+S S D  +NV+           Q  
Sbjct: 378 WDLRKVDDVETILA--HKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGH 435

Query: 182 EEEALHQVI--NFASIHSCGWLSPKRIWAL 209
            ++ L   I  ++ +I S GW    ++W++
Sbjct: 436 NDKILSIDISSDYQTIVSGGWDRSVKLWSM 465

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 76  TASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKI 135
           T S++S+ ++DLR N     +  +  S  I  +    M A    ++  D   + YD++ +
Sbjct: 232 TGSDNSIVLYDLRTNSPTQKIVQSMRSNAICWNP---MEAFNFVIANEDHNAYYYDMRNM 288

Query: 136 DAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALH 187
              +  F D H   + D+ F  +    L++GS D  + +YD+      E  H
Sbjct: 289 SRALNVFKD-HVSAVMDVDFSPTGTE-LVTGSYDKTIRIYDIGHGHSREIYH 338

>CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 aa]
            {ON} similar to uniprot|P38873 Saccharomyces cerevisiae
            YHR186c
          Length = 1527

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 65/132 (49%), Gaps = 10/132 (7%)

Query: 25   SRGLLSALSNGHVHLID-WNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTA-SEDSV 82
            SRG  S L  G V +I  W++L+   ++ +   + S    L +D  +GN FV   S+ ++
Sbjct: 1285 SRG--SLLVTGDVKIIRVWDALSESLEVDIPAKTSSLFTSLTSDQVAGNIFVAGFSDGTI 1342

Query: 83   KIFDLRLNQCVATVQNAKNS---PFISLDSRHGMLACGTEL--SGTDAEIHLYDLKKIDA 137
            +++D R +  +A V+  +     P   +++ H       EL    T+  + L+D++  D 
Sbjct: 1343 RVYDRRTDPRLAMVRRWRGGGGKPGAWINNVHMQRGGYRELVSGSTNGVVELWDIRH-DQ 1401

Query: 138  PMRSFCDSHHDD 149
            P+ ++ D +  D
Sbjct: 1402 PVATYVDENKKD 1413

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 75/179 (41%), Gaps = 14/179 (7%)

Query: 17  CLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA-----LKVLDNDVDSG 71
            L+  P     L SA +NG + + D N   S  D       I+      +K +  +    
Sbjct: 118 TLRFNPKQQNVLASAGNNGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLA 177

Query: 72  NTFVTASEDS--VKIFDLRLNQCVA----TVQNAKNSPFISLDSRHGMLACGTE-LSGTD 124
           + F +A + +    I+DL+  + V     T       P +++   H  +       SG+D
Sbjct: 178 HVFASAGDTTTYASIWDLKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSD 237

Query: 125 AE--IHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
           ++  I ++DL+  + PM +    H   I  + +   D S+LLS   DG V ++D K  E
Sbjct: 238 SDPVILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWDTKANE 296

>Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON}
           (27192..29201) [2010 nt, 670 aa]
          Length = 669

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 68/149 (45%), Gaps = 34/149 (22%)

Query: 55  GTSISALK--------VLDNDVDSGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPF- 104
           GT +SALK         LD D   G  +     D ++K++DL  ++ + +  NA  S   
Sbjct: 342 GTVLSALKNAHENNITCLDFDEPFGTLYSAGQLDNTIKVWDLSSSKFIGSF-NAHLSTIN 400

Query: 105 -ISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSF---------------CDSHHD 148
            + LD++  ++  G    G D+ + L+D+KK      ++               CDSH D
Sbjct: 401 CMQLDTQQQIIISG----GRDSLVRLWDIKKFQDYSTNYNDIENYYEETNCIFECDSHSD 456

Query: 149 DITDIKFHASDPSVLLSGSTDGYVNVYDL 177
           +I+ I +   D   LL+GS D  +  +DL
Sbjct: 457 EISSISY---DNFNLLTGSQDKTIKHWDL 482

>NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa]
           {ON} Anc_1.247 YJL112W
          Length = 668

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 71/162 (43%), Gaps = 41/162 (25%)

Query: 54  HGTSISALKVLDNDVDSGNTFVTASED-SVKIFDLRLNQCVATVQN-------------- 98
           H   I+AL         G   ++AS D +V+ +D+   +C  T+                
Sbjct: 452 HSDEITALSF------DGEYLISASRDKTVRQYDIISGKCFQTLATNFGSISKTNGDMLM 505

Query: 99  AKNSPFI-SLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHA 157
           ++NSP + +L   +  L  G+    +D    L+DL+ I   +RS  + H+  IT ++F  
Sbjct: 506 SRNSPVVGALQYYNTALITGS----SDGIARLWDLR-IGKVVRSM-EGHNGAITSLQF-- 557

Query: 158 SDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCG 199
            DP  L + STDG + V+DL+             +  +H CG
Sbjct: 558 -DPIKLTTSSTDGDIRVWDLR----------TAGWLELHPCG 588

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 72/161 (44%), Gaps = 31/161 (19%)

Query: 53  VHGTSISALKVLDNDVDSGNTFVTAS--EDSVKIFDLRLNQCVATVQNAKNS-PFISLDS 109
            H  SI+ L        S NT  TA+  +++VKI+DL   + + +    K +   + + +
Sbjct: 349 AHTDSITCLDF----AKSWNTLCTAANYDNTVKIWDLSTTEQLGSFSGHKATINCLQMSN 404

Query: 110 RHGMLACGTELSGTDAEIHLYDL---------------KKIDAPMRSFCDSHHDDITDIK 154
            + +L  G++    DA + ++++               +K ++P     DSH D+IT + 
Sbjct: 405 NNSLLMTGSK----DATVKVWNIDLGIELAKKENNQLEEKDESPCVLTFDSHSDEITALS 460

Query: 155 FHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASI 195
           F   D   L+S S D  V  YD+   +  + L    NF SI
Sbjct: 461 F---DGEYLISASRDKTVRQYDIISGKCFQTL--ATNFGSI 496

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 10/78 (12%)

Query: 102 SPFI-SLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDP 160
           +P I +L   +  LA GT+    D  + L+DL+ +  P+R   + H D IT +KF   D 
Sbjct: 489 APMIGALQCYNSALATGTK----DGIVRLWDLR-VGKPVR-LLEGHTDGITSLKF---DS 539

Query: 161 SVLLSGSTDGYVNVYDLK 178
             L++GS D  V ++DL+
Sbjct: 540 EKLVTGSMDNSVRIWDLR 557

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 89/191 (46%), Gaps = 29/191 (15%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  S ++L    +    G+  VTASED  +K++D+    C+
Sbjct: 325 GQLLVYEWQSESYILKQQGHFDSTNSLAYSPD----GSRVVTASEDGKIKVWDITSGFCL 380

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
           AT +   +S      ++ G +   + L GT   +  +DL +     R+F  +       I
Sbjct: 381 ATFEEHTSSVTAVQFAKRGQVMFSSSLDGT---VRAWDLIRY-RNFRTFTGTER-----I 431

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEALH------QVINFAS----IHSC 198
           +F+  A DPS  V+ +GS D + ++V+ ++  +  +AL         ++F+     + S 
Sbjct: 432 QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASA 491

Query: 199 GWLSPKRIWAL 209
            W    RIW++
Sbjct: 492 SWDKTIRIWSI 502

>ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 510

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 48/112 (42%), Gaps = 6/112 (5%)

Query: 74  FVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK 133
           F   S   V++F  R  Q + T    K+  + +     G L C  + +G    + +YD  
Sbjct: 55  FAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDATGL---VSVYDSY 111

Query: 134 KIDAPMRSF-CDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
              A + S    +H   +T  KFH+ D   L++ S D    V+D+ Q  E +
Sbjct: 112 NPRALLVSINASTHPTHVT--KFHSHDSKSLVTASDDRITRVWDISQSYEPQ 161

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 10/84 (11%)

Query: 99  AKNSPFI-SLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHA 157
            +N P I +L      LA GT+    D  I L+DL+  +   +     H D IT +KF  
Sbjct: 578 VENKPIIGALQCFDSALATGTK----DGIIRLWDLRSGEIARKLI--GHQDAITSLKF-- 629

Query: 158 SDPSVLLSGSTDGYVNVYDLKQQE 181
            D + ++SGS DG   ++DL+Q +
Sbjct: 630 -DTNNIISGSLDGSTRIWDLRQDQ 652

>Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON}
           YJL112W (REAL)
          Length = 714

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 66/149 (44%), Gaps = 39/149 (26%)

Query: 54  HGTSISALKVLDNDVDSGNTFVTASED-SVKIFDLRLNQCVATV---------------- 96
           H   I+AL  LD+D       V+ S+D +++ +DLR  +C+  +                
Sbjct: 501 HIDEITALS-LDSDF-----LVSGSQDRTIRQWDLRSGKCMQAIDLSFANVSSTATNVDL 554

Query: 97  -------QNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDD 149
                  Q ++     +L S    LA GT+    D  + L+DL+     +    + H D 
Sbjct: 555 SKSTLLTQRSERPSIGALQSFDAALATGTK----DGVVRLWDLRS--GKVIRTLEGHTDA 608

Query: 150 ITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           IT +KF   D + L++GS D  V V+DL+
Sbjct: 609 ITSLKF---DSACLVTGSYDRTVRVWDLR 634

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 78/184 (42%), Gaps = 38/184 (20%)

Query: 44  SLTSIQDIPVHGTSISALK--------VLDNDVDSGNTFVTAS--EDSVKIFDLRLNQCV 93
           S  + Q +   GT I +++         LD D   G T  TA   + +VKI+DL   + +
Sbjct: 376 SFPTFQQLYEPGTKIGSIESTHDDFITCLDFDAPFG-TLCTAGYLDHTVKIWDLSKQKKL 434

Query: 94  ATVQN-AKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK-----------------KI 135
             +         + +D  +G L  G    G DA + L++L                   I
Sbjct: 435 GELAGHLATINCMQIDRDNGTLVTG----GRDAALKLWNLSLAQQLYQETQNITSPTSHI 490

Query: 136 DAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASI 195
           D+P     +SH D+IT +     D   L+SGS D  +  +DL+  +  +A+   ++FA++
Sbjct: 491 DSPCVYTFESHIDEITALSL---DSDFLVSGSQDRTIRQWDLRSGKCMQAID--LSFANV 545

Query: 196 HSCG 199
            S  
Sbjct: 546 SSTA 549

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 4/111 (3%)

Query: 74  FVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK 133
           F   S   V+IF  R  Q + T    K+  + +     G L C  + +G  +    Y+ +
Sbjct: 55  FAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPR 114

Query: 134 KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
            I   M +   +H   +T  KFH  D  +L + S D    ++D+    E +
Sbjct: 115 TILLSMNA--STHPTHVT--KFHTQDSKILATASDDRVTRLWDISNAYEPQ 161

>SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {ON}
           similar to uniprot|P18851 YOR212W Saccharomyces
           cerevisiae STE4 G protein beta subunit
          Length = 426

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 24  YSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSV- 82
           Y     S  S+G+V+L D  S +S+Q+  V  + IS ++   +    GN+ +T S+D + 
Sbjct: 234 YDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSD----GNSIITGSDDGIA 289

Query: 83  KIFDLR 88
           ++FDLR
Sbjct: 290 RLFDLR 295

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 103 PFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSV 162
           P     S   M A G    G+D  ++L+D +   +    F      DI+ ++F  SD + 
Sbjct: 227 PPAGTTSYDSMFASG----GSDGYVYLWDTRSPSSVQNFFV--SDSDISTVRFF-SDGNS 279

Query: 163 LLSGSTDGYVNVYDLKQQEE 182
           +++GS DG   ++DL+   E
Sbjct: 280 IITGSDDGIARLFDLRSDCE 299

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 120 LSGTDAEIHLYDLKKI---DAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD 176
           + GT   + +YD+ +    D+P+ +    H   I  + F+     +L+SG  DG + V+D
Sbjct: 201 ICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWD 260

Query: 177 LK 178
           L+
Sbjct: 261 LR 262

>Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 57/144 (39%), Gaps = 21/144 (14%)

Query: 105 ISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLL 164
           ISL+    +LA G    G D    L+D+  +D P++ F   H   +  I F     S+L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 S--GSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELND 222
           +  GS D  +  +        + ++      S+          IW+L H +  +     D
Sbjct: 452 TGGGSKDRCIKFWHTSTGTLLDEIYTSGQVTSL----------IWSLRHKQIVATFGFGD 501

Query: 223 KSDELV-----EPKPLEFGDIRKP 241
             + ++      PK L+  ++R P
Sbjct: 502 TKNPVLITLYSYPKLLKLLEVRSP 525

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 37.0 bits (84), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 44/111 (39%), Gaps = 4/111 (3%)

Query: 74  FVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK 133
           F   S   V++F  R  Q + T    K+  + +   + G L C  + +G    + +YD  
Sbjct: 55  FAVTSSTRVQVFSSRTRQAIKTFSRFKDVVYSASYRKDGKLLCAGDATGL---VSVYDSY 111

Query: 134 KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
                + S   S H      KFH  D   L+S S D    V+D+    E +
Sbjct: 112 NPRTLLVSVAASQHPTHV-TKFHDHDLKTLVSASDDRVTRVWDISHAYEPQ 161

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 57/118 (48%), Gaps = 14/118 (11%)

Query: 70  SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           SG+  V+ S D +V+I+DL   QC+ T+        +++      +A G+     D  + 
Sbjct: 419 SGDKIVSGSGDRTVRIWDLNTGQCLLTLSIEDGVTTVAVSPDGKFIAAGS----LDRAVR 474

Query: 129 LYD------LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
           ++D      ++++D+        H D +  + F   D   ++SGS D  V +++LKQQ
Sbjct: 475 VWDAETGFLVERLDS--NELGTGHEDSVYSVVF-TKDGKNVVSGSLDKTVKLWNLKQQ 529

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 12/115 (10%)

Query: 70  SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           SG   V+ S D +V+I+DLR  QC  T+        +S    +G       L   D    
Sbjct: 510 SGEKLVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGKFIAAGSL---DRSAR 566

Query: 129 LYD------LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177
           ++D      LK++D+      + H D I  + F   D   L+SGS D  V +++L
Sbjct: 567 IWDTETGFLLKRLDS-QTDLQNGHKDSIYSVSF-TKDGKKLVSGSLDRSVKLWNL 619

>ADR331C Chr4 complement(1285562..1290250) [4689 bp, 1562 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YHR186C
          Length = 1562

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 68/126 (53%), Gaps = 8/126 (6%)

Query: 30   SALSNGHVHLID-WNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTA-SEDSVKIFDL 87
            S L+ G V +I  W++LT   ++ V   S S +  L +D  SGN FV+  S+ S++++D 
Sbjct: 1325 SLLATGDVKIIRVWDALTESVEVDVPAKSSSLITSLTSDQLSGNIFVSGFSDGSIRVYDR 1384

Query: 88   RLNQCVATVQNAKNS---PFISLDSRHGMLACGTEL-SGT-DAEIHLYDLKKIDAPMRSF 142
            R++   + V+  K S   P   + + H       EL SGT +  + L+D+++ D P+ +F
Sbjct: 1385 RVDPRDSMVRLWKPSGGRPISWITNVHLQRGGYRELVSGTNNGVVELWDIRQ-DKPVLTF 1443

Query: 143  CDSHHD 148
             DS  +
Sbjct: 1444 TDSGQN 1449

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 89/191 (46%), Gaps = 29/191 (15%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  S ++L    +    G+  VTAS+D  +K++D+    C+
Sbjct: 323 GQLLVYEWQSESYILKQQGHFDSTNSLAYSPD----GSRVVTASDDGKIKVWDITSGFCL 378

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
           AT +   +S      ++ G +   + L GT   +  +DL +     R+F  +       I
Sbjct: 379 ATFEEHTSSVTAVQFAKRGQVMFSSSLDGT---VRAWDLIRY-RNFRTFTGTER-----I 429

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEALH------QVINFAS----IHSC 198
           +F+  A DPS  V+ +GS D + ++V+ ++  +  +AL         ++F+     + S 
Sbjct: 430 QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASA 489

Query: 199 GWLSPKRIWAL 209
            W    RIW++
Sbjct: 490 SWDKTIRIWSI 500

>Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 105 ISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLL 164
           ISL+   G+LA G    G D    L+D+  +D P++ F   H   +  I F     S+L 
Sbjct: 396 ISLNEHSGLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 10/79 (12%)

Query: 101 NSPFI-SLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASD 159
           ++P I +L      LA GT+    D  + L+DL+ +  P+R     H D IT +KF   D
Sbjct: 507 DAPMIGALQCYKSALATGTK----DGIVRLWDLR-VGKPVR-LLRGHTDGITSLKF---D 557

Query: 160 PSVLLSGSTDGYVNVYDLK 178
              L++GS D  V ++DL+
Sbjct: 558 SEKLVTGSMDNSVRIWDLR 576

>AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR057C (PWP2)
          Length = 922

 Score = 37.0 bits (84), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 88/191 (46%), Gaps = 29/191 (15%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  +++AL    +    G   VTA+ED  +KI+D+    C+
Sbjct: 336 GQLLVYEWQSESYILKQQGHFDALNALAYSPD----GARIVTAAEDGKIKIWDIVSGFCL 391

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
           AT +   +S      +++G +   + L GT   +  +DL +     R+F  +       I
Sbjct: 392 ATFEEHTSSVTSVQFAKNGQIMFSSSLDGT---VKAWDLMRF-RNFRTFTATER-----I 442

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEALH------QVINFAS----IHSC 198
           +F   A+DP+  V+ +GS D Y + V+ ++  +  + L         ++F+     + S 
Sbjct: 443 QFSCLAADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASA 502

Query: 199 GWLSPKRIWAL 209
            W    R+W++
Sbjct: 503 SWDKTIRVWSI 513

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 16/112 (14%)

Query: 67  DVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAE 126
           D+   N   TA+       ++ L++     Q ++     +L S    LA GT+    D  
Sbjct: 533 DLSFANVLTTAT-------NVDLSKSTLLTQRSERPTIGALQSFDAALATGTK----DGI 581

Query: 127 IHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           + L+DL+     +R+  + H D IT +KF   D + L++GS D  V V+DL+
Sbjct: 582 VRLWDLRS-GKVIRTL-EGHTDAITSLKF---DSACLVTGSYDRTVRVWDLR 628

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 51/115 (44%), Gaps = 25/115 (21%)

Query: 81  SVKIFDLRLNQCVATVQN-AKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK------ 133
           +VKI+DL   + +  +         + +D  +G L  G    G DA + L++L       
Sbjct: 416 TVKIWDLSKRKKIGELAGHLATINCMQIDRDYGTLVTG----GRDAALKLWNLNLAEQLY 471

Query: 134 -----------KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177
                      +ID+P     ++H D++T +     DP+ L+SGS D  +  +DL
Sbjct: 472 QETQNLTCPASQIDSPCVFTFEAHIDEVTALSL---DPNFLVSGSQDRTIRQWDL 523

>TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {ON}
           Anc_8.631 YOR212W
          Length = 431

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 7/69 (10%)

Query: 110 RHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTD 169
           +  M A G    G+D+ +H++D +   +  + +    + D+  +KF+ +D + ++SGS D
Sbjct: 246 KTNMFATG----GSDSYVHIWDTRAPSSVQKFYI--SNSDVNTVKFY-NDGNAIVSGSDD 298

Query: 170 GYVNVYDLK 178
           G + +YDL+
Sbjct: 299 GIIRLYDLR 307

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 40/70 (57%), Gaps = 5/70 (7%)

Query: 33  SNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQ 91
           S+ +VH+ D  + +S+Q   +  + ++ +K  ++    GN  V+ S+D  ++++DLR + 
Sbjct: 255 SDSYVHIWDTRAPSSVQKFYISNSDVNTVKFYND----GNAIVSGSDDGIIRLYDLRADC 310

Query: 92  CVATVQNAKN 101
            +A    AK+
Sbjct: 311 KIADYSLAKS 320

>TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {ON}
           Anc_1.107 YNL253W
          Length = 507

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 69/161 (42%), Gaps = 14/161 (8%)

Query: 28  LLSALSNGHVHLIDWNS---LTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASED-SVK 83
           ++   S G + L+  N+   L +I  +P H   I+ LKV       G+  V+  ED +  
Sbjct: 247 IIVGTSIGEISLLRVNNNKELKNIIKVPAHRGKITGLKV----TPLGDKLVSVGEDGACL 302

Query: 84  IFDLRLNQCVAT-VQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSF 142
           I+DL    C++T V+   N     L     +L   +E    + +   YD+   +  +  +
Sbjct: 303 IWDLESLTCISTIVECESNIRTFDLSPSGKLLVVVSE----EGKFRFYDMITTEK-INDY 357

Query: 143 CDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEE 183
              H D    +KF+ +   +++SG  D    +Y  K   +E
Sbjct: 358 DQKHLDSDFIVKFYPNKSWLMISGENDTLCRLYSEKGHSDE 398

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 56/129 (43%), Gaps = 33/129 (25%)

Query: 74  FVTASED-SVKIFDLRLNQCVATV-----------------------QNAKNSPFISLDS 109
            V+ S+D +++ +DLR  +C+ T+                       Q  +     +L S
Sbjct: 515 LVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQS 574

Query: 110 RHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTD 169
               LA GT+    D  + L+DL+     +      H D IT +KF   D + L++GS D
Sbjct: 575 FDAALATGTK----DGVVRLWDLRS--GKVIRTLKGHTDAITSLKF---DSACLVTGSYD 625

Query: 170 GYVNVYDLK 178
             V ++DL+
Sbjct: 626 RTVRIWDLR 634

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 69/163 (42%), Gaps = 36/163 (22%)

Query: 44  SLTSIQDIPVHGTSISA--------LKVLDNDVDSGNTFVTAS--EDSVKIFDL-RLNQC 92
           S  + Q +   GT I +        L  LD D   G T  TA   + +VKI+DL + N+ 
Sbjct: 376 SFPTFQQLYEPGTKIGSIMSTHDDFLTCLDFDAPFG-TLCTAGYLDHTVKIWDLSKQNKI 434

Query: 93  VATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK-----------------KI 135
                +      + ++  +G L  G    G DA + L++L                   I
Sbjct: 435 GELAGHLATINCMQINRDYGTLVTG----GRDAALKLWNLNLAQQLYQETQNLTSPTNHI 490

Query: 136 DAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           D+P     ++H D++T +     DPS L+SGS D  +  +DL+
Sbjct: 491 DSPCVHTFEAHTDEVTALSL---DPSFLVSGSQDRTIRQWDLR 530

>AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YJL112W (MDV1) and YKR036C
           (CAF4)
          Length = 715

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 62/122 (50%), Gaps = 17/122 (13%)

Query: 81  SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKK-ID--- 136
           ++K+++L  N+ VA++     +       ++  L  G    G DA + ++D++K ID   
Sbjct: 435 TIKVWNLSKNKHVASITGHLATVSCMQMDQYNTLITG----GRDALLKMWDIQKAIDNDS 490

Query: 137 APMRSFC----DSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINF 192
            P    C    DSH D+IT + F A++   L+SGS D  +  +DL   +  + L   INF
Sbjct: 491 IPSDEVCIYTFDSHIDEITALSFEANN---LVSGSQDRTIRQWDLNNGKCVQTLD--INF 545

Query: 193 AS 194
           A+
Sbjct: 546 AT 547

>Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa]
           {ON} YCR057C (PWP2) - regulatory protein [contig 16]
           FULL
          Length = 913

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 88/191 (46%), Gaps = 29/191 (15%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  + +A+    +    G+  VTASED  +KI+D+    C+
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDATNAVTYSPD----GSRVVTASEDGKIKIWDVVSGFCL 376

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
            T Q    +      ++ G +     L GT   +  +DL +     R+F  +       I
Sbjct: 377 VTFQEHTAAVSALAFAKRGQVLFSASLDGT---VRAWDLVRY-RNFRTFTAAER-----I 427

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEAL--HQ----VINFAS----IHSC 198
           +F+  A+DPS  V+ +GS D + V+V+ ++  +  E L  H+     ++F+     + S 
Sbjct: 428 QFNCLAADPSGEVVCAGSVDSFAVHVWSVQTGQLVETLDGHEGPVSCLSFSQENSVLASA 487

Query: 199 GWLSPKRIWAL 209
            W    RIW++
Sbjct: 488 SWDKTIRIWSI 498

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           H   ITDI FH ++P +L + S D YV+ +D++
Sbjct: 113 HSRAITDINFHPTNPEILATCSIDAYVHAWDMR 145

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 127 IHLYDLKK---IDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           I +YD+ K   ID P+ +    H   +    F+ +  S+L+SG  DG + ++DL+
Sbjct: 208 ISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKIWDLR 262

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 113 MLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLL-SGSTDGY 171
           ML C  + +G    I L+D +    P+  F  +H D ++ ++++ + P+++  +G  DG 
Sbjct: 303 MLLCAADSNGG---IALWDCRAFSKPLSVF--NHGDSVSALQWNPNLPTIVATAGQGDGL 357

Query: 172 VNVYDLKQQEEEEAL 186
           + ++D  ++ E+  L
Sbjct: 358 IKIWDTSREPEDSLL 372

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 88/191 (46%), Gaps = 29/191 (15%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  S + L    +    G+  VTAS+D  +K++D+    C+
Sbjct: 320 GQLLVYEWQSESYILKQQGHFDSTNCLAYSPD----GSRVVTASDDGKIKVWDITSGFCL 375

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
           AT +   +S      ++ G +   + L GT   +  +DL +     R+F  +       I
Sbjct: 376 ATFEEHTSSVTAVQFAKRGQVMFSSSLDGT---VRAWDLIRY-RNFRTFTGTER-----I 426

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEALH------QVINFAS----IHSC 198
           +F+  A DPS  V+ +GS D + ++V+ ++  +  +AL         ++F+     + S 
Sbjct: 427 QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASA 486

Query: 199 GWLSPKRIWAL 209
            W    RIW++
Sbjct: 487 SWDKTIRIWSI 497

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 86/217 (39%), Gaps = 57/217 (26%)

Query: 125 AEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
           A+I L+D+ +   P+ +      D+IT +KF+ ++  +LLS  +D  V +YDL+     +
Sbjct: 195 AQIELWDINR-RKPLSNLSWGI-DNITAVKFNQNEADLLLSSGSDNSVVLYDLRTNSPTQ 252

Query: 185 ALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKPWNC 244
            + Q +   S+  C W         + ME F+    N       E +   + D+R     
Sbjct: 253 KIVQTMKTNSM--C-W---------NPMEPFNFVTAN-------EDQNAYYYDMRNMSRA 293

Query: 245 DYV----------VDIFPGC--IITGSTQEQSMLQLLPFSNEEVDTTNSII-IPRAHGDE 291
            +V          VDI P    I+TGS                 D T  I  I   H  E
Sbjct: 294 LHVFKDHVSAIMDVDISPTGEEIVTGS----------------YDKTIRIFNIKHGHSRE 337

Query: 292 VVRDALIHKT-------TSELFYSGGEDGNIVLWKSN 321
           V     +           S+   SG +DGN+ LW+SN
Sbjct: 338 VYHTKRMQHVFQVKFTMDSKYIVSGSDDGNVRLWRSN 374

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 82/188 (43%), Gaps = 17/188 (9%)

Query: 14  DNWCLKLQPLYSRG-LLSALSNGHVHLIDWNSLTSIQDI-PVHGTSISALKVLDNDVDSG 71
           + + L   PL   G LLS   +G V+    ++   + D  P   ++  +++ +       
Sbjct: 273 EGYGLDWSPLIKTGSLLSGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRSES 332

Query: 72  NTFVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEI 127
             F TA  D  ++I+D R  +    ++   +  +   IS   + G L    + +GT    
Sbjct: 333 TVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGT---W 389

Query: 128 HLYDLKKIDA-------PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
            ++DL++          P+  + D H   IT I F+  D S++  GS D  V ++DL  +
Sbjct: 390 GVWDLRQFTPSNADSVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVE 448

Query: 181 EEEEALHQ 188
            ++E + Q
Sbjct: 449 ADDEEIKQ 456

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/61 (21%), Positives = 32/61 (52%)

Query: 140 RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCG 199
           + F  S++  I DI++  S+ +V  +   DGY+ ++D + ++ + A+    +   ++   
Sbjct: 312 QPFTVSNNKSIEDIQWSRSESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVIS 371

Query: 200 W 200
           W
Sbjct: 372 W 372

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 53/110 (48%), Gaps = 9/110 (8%)

Query: 82  VKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRS 141
           +KIF L   + V +++ +  S  +  D    +LA G    GTD  + + D++  +  +  
Sbjct: 97  LKIFKLSTGKIVKSMKISSPSYVLETDPTSTLLAIG----GTDGSVTVIDIE--NGYITH 150

Query: 142 FCDSHHDDITDIKFHA---SDPSVLLSGSTDGYVNVYDLKQQEEEEALHQ 188
               H   I+ +KF+    ++  +L SG T+G V ++DL  ++    L +
Sbjct: 151 SLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQE 200

>KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} similar
           to uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4
           G protein beta subunit
          Length = 436

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 5/73 (6%)

Query: 24  YSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASED-SV 82
           Y    ++  S+G+ +L D     S Q   +  + +SA+K  +N    G +F+  S+D S 
Sbjct: 232 YGHNFITGGSDGYAYLWDVRQPNSAQSFFISDSDVSAIKFFNN----GESFMAGSDDGSA 287

Query: 83  KIFDLRLNQCVAT 95
           ++FDLR +  ++T
Sbjct: 288 RLFDLRSDCQIST 300

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 89/191 (46%), Gaps = 29/191 (15%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  S ++L    +    G+  VTAS+D  +K++D+    C+
Sbjct: 325 GQLLVYEWQSESYILKQQGHFDSTNSLAYSPD----GSRVVTASDDGKIKVWDVTSGFCL 380

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
           AT +   +S      ++ G +   + + GT   +  +DL +     R+F  +       I
Sbjct: 381 ATFEEHTSSVTAVQFAKRGQVMFSSSMDGT---VRAWDLIRY-RNFRTFTGTER-----I 431

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEALH------QVINFAS----IHSC 198
           +F+  A DPS  V+ +GS D + ++V+ ++  +  +AL         ++F+     + S 
Sbjct: 432 QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASA 491

Query: 199 GWLSPKRIWAL 209
            W    RIW++
Sbjct: 492 SWDKTIRIWSI 502

>Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 46/111 (41%), Gaps = 4/111 (3%)

Query: 74  FVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK 133
           F   S   V+IF  R  Q + T    K+  + +     G L C  + +G  +    Y+ +
Sbjct: 55  FAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPR 114

Query: 134 KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
            I   + +   +H   +T  KFH  D  VL + S D    ++D+    E +
Sbjct: 115 TILLSINA--STHPAHVT--KFHTQDNKVLATASDDRVTRLWDISHAYEPQ 161

>CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 aa]
           {ON} highly similar to uniprot|P41811 Saccharomyces
           cerevisiae YGL137w SEC27
          Length = 902

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 70/162 (43%), Gaps = 11/162 (6%)

Query: 28  LLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFD 86
           +L+ L +G V + ++ +   ++ I V  T + A K     +   N  V  S+D+ V++F+
Sbjct: 28  VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKF----ITRKNWIVVGSDDNKVRVFN 83

Query: 87  LRLNQCVAT-VQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDS 145
               + VA  V +      I++      +  G++    D  + L++ +  D  +      
Sbjct: 84  YNTGEKVADFVAHPDYIRSIAVHPSKPYILTGSD----DLTVKLWNWEN-DWSLEQTFKG 138

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALH 187
           H   +  + F+  DP+V  SG  D  V V+ L Q      LH
Sbjct: 139 HEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLH 180

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/151 (20%), Positives = 65/151 (43%), Gaps = 7/151 (4%)

Query: 37  VHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATV 96
           + L D N    I ++     +++ +K   N+ D   +  T S++S+ ++DLR N     +
Sbjct: 194 IELWDSNRSNPISNLSWGADNVTNVKFNQNEHDILAS--TGSDNSIVLYDLRTNSPTQKI 251

Query: 97  QNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFH 156
                +  +  +    M A     +  D   + YD++ +   +  F D H   + D+ F 
Sbjct: 252 VQTMRTNSLCWNP---MEAFNFVTANEDQNSYYYDMRYMSRALNVFKD-HVSAVMDVDFS 307

Query: 157 ASDPSVLLSGSTDGYVNVYDLKQQEEEEALH 187
            +   ++ +GS D  + +Y++K     E  H
Sbjct: 308 PTGQEIV-TGSYDKTIRIYNIKHGHSREIYH 337

>NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {ON}
           Anc_2.469 YMR093W
          Length = 514

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 46/104 (44%), Gaps = 4/104 (3%)

Query: 74  FVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK 133
           F   S   V+IF  R  Q + T    K+  + +     G L C  + +G  +    Y+ +
Sbjct: 55  FAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSIYDSYNPR 114

Query: 134 KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177
            I   + +   +H   +T  KFH+ D   L++ S D  + ++D+
Sbjct: 115 TILLSINA--STHPTHVT--KFHSQDNKTLITASDDRVIRLWDI 154

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 51/127 (40%), Gaps = 9/127 (7%)

Query: 124 DAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEE 183
           D  I L+D+     P      +  D +  +    S P +++SGS DG V +YD +     
Sbjct: 146 DRVIRLWDISNAYQPTLELT-AATDYVRSVTCVPSAPHMIVSGSYDGVVRLYDTRTSSAS 204

Query: 184 EALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKPWN 243
             ++ + +   +     +SP +I +      F I +L          K  E G+  K   
Sbjct: 205 TPIYSLNHEQPVEDIISISPTQIVSCGG-PNFKIWDLTSNK------KLFERGNFNKSVT 257

Query: 244 C-DYVVD 249
           C DY+ D
Sbjct: 258 CLDYIQD 264

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 88/213 (41%), Gaps = 40/213 (18%)

Query: 2   SYTKCDTISFGSDNWCLKLQPLYSR----------GLLSALSNGHVHLIDWNSLTSIQDI 51
           +Y   + ++ GS +  +K   + +R          GL++ L     H  D  S    Q+ 
Sbjct: 76  NYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLITGLCVTQPHFHDKKSDWKNQNF 135

Query: 52  PVHGTSISALKVLDNDVD-------SGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPF 104
            +  +    +K+   +VD       S N  VT  E  V+ FD               S F
Sbjct: 136 MLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFD-------------GESAF 182

Query: 105 ISLDS--RHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSV 162
             +DS   +   A G       A+IHL+D+ ++  P+ +      D+IT ++F+ ++  +
Sbjct: 183 QGIDSHRENSTFATG------GAKIHLWDVNRL-KPISNLSWGA-DNITSVRFNQNETDI 234

Query: 163 LLSGSTDGYVNVYDLKQQEEEEALHQVINFASI 195
           L S  +D  + +YDL+     + + Q +   +I
Sbjct: 235 LASTGSDNSIVLYDLRTNSPTQKIVQTMRTNAI 267

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           H   ITDI FH + P +L + S D YV+ +D++
Sbjct: 113 HSRAITDINFHPTHPEILATCSIDAYVHAWDMR 145

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 84/188 (44%), Gaps = 17/188 (9%)

Query: 14  DNWCLKLQPLYSRG-LLSALSNGHVHLIDWNSLTSIQDI-PVHGTSISALKVLDNDVDSG 71
           + + L   PL   G LLS   +G ++    ++   + D  P   ++  +++ +       
Sbjct: 275 EGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTES 334

Query: 72  NTFVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEI 127
             F TA  D  ++I+D R  +    ++   +  +   IS   + G L    + +GT    
Sbjct: 335 TVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGT---W 391

Query: 128 HLYDLKKI-----DA--PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
            ++DL++      DA  P+  + D H   IT I F+  D S++  GS D  V ++DL  +
Sbjct: 392 GVWDLRQFTPSNADAVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVE 450

Query: 181 EEEEALHQ 188
            ++E + Q
Sbjct: 451 ADDEEIKQ 458

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/61 (19%), Positives = 32/61 (52%)

Query: 140 RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCG 199
           + F  S++  I DI++  ++ +V  +   DGY+ ++D + ++ + A+    +   ++   
Sbjct: 314 QPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVIS 373

Query: 200 W 200
           W
Sbjct: 374 W 374

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 12/96 (12%)

Query: 88  RLNQCVATVQNAK-NSPFISLDSRH--GMLACG-TELSGTDAEIHLYDLKKIDAPMRSFC 143
           +LN  V+   NAK N    S+D+++  G L  G  EL  T+++  L  +KK+        
Sbjct: 52  KLNPVVSVEANAKFNDIDWSIDNKYIAGALDNGMVELFKTNSKDTLKSIKKLS------- 104

Query: 144 DSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179
             H   +T + F+A   +VL SGS +G + ++DL +
Sbjct: 105 -KHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLNK 139

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 125 AEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
           A+IHL+D+ ++  P+ S      D+IT +KF+ S+  +L S  +D  + +YDL+     +
Sbjct: 199 AKIHLWDVNRL-KPV-SNLSWGADNITSVKFNQSETDILASTGSDNSIVLYDLRTNSPTQ 256

Query: 185 ALHQVINFASI 195
            + Q +   +I
Sbjct: 257 KIVQTMRTNAI 267

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 82/188 (43%), Gaps = 17/188 (9%)

Query: 14  DNWCLKLQPLYSRG-LLSALSNGHVHLIDWNSLTSIQDI-PVHGTSISALKVLDNDVDSG 71
           + + L   PL   G LL+   +G + L   ++   I D  P    +  +++ +       
Sbjct: 280 EGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTES 339

Query: 72  NTFVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEI 127
             F T+  D  V+I+D R  +    ++T  +  +   IS + + G L    + +G+    
Sbjct: 340 TVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGS---W 396

Query: 128 HLYDLKKIDA-------PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
            ++DL++          P+  + D H   IT I F+  D SV+   S D  V ++DL  +
Sbjct: 397 GVWDLRQFSPANSEGVQPVAQY-DFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVE 455

Query: 181 EEEEALHQ 188
            +++ + Q
Sbjct: 456 ADDDEIQQ 463

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 12/61 (19%), Positives = 33/61 (54%)

Query: 140 RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCG 199
           + F  +++  + DI++  ++ +V  +  TDGYV ++D + ++ + A+    +   ++   
Sbjct: 319 QPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVIS 378

Query: 200 W 200
           W
Sbjct: 379 W 379

>Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 46/111 (41%), Gaps = 4/111 (3%)

Query: 74  FVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK 133
           F   S   V+IF  R  Q + T    K+  + +     G L C  + +G  +    Y+ +
Sbjct: 55  FAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDATGLVSVYDSYNPR 114

Query: 134 KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
            I   + +   +H   +T  KFH  D  +L + S D    ++D+    E +
Sbjct: 115 TILLSINA--STHPTHVT--KFHTQDNKILATASDDRVTRLWDISHAYEPQ 161

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 84  IFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFC 143
           I+D+R   C A V +    P  S+D         T  +  D  ++++D++K + P     
Sbjct: 333 IWDIRSGNC-AMVLSGHTKPIYSVDWSPRGFEVAT--ASGDGTVNIWDIRKTNQPQVLL- 388

Query: 144 DSHHDDITDIKFHASDPSVLLSGSTDGYVNVY 175
            +H+  ++ I+F   +   L+S   D  +NVY
Sbjct: 389 -AHNSIVSGIRFEKHNGKFLMSCGYDKNINVY 419

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 85/191 (44%), Gaps = 29/191 (15%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  +++ L    +    G+  VTASED  +KI+D+    C+
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDTLNGLTYSPD----GSRVVTASEDGKIKIWDVVSGFCL 376

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
           AT +   ++      S+ G +     L GT   +  +DL +     R+F  +       I
Sbjct: 377 ATFEEHTSAVSAVQFSKRGQVLFSASLDGT---VRAWDLIRY-RNFRTFTAAER-----I 427

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEALH------QVINFAS----IHSC 198
           +F+  A DPS  V+ +GS D Y + V+ ++  +  + L         + F+     + S 
Sbjct: 428 QFNSLAVDPSGEVVCAGSIDNYEIQVWSVQTGQLLDCLAGHEGPVSCLAFSQENNVLASA 487

Query: 199 GWLSPKRIWAL 209
            W    R+W++
Sbjct: 488 SWDKTIRVWSI 498

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 36/63 (57%)

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
           SG    I L+D +     +RS    H+  I   KF++   S+L+SG ++G +N++DL++ 
Sbjct: 262 SGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLLISGDSEGRINLWDLRKL 321

Query: 181 EEE 183
           + E
Sbjct: 322 DGE 324

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 52/114 (45%), Gaps = 13/114 (11%)

Query: 93  VATVQNAKNSPFISLD-SRHGMLACGTELSGTDAEIHLYDLKK-------IDAPMRSFCD 144
           +  V+N   +  IS +  R G+LA       +  +I L+DLKK       +D P+ +  D
Sbjct: 186 IENVENTNEATSISWNLQREGLLASCY----SSGQIQLWDLKKYSNSKLEMDTPLLN-VD 240

Query: 145 SHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSC 198
                + D+ +H S  S+L +      + ++D +   E    ++ ++   I+SC
Sbjct: 241 FDALGVNDVNWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSC 294

>YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}
           UTP15Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 513

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 46/111 (41%), Gaps = 4/111 (3%)

Query: 74  FVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK 133
           F   S   V+IF  R  Q + T    K+  + +     G L C  + +G  +    Y+ +
Sbjct: 55  FAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPR 114

Query: 134 KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
            I   + +   +H   +T  KFH  D  +L + S D    ++D+    E +
Sbjct: 115 TILLSINA--STHPTHVT--KFHTQDNKILATASDDRVTRLWDISNAYEPQ 161

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 54/105 (51%), Gaps = 8/105 (7%)

Query: 78  SEDSVKIFDLRLNQCVATVQNAKNS-PFISLDSRHGMLACGTELSGTDAEIHLYDLKKID 136
           S+  +K++DL     + T    K++   ++ DS    L  G+     D++I ++DL  + 
Sbjct: 94  SDGVIKVWDLISKTILLTFNGHKSAITILTFDSTGTRLISGS----NDSDIIVWDL--VS 147

Query: 137 APMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
                   SH D+IT I + + D + L+S S DG + V+DLK Q+
Sbjct: 148 EVGLYKLRSHKDNITGI-WCSDDENWLISTSKDGLIKVWDLKIQQ 191

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 68/143 (47%), Gaps = 19/143 (13%)

Query: 46  TSIQDIPVHG--TSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQ--NAKN 101
           + I  I +HG  T I ++ + D++        TAS   +KI++L+ ++C+ T +   A  
Sbjct: 374 SKIHTIELHGQRTDIRSIAISDDN----KLLATASNGLLKIWNLKTHKCIRTFECGYALC 429

Query: 102 SPFISLDSRHGMLACGTELSGT-DAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDP 160
             F+      G+L     + GT + E+ L+DL      + +  D+H   I  +    SD 
Sbjct: 430 CKFLP----GGLLV----IVGTRNGELQLFDLAS-STQLENIEDAHDAAIWSLDI-TSDG 479

Query: 161 SVLLSGSTDGYVNVYDLKQQEEE 183
             L++GS D  V  +D K  +++
Sbjct: 480 KRLITGSADKTVKFWDFKLDQQK 502

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%)

Query: 124 DAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEE 183
           D  I ++D+K       S    H D + + K+H SDP++  S S D ++ ++D + ++  
Sbjct: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240

Query: 184 EALHQVINFASI 195
           + L Q   F +I
Sbjct: 241 QKLLQKEPFNTI 252

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 91/225 (40%), Gaps = 24/225 (10%)

Query: 96  VQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDA-PMRSFCDSHHDDITDIK 154
           V  A+ +PF S      ++A    +SGT   + LYD  K D   +R     H ++   + 
Sbjct: 116 VTRARYAPFDS-----NLIAT---ISGT-GTVFLYDRTKDDENALRGKYAYHKENGYGLN 166

Query: 155 FHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGW-LSPKRIWALSHME 213
           F  + P  L+S S DG + ++D+K  +        ++   ++ C W  S   I+     +
Sbjct: 167 FSVASPGELISCSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSED 226

Query: 214 TFSIHELNDKSDELVEPKPLEFGDIRKPWNCDYVVDIFPGCIITGSTQEQSMLQLLPFSN 273
           +F +  ++DK  E    KPL+    ++P+N                T   +M+ L     
Sbjct: 227 SFLM--IHDKRSE----KPLQKLLQKEPFNTIAFSKHSSNLFAAAGT--DAMVYLF---- 274

Query: 274 EEVDTTNSIIIPRAHGDEVVRDALIHKTTSELFYSGGEDGNIVLW 318
           +    T ++     H + V      H     +  SGG D  ++LW
Sbjct: 275 DSRKPTEALHSMSGHQEAVTSLEFAHHKDG-ILCSGGSDRRVLLW 318

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 31/56 (55%)

Query: 127 IHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
           + L DL+     ++S C SH+  +   KF+  +  +L S  ++G +N++D++   +
Sbjct: 276 VSLLDLRTKKEKLKSNCRSHNGGVNSCKFNYRNSLILASADSNGKLNLWDIRNMND 331

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 53/257 (20%), Positives = 95/257 (36%), Gaps = 41/257 (15%)

Query: 76  TASEDSVKIFDLRLNQCVATVQNAKNSPF-ISLDSRHGMLACGTELSGTDAEIHLYDLKK 134
            +S+ ++ IFD   +      Q+  + PF   L   HG++     +  + A+I       
Sbjct: 148 ASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDVETMDASSADI------- 200

Query: 135 IDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFAS 194
                        ++ T I ++    ++LLS  ++G V V+D+KQ   E  +   +   S
Sbjct: 201 -------------NEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIID-LPLVS 246

Query: 195 IHSCGWLSPKRIWALSHMETF---------SIHELNDKSDELVEPKPLEFGDIRKPWNCD 245
           I+S G       W  +H   F         S+ +L  K ++L        G +    +C 
Sbjct: 247 INSDGSGVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVN---SCK 303

Query: 246 YVVDIFPGCIITGSTQEQSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHKTTSEL 305
           +    +   +I  S      L L    N      +  +    HG  V          + L
Sbjct: 304 FN---YRNSLILASADSNGKLNLWDIRN----MNDCPLTTMEHGGSVSTLEWSPNFDTVL 356

Query: 306 FYSGGEDGNIVLWKSNR 322
             +G EDG + LW ++R
Sbjct: 357 ATAGQEDGLVKLWDTSR 373

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 49/104 (47%), Gaps = 15/104 (14%)

Query: 82  VKIFDLRLNQCVATVQNAKNSP--FISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPM 139
           +KI+D++  Q V  + N+  +   F+  D     L  G+     D+ I ++DL       
Sbjct: 100 IKIWDMQ-TQTVLIIFNSHTAAITFLKFDPSGTRLISGSR----DSNIIIWDL----VGE 150

Query: 140 RSFCD--SHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
              C   SH D IT I F   D   L+S S DG + V+D+K Q+
Sbjct: 151 VGLCKLRSHKDSITGIWFENDDW--LISTSKDGLIKVWDIKSQQ 192

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
           H   ITDI FH S P +L + S D YV+ +D++  + 
Sbjct: 113 HFRAITDINFHPSHPELLATCSIDTYVHAWDMRSPQR 149

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 59/126 (46%), Gaps = 15/126 (11%)

Query: 74  FVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHL 129
           F TA+ D  ++I+D R  +    ++   +  +   IS   + G L    + +GT     +
Sbjct: 336 FATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGT---WGV 392

Query: 130 YDLKKIDA-------PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
           +DL++          P+  + D H   IT I F+  D S++  GS D  V ++DL  + +
Sbjct: 393 WDLRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEAD 451

Query: 183 EEALHQ 188
           +E + Q
Sbjct: 452 DEEIKQ 457

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 93  VATVQNAKNSPFISLDSRHGMLACGTELSG-TDAEIHLYD--LKKIDAPMRSFCDSHHDD 149
           + TV+N  N     LD    ++  G  LSG    +I+L      +     +SF  S+++ 
Sbjct: 264 IHTVKNHGNVEGYGLD-WSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNES 322

Query: 150 ITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGW 200
           I DI++  ++ +V  + + DGY+ ++D + ++ + A+    +   ++   W
Sbjct: 323 IEDIQWSRTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 373

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 78/172 (45%), Gaps = 30/172 (17%)

Query: 18  LKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSIS------ALKVLDNDVDSG 71
           +KL PL  R  L+ ++N      D   +T ++  P     IS      ALK+ +     G
Sbjct: 46  IKLSPLQER--LTTITNN-----DEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIEG 98

Query: 72  NTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYD 131
            T +   + S+        Q + T++ +  S  +  DS   ++A G    GTD  I + D
Sbjct: 99  ETTMNTKQQSL--------QPIKTLKLSSPSYIMDCDSTSTLVAVG----GTDGSIIVVD 146

Query: 132 LKKIDAPMRSFCDSHHDDITDIKFHASDPS---VLLSGSTDGYVNVYDLKQQ 180
           ++  +  +      H   I+ +KF+ ++ +   +L SG T+G V ++DL ++
Sbjct: 147 IE--NGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSGDTNGMVKIWDLVKR 196

>Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {ON}
           complement(90370..91632) [1263 nt, 421 aa]
          Length = 420

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 40/67 (59%), Gaps = 5/67 (7%)

Query: 30  SALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASED-SVKIFDLR 88
           S+ S+G+ ++ D  S  S+Q   V  + ++ +K   +    GN+ VT S+D ++++FDLR
Sbjct: 243 SSGSDGYTYIWDVRSAASVQSFFVSNSDVNTVKFFKD----GNSIVTGSDDGTLRMFDLR 298

Query: 89  LNQCVAT 95
            +  +AT
Sbjct: 299 ADCPIAT 305

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 37/58 (63%), Gaps = 3/58 (5%)

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           SG+D   +++D++   A ++SF  S+ D +  +KF   D + +++GS DG + ++DL+
Sbjct: 244 SGSDGYTYIWDVRSA-ASVQSFFVSNSD-VNTVKFF-KDGNSIVTGSDDGTLRMFDLR 298

>SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar to
           uniprot|P38123 Saccharomyces cerevisiae YBR175W SWD3
           Subunit of the COMPASS complex which methylates histone
           H3 on lysine 4 and is required in transcriptional
           silencing near telomeres
          Length = 314

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 101 NSPFISLD-SRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASD 159
            +P +SL  +  G L C   +   D  I ++D+  +   +     +H + +  I     D
Sbjct: 97  TAPVLSLVYTSKGNLLCSASM---DESIKIWDV--LTGTLLKTISAHSEPVVSIDMPVCD 151

Query: 160 PSVLLSGSTDGYVNVYD 176
           PS+L SGS DG + ++D
Sbjct: 152 PSILSSGSYDGLIRIFD 168

>CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa]
           {ON} similar to uniprot|Q08281 Saccharomyces cerevisiae
           YOL138c
          Length = 1336

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 7/83 (8%)

Query: 126 EIHLYDLKKI---DAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
           +I LYDL +    + PM      H   I    F+ S  ++++SG  DG V V+D++    
Sbjct: 260 DISLYDLNRTTPAEDPMIQILSGHTRAINSFDFNMSQTNLIISGGQDGCVKVWDIRSDSM 319

Query: 183 EEALHQVINFA----SIHSCGWL 201
           +      +N      SI    W+
Sbjct: 320 KRQGRSDLNIKTANDSIRDVKWM 342

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 9/78 (11%)

Query: 110 RHGMLACGTELSGTDAEIHLYDLKKIDAP-----MRSFCDSHHDDITDIKFHASDPSVLL 164
           +H +L  G    G+  EI+++D  KI+ P     +     +  D+I  + ++ +   V  
Sbjct: 116 QHNVLCSG----GSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFA 171

Query: 165 SGSTDGYVNVYDLKQQEE 182
           S  + G+ +++DLK ++E
Sbjct: 172 SAGSSGFASIWDLKAKKE 189

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 71/157 (45%), Gaps = 18/157 (11%)

Query: 28  LLSALSNGHVHLIDWNSLTSIQDIP-VHGTSISALK---VLDNDVDSGNTFVTA-SEDSV 82
           L S  S G +++ D N + +    P V GT+++ +     L  + + G+ F +A S    
Sbjct: 120 LCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSGFA 179

Query: 83  KIFDLRLNQCV------ATVQNAKNSPFI----SLDSRHGMLACGTELSGTDAEIHLYDL 132
            I+DL+  + V      +++   KN   I      +S     A G++   +D  I ++DL
Sbjct: 180 SIWDLKAKKEVIHLSHTSSITGQKNQLSIVEWHPNNSTRIATASGSD---SDPSILVWDL 236

Query: 133 KKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTD 169
           +  + P+++    H   +  + +   D ++LLS   D
Sbjct: 237 RNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRD 273

>NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {ON}
           Anc_8.631
          Length = 428

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 122 GTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           G+D   +++D +   A  + F      D+T IKF   D + +++GS DG +N++DL+
Sbjct: 251 GSDGYTYIWDTRSPSAVQKFFVS--DSDVTSIKFFK-DGNSIITGSDDGIINMFDLR 304

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 82/188 (43%), Gaps = 17/188 (9%)

Query: 14  DNWCLKLQPLYSRG-LLSALSNGHVHLIDWNSLTSIQDI-PVHGTSISALKVLDNDVDSG 71
           + + L   PL   G LLS   +G ++    ++   + D  P   ++  +++ +       
Sbjct: 273 EGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTES 332

Query: 72  NTFVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEI 127
             F TA  D  ++I+D R  +    ++   +  +   IS   + G L    + +GT    
Sbjct: 333 TVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGT---W 389

Query: 128 HLYDLKKIDA-------PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
            ++DL++          P+  + D H   IT I F+  D S++  GS D  V ++DL  +
Sbjct: 390 GVWDLRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVE 448

Query: 181 EEEEALHQ 188
            ++E + Q
Sbjct: 449 ADDEEIKQ 456

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 12/61 (19%), Positives = 32/61 (52%)

Query: 140 RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCG 199
           + F  S++  I DI++  ++ +V  +   DGY+ ++D + ++ + A+    +   ++   
Sbjct: 312 QPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVIS 371

Query: 200 W 200
           W
Sbjct: 372 W 372

>Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON}
           (104927..105949) [1023 nt, 341 aa]
          Length = 340

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 55/142 (38%), Gaps = 28/142 (19%)

Query: 58  ISALKVLDNDVDSGNTFVTASEDSVKIFDLRL----NQCVATVQN--------------- 98
           +  L V+  D+ SG  F T     VK           QCVAT  +               
Sbjct: 34  VDGLSVVIYDISSGEVFQTILTSHVKSISQVCWSPDGQCVATASDDFTINVLHLLYGQLY 93

Query: 99  ---AKNSPFISLD-SRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIK 154
                 +P ISL  +  G L C + +   D  I ++D   ++  +     +H + +  I 
Sbjct: 94  ILMGHTAPVISLCYNSKGNLLCSSSM---DESIKIWD--TLNGTLMRTISAHSEAVVSID 148

Query: 155 FHASDPSVLLSGSTDGYVNVYD 176
               D S+L SGS DG + ++D
Sbjct: 149 ICTFDSSILSSGSFDGLIRIFD 170

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 81/188 (43%), Gaps = 17/188 (9%)

Query: 14  DNWCLKLQPLYSRG-LLSALSNGHVHLIDWNSLTSIQDI-PVHGTSISALKVLDNDVDSG 71
           + + L   PL   G LL+   +G ++    ++   I D  P    +  +++ +       
Sbjct: 275 EGYALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTES 334

Query: 72  NTFVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEI 127
             F +A  D  ++I+D R  +    ++   +  +   IS   + G L    + +GT    
Sbjct: 335 TVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGT---W 391

Query: 128 HLYDLKKIDA-------PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
            ++DL++          P+  + D H   IT I F+  D S++  GS D  V ++DL  +
Sbjct: 392 GVWDLRQFSPENAGSVQPVAQY-DFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVE 450

Query: 181 EEEEALHQ 188
            ++E + Q
Sbjct: 451 ADDEEIKQ 458

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/61 (19%), Positives = 32/61 (52%)

Query: 140 RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCG 199
           + F  +++  I DI++  ++ +V  S   DGY+ ++D + ++ + A+    +   ++   
Sbjct: 314 QPFTVANNQSIEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVIS 373

Query: 200 W 200
           W
Sbjct: 374 W 374

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 9/103 (8%)

Query: 82  VKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRS 141
           +KIF L   +   +++ +  S  +  DS   ++A G    GTD  I + D++  +  +  
Sbjct: 84  LKIFSLDSMKITRSMKISSPSYVMDSDSTSTLIAIG----GTDGSISVVDVE--NGYITH 137

Query: 142 FCDSHHDDITDIKFHA---SDPSVLLSGSTDGYVNVYDLKQQE 181
               H   I+ +KFH     D  +L SG T+G   V+DL ++ 
Sbjct: 138 SFKGHGGTISSLKFHGELNGDKWLLASGDTNGVAKVWDLVKRR 180

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 11/112 (9%)

Query: 69  DSGNTFVTASEDSVKIFDLRLNQCVATVQ--NAKNSPFISLDSRHGMLACGTELSGTDAE 126
           D      TAS  S+KI++++ ++C+ T +   A    F+      G+L     L   + E
Sbjct: 401 DDNKLLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLP----GGLLVI---LGTRNGE 453

Query: 127 IHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           + L+DL    + + +  D+H   I  +    SD   L++GS D  V  +D K
Sbjct: 454 LQLFDLAS-SSLLDTIEDAHDAAIWSLDL-TSDGKRLVTGSADKTVKFWDFK 503

>KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {ON}
           highly similar to uniprot|P25636 Saccharomyces
           cerevisiae YCR057C PWP2 part of small (ribosomal)
           subunit (SSU) processosome (contains U3 snoRNA) Eight
           WD-repeats with homology with G protein beta subunits
           flanked by nonhomologous N-terminal and C-terminal
           extensions regulatory protein
          Length = 915

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 89/191 (46%), Gaps = 29/191 (15%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  + +A+    +    G+  VTASED  +KI+D+    C+
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDATNAVTYSPD----GSRVVTASEDGKIKIWDVVSGFCL 376

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
            T Q   ++      ++ G +     L GT   +  +DL +     R+F  +       I
Sbjct: 377 VTFQEHTSAVTGLAFAKKGQVLFSASLDGT---VRAWDLVRY-RNFRTFTAAER-----I 427

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEAL--HQ----VINFAS----IHSC 198
           +F+  A+DPS  V+ +GS D + ++V+ ++  +  E L  H+     ++F+     + S 
Sbjct: 428 QFNCLAADPSGEVVCAGSVDSFAIHVWSVQTGQLVETLDGHEGPVSCLSFSRENSVLASA 487

Query: 199 GWLSPKRIWAL 209
            W    R+W++
Sbjct: 488 SWDKTIRVWSI 498

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 69/172 (40%), Gaps = 50/172 (29%)

Query: 33  SNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS---VKIFDLRL 89
           ++G V++ D  +      +  HG +IS++K    +VDSG  ++ AS D+   VKI+DL  
Sbjct: 121 TDGSVNVFDIANGYVTHSLKGHGATISSVKFY-GEVDSG-MWLLASGDTNGMVKIWDLVK 178

Query: 90  NQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDD 149
            +C+ TVQ                                       A +R         
Sbjct: 179 RRCIHTVQEHT------------------------------------AAVRGL------- 195

Query: 150 ITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGWL 201
             DI+      S+LLSG  D  V+V+    +++ + L  +     I SCG++
Sbjct: 196 --DIRVQEGAESLLLSGGRDDVVHVHHFDMKKKCKLLQTIPVKRQIESCGFI 245

>KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly
           similar to uniprot|Q12021 Saccharomyces cerevisiae
           YDR030C RAD28 Protein involved in transcription- coupled
           repair nucleotide excision repair of UV-induced DNA
           lesions homolog of human CSA protein
          Length = 425

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 60/132 (45%), Gaps = 16/132 (12%)

Query: 54  HGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGM 113
           H  S++++K    D  +G  F  +++  VKI+D    Q  +++  A       LD+   +
Sbjct: 141 HAFSVTSVKWYGPD--NGLFFTGSNDHKVKIWDTNTFQVASSIDIAHR--VAQLDTLGDL 196

Query: 114 LACGTELSGTDAEIHLYDLKKIDAPMR---SFCDSHHDDITDIKFH----ASDPSVLLSG 166
           LA  +E    D+   L DL+ + A +       D  H  I   KF      + P +L +G
Sbjct: 197 LAVASE----DSHPRLIDLRSMSAAISLGVKRSDMRHG-INAAKFSHTSSGAKPLLLATG 251

Query: 167 STDGYVNVYDLK 178
             DG V V+DL+
Sbjct: 252 DDDGNVRVWDLR 263

>ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 912

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 90/189 (47%), Gaps = 25/189 (13%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + +     H  S+++L    +    G+  VTAS+D  +K++D+    C+
Sbjct: 317 GQLLVYEWQSESYVLKQQGHFDSMNSLTYSPD----GSRVVTASDDGKIKVWDVVSGFCI 372

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
            T++   +S      ++ G +   + L GT   +  +DL +     R F        T +
Sbjct: 373 VTLEGHTSSVTGIQFAKRGQVLFTSSLDGT---VRAWDLIRY-RNFRVFTSVERIQFTCV 428

Query: 154 KFHASDPS--VLLSGSTDGY-VNVYDLK--QQEEEEALHQ----VINF----ASIHSCGW 200
              A DPS  V+ +GSTD + ++V+ ++  Q  ++ A H+     ++F    +++ S  W
Sbjct: 429 ---AVDPSGEVVCAGSTDSFDIHVWSVQTGQLVDQLAGHEGPVSCLSFSRETSTLASASW 485

Query: 201 LSPKRIWAL 209
               R+W++
Sbjct: 486 DRTIRVWSI 494

>KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.450
           YMR102C
          Length = 910

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 43/106 (40%), Gaps = 10/106 (9%)

Query: 237 DIRKPWNCDYVVDIFPGCIITGSTQEQSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDA 296
           +++ P + DY+   + G +  G     S     P S  + D+   ++ P+   +   R  
Sbjct: 175 ELKVPDDSDYIGKHYSGHVENGRLAIASSNNGRPRSTLQTDSP--VLSPKVSAESAARSK 232

Query: 297 LIHKTTSEL----FYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKL 338
            +  +   L       GG+DG I LWK     L+ P E W  Q  L
Sbjct: 233 AVWTSKFSLDGRYMSVGGKDGGISLWK----VLSSPVERWELQSTL 274

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 62/135 (45%), Gaps = 15/135 (11%)

Query: 50  DIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQ--NAKNSPFISL 107
           DI  H T + A+ + D++        TAS  S+KI++++   C+ T +   A    F+  
Sbjct: 380 DIKGHRTDVRAIDISDDN----KLLATASNGSLKIWNIKTKSCIRTFECGYALACKFL-- 433

Query: 108 DSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGS 167
                ++  GT+      +++L+DL      + S   +H   I  +   A D   L++GS
Sbjct: 434 -PGGALVVIGTK----TGDLNLFDLAS-STLLSSIEAAHSGAIWSLDLTA-DGKRLVTGS 486

Query: 168 TDGYVNVYDLKQQEE 182
            D  V  +D + ++E
Sbjct: 487 ADKSVRFWDFQVEQE 501

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 11/102 (10%)

Query: 82  VKIFDLRLNQCVATVQNAKNSPF--ISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPM 139
           VKI+DL L++ V    N   S    +  DS    L  G++    D++I ++DL       
Sbjct: 99  VKIWDL-LSKSVLINFNGHKSAITVLKFDSTGTRLISGSK----DSDIIVWDLVGEVGLF 153

Query: 140 RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
           +    SH D IT +     D   L+S S DG + V+DLK Q+
Sbjct: 154 K--LRSHKDSITGLWCEGED--WLVSTSKDGLIKVWDLKTQQ 191

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 58/115 (50%), Gaps = 11/115 (9%)

Query: 75  VTASEDS-VKIFDLRLNQCVATVQNAKNSPFISLD---SRHGMLACGTELSGTDAEIHLY 130
            + S+D+ VK++D R  QC++T+   K++  IS     ++  MLA  ++    D    ++
Sbjct: 225 ASGSKDNLVKLWDPRAGQCISTILGCKHT-IISTKFQPTKGNMLAVISK----DKSCRIF 279

Query: 131 DLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEA 185
           D+++    +  + D    D   + +H  + S+   G  DG +  +DL Q+ ++ +
Sbjct: 280 DIRQNMKELAVYRD--ESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSS 332

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 71/151 (47%), Gaps = 18/151 (11%)

Query: 71  GNTFVTASEDSVK-IFDLRLNQCVATVQN-AKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           G+   +A  DSV  ++D+R  + +  ++  AK    +S       +A G+     D  + 
Sbjct: 325 GSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGS----GDGTVQ 380

Query: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD----LKQQEEEE 184
           ++D++K + P  S   +H+  ++++ F   + + L+S S D  + V+     +K    + 
Sbjct: 381 VWDIRKANKP--SSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSWIKLASLQG 438

Query: 185 ALHQVINF------ASIHSCGWLSPKRIWAL 209
              ++++       A++ S GW    +IWAL
Sbjct: 439 HTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

>TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.585
           YBR175W
          Length = 340

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 104/259 (40%), Gaps = 42/259 (16%)

Query: 71  GNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLD-SRHGMLACGTELSGTDAEIH 128
           G    + S+D +V+I  L+  Q    V +   +P +SL  +  G L C + +   D  I 
Sbjct: 78  GQCIASGSDDFTVEITHLQFGQIYRLVSH--TAPVVSLCFNVKGNLLCSSSM---DESIK 132

Query: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQ 188
           ++D   ++  +     +H   +  I     D S++ SGS DG + ++D            
Sbjct: 133 IWD--TLNGVLLRTISAHSGAVVSIDMPQLDSSIISSGSFDGLIRIFDT----------- 179

Query: 189 VINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKPWNC--DY 246
               AS H    L+  + W +        +    K+ + +  K L+   I K W+C   Y
Sbjct: 180 ----ASGHCLKTLTYDKDWKIDTGVVAIANVRWSKNGKFLLVKSLD--GIVKIWDCIRGY 233

Query: 247 VVDIFPGCIITGSTQEQSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHKTTSELF 306
           VV  F   I     QE         +N    +T++  +  A G + +     H   S + 
Sbjct: 234 VVRTFK--IDQSDDQE---------ANGASHSTDAYRMRYAFGMDFLYPENDH---SPIV 279

Query: 307 YSGGEDGNIVLWKSNRGSL 325
            SG E+G+I LW S+   L
Sbjct: 280 ISGYENGDIYLWDSSNKKL 298

>Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782
           bp, 593 aa] {ON} YGR225W (REAL)
          Length = 593

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 61/144 (42%), Gaps = 21/144 (14%)

Query: 105 ISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLL 164
           ISL+    +LA G    G D    L+D+  +D P++ F   H   +  I F     S+L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 S--GSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELND 222
           +  GS D  +  +         A   +++   I++ G ++   IW+L H +  +     D
Sbjct: 452 TGGGSKDRCIKFW-------HTATGTLLD--EIYTSGQVT-SLIWSLRHKQIVATFGFGD 501

Query: 223 KSDELV-----EPKPLEFGDIRKP 241
             + ++      PK  +  ++R P
Sbjct: 502 TRNPVLITLYSYPKLSKLLEVRSP 525

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 57/131 (43%), Gaps = 30/131 (22%)

Query: 69  DSGNTFVTASEDSVKIFDLRLNQCVATV---------QNAKN-----------SPFI-SL 107
           DSG+    + + +V+ +DL   +C+ T+         Q + N           SP I +L
Sbjct: 507 DSGHLVSGSQDRTVRQWDLTSGKCLQTIDLSFAGRLSQTSSNSGSGLLTSTDTSPIIGAL 566

Query: 108 DSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGS 167
                 LA GT     D  + L+DL+     +    + H   +T +KF   D   L++GS
Sbjct: 567 QCFDAALATGTR----DGAVRLWDLRS--GKIIRTLEGHTGAVTSLKF---DSKNLITGS 617

Query: 168 TDGYVNVYDLK 178
            D  V ++DL+
Sbjct: 618 LDRSVRIWDLR 628

>Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {ON}
            YHR186C (REAL)
          Length = 1556

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 65/133 (48%), Gaps = 14/133 (10%)

Query: 23   LYSRGLLSALSNGHVHLID-WNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASED- 80
            L  RG  S L+ G V +I  W++ T   ++ +   + S +  L  D  +GN FV    D 
Sbjct: 1317 LQIRG--SLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADG 1374

Query: 81   SVKIFDLRLNQCVATVQ-----NAKNSPFISLDSRHGMLACGTEL--SGTDAEIHLYDLK 133
            S++++D RL+   + ++     N K   +I  ++ H       EL    T+  + L+D++
Sbjct: 1375 SLRVYDRRLDPRDSMIRRWRAGNEKQGVWI--NNVHLQRGGYRELISGATNGVVELWDIR 1432

Query: 134  KIDAPMRSFCDSH 146
              D P++SF D +
Sbjct: 1433 SED-PVQSFVDQN 1444

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 51/102 (50%), Gaps = 9/102 (8%)

Query: 82  VKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRS 141
           ++++ L+  + + +++ +     ++ D    +LA G    GTD  + + D++  +  +  
Sbjct: 84  LRVYSLKQERIIRSMKISSPVYVMNCDQTSTLLAIG----GTDGSVSVIDIE--NGYVTH 137

Query: 142 FCDSHHDDITDIKFHA---SDPSVLLSGSTDGYVNVYDLKQQ 180
               H   I+ +KFH    S+   L SG T+G + V+DL ++
Sbjct: 138 SLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKR 179

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 55/108 (50%), Gaps = 10/108 (9%)

Query: 71  GNTFVTASEDSVK-IFDLRLNQCVATVQNAKNSPFISLD-SRHGM-LACGTELSGTDAEI 127
           G+   +   DSV  ++DLR  + +  ++     P   LD S +G  +A G+     D  I
Sbjct: 323 GSLLCSTGLDSVGLVWDLRSGKSIMALE-GHIKPIYGLDWSPNGYDIATGS----ADGTI 377

Query: 128 HLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVY 175
            L+D++K+   +     +H+  ++++KF  ++   L+S S D  +N+Y
Sbjct: 378 RLWDVRKV--GILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIY 423

>YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {ON}
            AMA1Activator of meiotic anaphase promoting complex
           (APC/C); Cdc20p family member; required for initiation
           of spore wall assembly; required for Clb1p degradation
           during meiosis
          Length = 593

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 56/144 (38%), Gaps = 21/144 (14%)

Query: 105 ISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLL 164
           ISL+    +LA G    G D    L+D+  +D P++ F   H   +  I F     S+L 
Sbjct: 396 ISLNEHANLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 S--GSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELND 222
           +  GS D  +  +          L ++     + S        IW+L H +  +     D
Sbjct: 452 TGGGSKDRCIKFW---HTSTGTLLDEICTSGQVTSL-------IWSLRHKQIVATFGFGD 501

Query: 223 KSDELV-----EPKPLEFGDIRKP 241
             + ++      PK  +  ++R P
Sbjct: 502 TKNPVLITLYSYPKLSKLLEVRSP 525

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 12/116 (10%)

Query: 70  SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           SG+  V+ S D +V+I+DLR  QC  T+        +++    G L     L   D  + 
Sbjct: 501 SGDKLVSGSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSL---DRTVR 557

Query: 129 LYD------LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           ++D      ++++D+        H D +  + F   D   ++SGS D  V +++L+
Sbjct: 558 IWDSETGFLVERLDS-ENELGTGHKDSVYSVVF-TRDGHGVVSGSLDRSVKLWNLR 611

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 63/136 (46%), Gaps = 17/136 (12%)

Query: 50  DIPVHGTSISALKVLDNDVDSGNTFV-TASEDSVKIFDLRLNQCVATVQ--NAKNSPFIS 106
           DI  H + + A+     D+   N  + TAS  ++KI++++ N C+ T +   A    F+ 
Sbjct: 380 DIRGHRSDVRAI-----DISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALACKFL- 433

Query: 107 LDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSG 166
                 ++  GT+      ++HLYDL      + +   +H   I  +    +D   L++G
Sbjct: 434 --PGGALVVLGTK----TGDLHLYDLAS-STLLNTIEGAHSGAIWSLDM-TTDGKRLVTG 485

Query: 167 STDGYVNVYDLKQQEE 182
           S D  V  +D + ++E
Sbjct: 486 SADKTVCFWDFQVEQE 501

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 9/131 (6%)

Query: 75  VTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKK 134
           V  S   V+IFD+   +C+ T+    +     L     +L  G+     D  I   D++ 
Sbjct: 320 VGQSNGIVEIFDVNKKKCIRTML-GHSDRVACLSWNSYILTSGSR----DHNILHRDVRS 374

Query: 135 IDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFAS 194
            D P     +SH  ++  +K++  D + L+SG  D  VNVYD  +   +  +    + A+
Sbjct: 375 PD-PFFEKIESHSQEVCGLKWNV-DENKLVSGGNDNIVNVYD--RTSTKPFMTMTEHKAA 430

Query: 195 IHSCGWLSPKR 205
           + +  W S KR
Sbjct: 431 VKALDWSSHKR 441

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 53/114 (46%), Gaps = 12/114 (10%)

Query: 71  GNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHL 129
           G   V+ S D S++I+DL+  QC  T+        +++    G L     L   D  + +
Sbjct: 395 GQKLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSL---DRSVRI 451

Query: 130 YD------LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177
           +D      ++++D+   S  + H D +  + F   D   ++SGS D  V +++L
Sbjct: 452 WDSSTGFLVERLDSDNES-GNGHQDSVYSVAF-TKDGQHVVSGSLDRTVKLWNL 503

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 63/123 (51%), Gaps = 13/123 (10%)

Query: 75  VTASEDS-VKIFDLRLNQCVATVQNAKNSPFISL--DSRHGMLACGTELSGTDAEIHLYD 131
           V+ S+D+ VK++D R  QCV+T+   K++   +    ++  +LA  ++    D    ++D
Sbjct: 224 VSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISK----DKSCRVFD 279

Query: 132 LKKIDAPMRSF-CDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVI 190
           L+   A M    C     D  ++++   + S+   G  DG +  +DL  Q+ E+ +H +I
Sbjct: 280 LR---ASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLG-QDTEKPIH-II 334

Query: 191 NFA 193
            FA
Sbjct: 335 PFA 337

>SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|Q04305 Saccharomyces cerevisiae
           YMR093W UTP15 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 515

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 42/104 (40%), Gaps = 4/104 (3%)

Query: 74  FVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK 133
           F   S   V+IF  R  Q + T    K+  + +     G L C  + +G    + +YD  
Sbjct: 55  FAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDATGL---VSVYDSY 111

Query: 134 KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177
                + S   S H      KFH  +   L+S S D  V ++D+
Sbjct: 112 NPHTLLLSIKASSHPTHVS-KFHPMENKTLISASDDRTVRLWDI 154

>Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] {ON}
            YHR186C (REAL)
          Length = 1555

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 61/126 (48%), Gaps = 12/126 (9%)

Query: 30   SALSNGHVHLID-WNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASED-SVKIFDL 87
            S L+ G V +I  W++ T   ++ +   + S +  L  D  +GN FV    D S++++D 
Sbjct: 1321 SLLTTGDVKIIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDR 1380

Query: 88   RLNQCVATVQ-----NAKNSPFISLDSRHGMLACGTEL--SGTDAEIHLYDLKKIDAPMR 140
            RL+   + ++     N K   +I  ++ H       EL    T+  + L+D++  D P+ 
Sbjct: 1381 RLDPRDSMIRRWRAGNEKQGVWI--NNVHLQRGGYRELVSGATNGVVELWDIRSED-PVE 1437

Query: 141  SFCDSH 146
            SF D +
Sbjct: 1438 SFVDQN 1443

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
           YOL138C (REAL)
          Length = 1326

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 127 IHLYDLKK---IDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEE 183
           I +YDL K   ID P+ +    H   I    F+  + ++L+SG  D  V ++DL+  + +
Sbjct: 235 ISIYDLNKSSSIDNPLITSLYEHTRSINSFDFNMVESNLLISGGQDSCVKIWDLRSNKPK 294

Query: 184 EALHQ--VINFA--SIHSCGWL 201
            +      IN A  SI    W+
Sbjct: 295 SSNRSDISINTASDSIRDVKWM 316

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 29/56 (51%)

Query: 127 IHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
           + L DL+     ++S C  H   +   KF+  +  +L S  ++G +N++D++   E
Sbjct: 276 VSLLDLRTKKEKLKSNCKIHGGGVNSCKFNYKNSLILASADSNGRLNLWDIRNMNE 331

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 53/256 (20%), Positives = 96/256 (37%), Gaps = 41/256 (16%)

Query: 77  ASEDSVKIFDLRLNQCVATVQNAKNSPF-ISLDSRHGMLACGTELSGTDAEIHLYDLKKI 135
           +S+ ++ IFD   +      Q+  + PF I L   HG++                D++ +
Sbjct: 149 SSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQ---------------DVETM 193

Query: 136 DAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASI 195
           D  +        ++ T + ++    ++LLS  ++G + V+D+KQ   +  +  V    SI
Sbjct: 194 DTSLVDI-----NEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDV-PLMSI 247

Query: 196 HSCGWLSPKRIWALSHMETF---------SIHELNDKSDELVEPKPLEFGDIRKPWNCDY 246
            S G       W  +H   F         S+ +L  K ++L     +  G +    +C +
Sbjct: 248 DSDGSSVNDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGGVN---SCKF 304

Query: 247 VVDIFPGCIITGSTQEQSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHKTTSELF 306
               +   +I  S      L L    N       + I    HG  V          + L 
Sbjct: 305 N---YKNSLILASADSNGRLNLWDIRN----MNENPIATMEHGASVSTLEWSPNFDTVLA 357

Query: 307 YSGGEDGNIVLWKSNR 322
            +G EDG + LW + R
Sbjct: 358 TAGQEDGLVKLWDTTR 373

>Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W
           (WTM2) - Transcriptional modulator [contig 67] FULL
          Length = 381

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 33/68 (48%), Gaps = 5/68 (7%)

Query: 124 DAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK----- 178
           D +I  YD +    P+   CD H   +T      +  ++ ++GS  G + ++DL+     
Sbjct: 186 DNKIRFYDTRGDGKPLWEVCDPHDGRLTCFDVSPALETLFVTGSDTGVLKLWDLRSVIAA 245

Query: 179 QQEEEEAL 186
           Q E++E +
Sbjct: 246 QLEQQEPM 253

 Score = 30.4 bits (67), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 64/149 (42%), Gaps = 38/149 (25%)

Query: 48  IQDIPVHGTSIS-ALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCVATVQNAKNSPFI 105
           I+ I + GT+++  +K  DN     + F T S+D+ ++ +D R              P  
Sbjct: 158 IRSICIPGTTVTHTIKFHDN-----HMFSTCSDDNKIRFYDTR----------GDGKPLW 202

Query: 106 SL-DSRHGMLAC--------GTELSGTDAEI-HLYDLKKIDA-------PMR--SFCDSH 146
            + D   G L C           ++G+D  +  L+DL+ + A       PM       S 
Sbjct: 203 EVCDPHDGRLTCFDVSPALETLFVTGSDTGVLKLWDLRSVIAAQLEQQEPMEIAKLYQSG 262

Query: 147 HDDITDIKFHASDPSVLLSGSTDGYVNVY 175
            D + DI+F +S P+ LL  S  G  NVY
Sbjct: 263 ADPVADIRFGSSSPTELL--SVGGSGNVY 289

>YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON}
            KOG1Subunit of TORC1, a rapamycin-sensitive complex
            involved in growth control that contains Tor1p or Tor2p,
            Lst8p and Tco89p; contains four HEAT repeats and seven
            WD-40 repeats; may act as a scaffold protein to couple
            TOR and its effectors
          Length = 1557

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 10/131 (7%)

Query: 23   LYSRGLLSALSNGHVHLID-WNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASED- 80
            L  RG  S L+ G V +I  W++ T   ++ +   + S +  L  D  +GN FV    D 
Sbjct: 1318 LQIRG--SLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADG 1375

Query: 81   SVKIFDLRL---NQCVATVQNAKNSPFISLDSRHGMLACGTEL--SGTDAEIHLYDLKKI 135
            S++++D RL   +  +   +   +   + +++ H       EL    T+  + L+D++  
Sbjct: 1376 SLRVYDRRLDPRDSMIRRWRAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSE 1435

Query: 136  DAPMRSFCDSH 146
            D P+ SF D +
Sbjct: 1436 D-PVESFVDQN 1445

>NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {ON}
           Anc_6.325
          Length = 915

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 92/204 (45%), Gaps = 33/204 (16%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  + ++L    +    G+  VTA+ED  +K++D+    C+
Sbjct: 323 GQLLVYEWQSESYILKQQGHFDATNSLTYSPD----GSRVVTAAEDGKIKVWDVVSGFCL 378

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
           AT Q   +S      ++ G +   + L GT   +  +DL +     R+F  +       I
Sbjct: 379 ATFQEHTSSVTQVQFAKRGQVLFSSSLDGT---VRAWDLIRY-RNFRTFTAAER-----I 429

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEALH------QVINFAS----IHSC 198
           +F+  A DPS  V+ +GS D + ++V+ ++  +  + L         + F+     + S 
Sbjct: 430 QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASA 489

Query: 199 GWLSPKRIWAL----SHMETFSIH 218
            W    R+W++      +E F ++
Sbjct: 490 SWDKTVRVWSIFGRSQQVEPFDVY 513

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 23/132 (17%)

Query: 66  NDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDS--RHGMLACGTELSGT 123
           N   S N  VT  E  ++ FD               S F  +DS   +   A G      
Sbjct: 157 NKNSSDNDSVTNEEGLIRTFD-------------GESAFQGIDSHRENSTFATG------ 197

Query: 124 DAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEE 183
            A+IHL+D+ ++  P+ S      D+IT +KF+ ++  +L S  +D  + +YDL+     
Sbjct: 198 GAKIHLWDVNRL-KPV-SDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPT 255

Query: 184 EALHQVINFASI 195
           + + Q +   +I
Sbjct: 256 QKIVQTMRTNAI 267

>KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] {ON}
            some similarities with uniprot|P38873 Saccharomyces
            cerevisiae YHR186C KOG1 Subunit of TORC1 a rapamycin-
            sensitive complex involved in growth control that
            contains Tor1p or Tor2p Lst8p and Tco89p contains four
            HEAT repeats and seven WD-40 repeats may act as a
            scaffold protein to couple TOR and its effectors
          Length = 1506

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 69/130 (53%), Gaps = 13/130 (10%)

Query: 25   SRGLLSALSNGHVHLID-WNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTA-SEDSV 82
            SRG  S L  G V +I  W++LT   ++ +   S S +  L +D  SGN FV   S+ S+
Sbjct: 1275 SRG--SLLVTGDVKIIRIWDALTESVEVDIPAKSSSLITSLTSDQFSGNIFVAGYSDGSI 1332

Query: 83   KIFDLRLNQCVATVQ-----NAKNSPFIS-LDSRHGMLACGTEL-SGT-DAEIHLYDLKK 134
            +++D R++   + ++      + NSP  S +++ H       EL SGT +  + L+D++ 
Sbjct: 1333 RVYDRRMDPRDSMIRLWKTPKSDNSPVGSWVNNIHLQRGGYRELVSGTNNGVVALWDIRA 1392

Query: 135  IDAPMRSFCD 144
             D P+ +F D
Sbjct: 1393 -DKPVCTFTD 1401

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 21/27 (77%), Gaps = 1/27 (3%)

Query: 150  ITDIKF-HASDPSVLLSGSTDGYVNVY 175
            ITD+KF +  D  +LL+GS+DG VN+Y
Sbjct: 1212 ITDMKFLNDDDTPLLLAGSSDGIVNIY 1238

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 12/116 (10%)

Query: 70  SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           SG+  V+ S D +V+I+DLR  QC  T+        +++    G L     L   D  + 
Sbjct: 523 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSL---DRTVR 579

Query: 129 LYD------LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           ++D      ++++D+        H D +  + F   D   ++SGS D  V +++L+
Sbjct: 580 IWDSETGFLVERLDS-ENELGTGHKDSVYSVVF-TRDGHGVVSGSLDRSVKLWNLR 633

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/60 (21%), Positives = 31/60 (51%)

Query: 141 SFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGW 200
           +F   ++  I DI+F  ++ +V  S   DGY+ ++D + ++ + A+    +   ++   W
Sbjct: 326 AFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISW 385

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 11/112 (9%)

Query: 69  DSGNTFVTASEDSVKIFDLRLNQCVATVQ--NAKNSPFISLDSRHGMLACGTELSGTDAE 126
           D      TAS  S+KI++++ ++C+ T +   A    F+      G+L     L   + E
Sbjct: 401 DDNRLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLP----GGLLVI---LGTRNGE 453

Query: 127 IHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           + L+DL    + + +  D+H   I  +    SD   L++GS D  V  +D +
Sbjct: 454 LQLFDLAS-SSLLDTIEDAHDAAIWSLDL-TSDGKRLVTGSADKTVKFWDFQ 503

>NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1311

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query: 118 TELSGTDAEIHLYDLKK---IDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNV 174
           T +  T  +I ++D+ +   I+ P+ +    H   +    F+    ++++SG  DG V +
Sbjct: 189 TAICTTSTDISIFDISRNINIENPLLTSLSEHTRSVNSFDFNMVQSNLIISGGQDGCVKI 248

Query: 175 YDLKQQEEEEALHQVINFA----SIHSCGWL 201
           +DL+    + +    I+F     SI    W+
Sbjct: 249 WDLRSNSIKGSSRCDISFNTGSDSIRDVKWM 279

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 12/116 (10%)

Query: 70  SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           +G+  V+ S D +V+I+DLR  QC  T+        +++    G       L   D  + 
Sbjct: 422 AGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSL---DRTVR 478

Query: 129 LYD------LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           ++D      ++++D+        H D +  + F   D   ++SGS D  V ++DL+
Sbjct: 479 VWDSETGFLVERLDSE-NELSTGHKDSVYSVVF-TRDGRSVVSGSLDRSVKLWDLR 532

>SAKL0H01628g Chr8 (168606..173270) [4665 bp, 1554 aa] {ON} similar to
            gnl|GLV|CAGL0M13409g Candida glabrata CAGL0M13409g and
            some similarites with YHR186C uniprot|P38873
            Saccharomyces cerevisiae YHR186C KOG1 Subunit of TORC1 a
            rapamycin-sensitive complex involved in growth control
            that contains Tor1p or Tor2p Lst8p and Tco89p contains
            four HEAT repeats and seven WD-40 repeats may act as a
            scaffold protein to couple TOR and its effectors
          Length = 1554

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 83/197 (42%), Gaps = 54/197 (27%)

Query: 25   SRGLLSALSNGHVHLID-WNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASED-SV 82
            SRG  S L  G V +I  W++LT   ++ +   S S +  L +D  SGN FV    D S+
Sbjct: 1319 SRG--SLLVTGDVKIIRAWDALTETIEVDIPAKSSSLITSLTSDQLSGNIFVAGFADGSL 1376

Query: 83   KIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSF 142
            +++D R                  LDSR             D+ + L+         RS 
Sbjct: 1377 RVYDRR------------------LDSR-------------DSMVRLW---------RST 1396

Query: 143  CDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGWLS 202
                +  I ++         L+SG+T+G V ++D++ Q      + V++F      G  S
Sbjct: 1397 GGKQNSWINNVHLQRGGYRELVSGTTNGVVELWDIRSQ------NAVLSFVDEGQRG--S 1448

Query: 203  PKRIWALSHMETFSIHE 219
             ++I  +S M +  +HE
Sbjct: 1449 GQKI--MSTMTSMQVHE 1463

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 12/116 (10%)

Query: 70  SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           +G+  V+ S D +V+I+DLR  QC  T+        +++    G       L   D  + 
Sbjct: 405 AGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSL---DRTVR 461

Query: 129 LYD------LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           ++D      ++++D+        H D +  + F   D   ++SGS D  V ++DL+
Sbjct: 462 VWDSETGFLVERLDS-ENELSTGHKDSVYSVVF-TRDGQGVISGSLDRSVKLWDLR 515

>Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W
           (REAL)
          Length = 315

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 9/108 (8%)

Query: 71  GNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLD-SRHGMLACGTELSGTDAEIH 128
           G+   TAS+D SV+I  L        V     +P ISL  +R G L   + +   D  I 
Sbjct: 67  GHCLATASDDFSVEIIHLSYGLLHTFV--GHTAPVISLTFNRKGNLLFTSSM---DESIK 121

Query: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD 176
           ++D   ++  +     +H + +  +    +D S+L SGS DG + ++D
Sbjct: 122 IWD--TLNGSLMKTISAHSEAVVSVDVPLNDSSILSSGSYDGLIRIFD 167

>TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.429
           YDR364C
          Length = 452

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 60/132 (45%), Gaps = 11/132 (8%)

Query: 54  HGTSISALKVLDNDVDSGNTFVTASEDSV-KIFDLRLNQCVATVQNAKNSPFISLDSRHG 112
           H     AL+ L N   SG+ F++   D + +I+D   ++         + P  ++D  + 
Sbjct: 158 HLNGTGALRFLPN---SGHLFLSGGNDCMLRIWDFYHDRGCLRDYKGHSKPIKAVDFAND 214

Query: 113 MLACGTELSGT-DAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGY 171
                T LS   D +  ++D +      R    + H    D+KFH S+P+  + G ++  
Sbjct: 215 GR---TFLSAAFDQKAKIWDTETGKVTSRY---NFHSTPNDLKFHPSEPNSFIVGLSNSK 268

Query: 172 VNVYDLKQQEEE 183
           +N YD++ Q ++
Sbjct: 269 INHYDVRVQAKQ 280

>KLLA0F12694g Chr6 complement(1174812..1175954) [1143 bp, 380 aa]
           {ON} weakly similar to uniprot|Q6Q5U4 Saccharomyces
           cerevisiae YDR065W Hypothetical ORF
          Length = 380

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 54/144 (37%), Gaps = 32/144 (22%)

Query: 186 LHQVINFASIHSCGWLSPKRIWALSHMETFSIHE-------LNDKSDELVEPKPLEFGDI 238
           L Q +     H  GW     +  LSH+  + + +       L +K  E +EP P      
Sbjct: 43  LRQAVRRNRNHKAGWYVRGLLEDLSHLNKYIVGDDIIKLVALKNKYTEQIEPAPEPLQQA 102

Query: 239 RKPWNCDYVVDIFPGCIITGSTQEQSMLQ----LLPFSNEEVDTTNSII----------- 283
            KP           G ++T +  ++S  +    L P   +  D    ++           
Sbjct: 103 NKP---------ISGVVVTENMGDESRREKKKRLAPIPGDG-DLYRYLLRYYKIYGPTKT 152

Query: 284 IPRAHGDEVVRDALIHKTTSELFY 307
           IPR H DE++R   IH+   ++ Y
Sbjct: 153 IPRKHIDELLRPLAIHERYCKILY 176

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/144 (20%), Positives = 61/144 (42%), Gaps = 16/144 (11%)

Query: 93  VATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAP----MRSFCDSHHD 148
           + TV+N  N    +LD    M+  G  L+G D    +Y  ++  +      + F   ++ 
Sbjct: 271 IHTVRNHGNVEGYALD-WSPMIKNGALLTG-DCSGQIYFTQRHTSKWITDKQPFTAENNK 328

Query: 149 DITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGWLSP----- 203
            + DI++  ++ +V  S   DGY+ ++D + ++ + AL    +   ++   W        
Sbjct: 329 SVEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKIGYLL 388

Query: 204 -----KRIWALSHMETFSIHELND 222
                  +W +  +  FS   +ND
Sbjct: 389 ASGDDNGLWGVWDLRQFSPDNIND 412

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 144 DSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVI 190
           D H   IT I F+  D S++   S D  V ++DL  + ++E + Q I
Sbjct: 420 DFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQI 466

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 127 IHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEAL 186
           + L DL+     +RS   +H   +   KF+  +  VL S  ++G +N++D+++   E  +
Sbjct: 276 VSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLVLASADSNGRLNLWDIRKM-NESPI 334

Query: 187 HQVINFASIHSCGW 200
             + + ASI +  W
Sbjct: 335 TTMEHGASISTLEW 348

>Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {ON}
            YHR186C (REAL)
          Length = 1556

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 58/129 (44%), Gaps = 18/129 (13%)

Query: 30   SALSNGHVHLID-WNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASED-SVKIFDL 87
            S L+ G V +I  W++ T   ++ +   + S +  L  D  +GN FV    D S++++D 
Sbjct: 1322 SLLTTGDVKVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDR 1381

Query: 88   RLNQCVATVQNAKNSPFISLDSRHGMLACGTEL----------SGTDAEIHLYDLKKIDA 137
            RL+   + ++  +       + R G+      L            T+  + L+D++  D 
Sbjct: 1382 RLDPRDSMIRRWRAG-----NERQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSED- 1435

Query: 138  PMRSFCDSH 146
            P+ SF D +
Sbjct: 1436 PVESFVDQN 1444

>TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 44/112 (39%), Gaps = 6/112 (5%)

Query: 74  FVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK 133
           F   S   V++F     Q + T    K+  + +     G L C  + +G    + +YD  
Sbjct: 55  FAVTSSTRVQLFSSSTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGL---VSVYDSY 111

Query: 134 KIDAPMRSF-CDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEE 184
                + S    SH   +T  KFH  D   L++ S D    V+D+    E +
Sbjct: 112 NPRTLLLSINASSHPTHVT--KFHTQDSKTLVTASDDRITRVWDISHAYEPQ 161

>TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa]
           {ON} Anc_6.325 YCR057C
          Length = 901

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 86/191 (45%), Gaps = 29/191 (15%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  S++AL    +    G+  VTA+ED  +K++D+    C+
Sbjct: 313 GQLLVYEWQSESYILKQQGHFDSLNALTYSPD----GSRVVTAAEDGKIKVWDVISGFCL 368

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
            T++   +S      ++ G +     L GT   +  +DL +     R F  +       I
Sbjct: 369 VTLEGHTSSVTAVQFAKRGQVLFSASLDGT---VRAWDLIRY-RNFRVFTAAER-----I 419

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEALH------QVINFAS----IHSC 198
           +F+  A DPS   + +GS D + ++V+ ++  +  + L         ++F+     + S 
Sbjct: 420 QFNCLAVDPSGECVCAGSVDSFDIHVWSVQTSQLLDTLSGHEGPVSCLSFSQENSVLASA 479

Query: 199 GWLSPKRIWAL 209
            W    RIW++
Sbjct: 480 SWDKTIRIWSI 490

>Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W
           (REAL)
          Length = 1152

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 120 LSGTDAEIHLYDLKKIDAPMRSFC-DSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           +S ++ +  +++L K  A    F    H   ITDI F+   P VL + S D YV+ +D++
Sbjct: 86  VSTSNQKAIIWNLAKSSANAIEFVLHGHSRAITDINFNPQHPDVLATCSVDTYVHAWDMR 145

>Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa]
           {ON} YBR175W (SWD3) - YBR175W [contig 22] FULL
          Length = 316

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 5/65 (7%)

Query: 112 GMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGY 171
           G L C   +   D  I ++D+  +   +     +H + +  I     DPS+L SGS DG 
Sbjct: 111 GNLLCSCSM---DESIKIWDI--LSGTLLRTLSAHSEPVVSIDLPPFDPSILSSGSYDGL 165

Query: 172 VNVYD 176
           + ++D
Sbjct: 166 IRIFD 170

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 11/115 (9%)

Query: 69  DSGNTFVTASEDSVKIFDLRLNQCVATVQ--NAKNSPFISLDSRHGMLACGTELSGTDAE 126
           D      TAS  S+KI++++ ++C+ T +   A    F+      G+L      SG   E
Sbjct: 401 DDNKLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLP----GGLLVILGTRSG---E 453

Query: 127 IHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQE 181
           + L+DL    + + +  D+H   I  +    SD   L++GS D  V  +D + ++
Sbjct: 454 LQLFDLAS-SSLLDTIEDAHDAAIWSLDL-TSDGKRLVTGSADKTVKFWDFQVEK 506

>TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {ON}
           Anc_8.631 YOR212W
          Length = 417

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 39/66 (59%), Gaps = 5/66 (7%)

Query: 30  SALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLR 88
           S  S+G+ ++ D  S  ++Q+  V  + ++A+K  ++    GN+ VT S+D  + +FDLR
Sbjct: 241 SCGSDGYAYIWDIRSPAAVQNFFVSDSDVNAIKYFND----GNSIVTGSDDGIIHMFDLR 296

Query: 89  LNQCVA 94
            +  +A
Sbjct: 297 ADCEIA 302

>ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR212W (STE4)
          Length = 467

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 69/133 (51%), Gaps = 21/133 (15%)

Query: 54  HGTSISALKVLDNDVDSGNTFVTASED-SVKIFDL----RLNQC---VATVQNAKNSPFI 105
           H   IS ++ LD+     N+ +TAS D +  ++D+    R+N+    +  V +   +P  
Sbjct: 215 HTCYISEIEFLDD-----NSILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAP-T 268

Query: 106 SLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLS 165
             +    + A G    G+D  ++++D K++   ++SF  S   D++ +KF   + + + +
Sbjct: 269 ETEGNGNVFASG----GSDGYLYIWD-KRVPTSVQSFFVSD-SDVSKVKFF-RNGNTIAT 321

Query: 166 GSTDGYVNVYDLK 178
           GS DG  N+YDL+
Sbjct: 322 GSDDGCTNLYDLR 334

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 30  SALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLR 88
           S  S+G++++ D    TS+Q   V  + +S +K   N    GNT  T S+D    ++DLR
Sbjct: 279 SGGSDGYLYIWDKRVPTSVQSFFVSDSDVSKVKFFRN----GNTIATGSDDGCTNLYDLR 334

>TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {ON}
           Anc_6.325 YCR057C
          Length = 912

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 81/189 (42%), Gaps = 25/189 (13%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H     AL  L    D G+  VT+SED  +KI+D+    C+
Sbjct: 316 GQLLVYEWQSESYILKQQGH---FDALNDLTYSPD-GSRVVTSSEDGKIKIWDVVSGFCL 371

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
           AT +   +S      ++ G +     L GT   +  +DL +     R+F      D    
Sbjct: 372 ATFEEHTSSVTAVQFAKRGQVLFSASLDGT---VRAWDLIR----YRNFRTFTSTDRIQF 424

Query: 154 KFHASDPS--VLLSGSTDGY-VNVYDLKQQEEEEALH------QVINFAS----IHSCGW 200
              A DPS  V+ +GS D + ++V+ ++  +  + L         + F+     + S  W
Sbjct: 425 NCLAVDPSGEVVCAGSLDNFEIHVWSVQTGQLLDTLAGHEGPVSCLAFSQENGVLASASW 484

Query: 201 LSPKRIWAL 209
               RIW++
Sbjct: 485 DKTIRIWSI 493

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 52/111 (46%), Gaps = 4/111 (3%)

Query: 93  VATVQNAKNSPFISLDSRHGMLACGTELSG-TDAEIHL--YDLKKIDAPMRSFCDSHHDD 149
           V T++N  N    +LD    ++  G  L+G    +I+L   +  K     + F   ++  
Sbjct: 270 VHTIKNHGNVEGYALD-WSPLIKTGALLTGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKS 328

Query: 150 ITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGW 200
           + DI++  ++ +V  S   DGYV ++D + ++ + AL    +   ++   W
Sbjct: 329 VEDIQWSRTEATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISW 379

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 81/188 (43%), Gaps = 17/188 (9%)

Query: 14  DNWCLKLQPLYSRG-LLSALSNGHVHLIDWNSLTSIQDI-PVHGTSISALKVLDNDVDSG 71
           + + L   PL   G LL+   +G ++L   N+   + D  P    +  +++ +       
Sbjct: 280 EGYALDWSPLIKTGALLTGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTEA 339

Query: 72  NTFVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEI 127
             F +   D  V+I+D R  Q    ++   +  +   IS + + G L    + +G+    
Sbjct: 340 TVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGS---W 396

Query: 128 HLYDLKKIDA-------PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
            ++DL++          P+  + D H   IT I F+  + S++   S D  V ++DL  +
Sbjct: 397 GVWDLRQFTPDNINNVQPVAQY-DFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVE 455

Query: 181 EEEEALHQ 188
            ++E + Q
Sbjct: 456 ADDEEIKQ 463

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 54/116 (46%), Gaps = 12/116 (10%)

Query: 70  SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           SG+  V+ S D +V+I+DLR  QC  T+        +++    G       L   D  + 
Sbjct: 428 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSL---DRAVR 484

Query: 129 LYD------LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           ++D      ++++D+        H D +  + F   D + ++SGS D  V +++L+
Sbjct: 485 VWDSETGFLVERLDS-ENELGTGHKDSVYSVVF-TRDGNGVVSGSLDRSVKLWNLR 538

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/92 (18%), Positives = 41/92 (44%), Gaps = 10/92 (10%)

Query: 140 RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCG 199
           +SF   ++  I DI++  ++ +V  +   DGY+ ++D + ++ + A+    +   ++   
Sbjct: 330 QSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVIS 389

Query: 200 WLSP----------KRIWALSHMETFSIHELN 221
           W             K +W +  +  FS  + N
Sbjct: 390 WNEKMEYLLASGDDKGVWGVWDLRQFSPSQEN 421

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 16/126 (12%)

Query: 74  FVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEI-H 128
           F TA  D  ++I+D R  +    ++T  +  +   IS + +   L      SG D  +  
Sbjct: 353 FATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLA----SGDDKGVWG 408

Query: 129 LYDLKKID------APMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
           ++DL++        +P+  + D H   IT I F+  D S +   S D  V ++DL  + +
Sbjct: 409 VWDLRQFSPSQENASPVAQY-DFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEAD 467

Query: 183 EEALHQ 188
           +E + Q
Sbjct: 468 DEEIKQ 473

>ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR093W
          Length = 518

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 59/141 (41%), Gaps = 8/141 (5%)

Query: 42  WNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKN 101
           W   +S Q +  H    +A+  ++ +    + F   S   V++F  R  Q + T    K+
Sbjct: 27  WRQYSSTQLVKEH----NAVTHIEFNPQHPHDFAVTSSTRVQLFSSRTRQVIKTFSRFKD 82

Query: 102 SPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPS 161
             + S     G L    + +G  +    Y+ + +   +++   +H   +T  KFH  D  
Sbjct: 83  VVYSSSFRPDGKLLAAGDATGLVSVYDSYNPRNLLVSIKA--STHPAHVT--KFHPLDKQ 138

Query: 162 VLLSGSTDGYVNVYDLKQQEE 182
            L++ + D  V V+D+    E
Sbjct: 139 TLVTATDDRVVRVWDISHAYE 159

>Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W
           (REAL)
          Length = 315

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 9/108 (8%)

Query: 71  GNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLD-SRHGMLACGTELSGTDAEIH 128
           G    TAS+D SV+I  L        V     +P ISL  +R G L   + +   D  I 
Sbjct: 67  GQCIATASDDFSVEIVHLSYGLLHTFV--GHTAPVISLAFNRKGNLLFTSSM---DESIK 121

Query: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD 176
           ++D   ++  +     +H + +  +    +D S+L SGS DG + ++D
Sbjct: 122 IWD--TLNGSLMKTISAHSEAVVSVDVPTNDSSILSSGSYDGLIRIFD 167

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 13/117 (11%)

Query: 69  DSGNTFVTASEDSVKIFDLRLNQCVATVQ--NAKNSPFISLDSRHGMLACGTELSGTDA- 125
           D      TAS  S+KI++L+   C+ T +   A    F+      GML     + GT A 
Sbjct: 439 DDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTCKFLP----GGMLV----IIGTRAG 490

Query: 126 EIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
           E+ L+DL      + +  ++H   I  +    SD   L++GS D  V  ++ + ++E
Sbjct: 491 ELQLFDLAS-STQIANIEEAHDAAIWSLDL-TSDGKRLITGSADKSVKFWNFQLEQE 545

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128w
          Length = 1120

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 145 SHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           SH   ITDI F+   P +L + S D YV+ +DL+
Sbjct: 112 SHSRAITDINFNFQHPDILATCSIDTYVHAWDLR 145

>KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.359
           YFR021W
          Length = 524

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 62/135 (45%), Gaps = 19/135 (14%)

Query: 30  SALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS--VKIFD- 86
           S + NG V + D N+L  I  I  H  S+++L VL  D   G+   TASE    V+IF  
Sbjct: 238 SLMKNGDVIIFDLNALQPIMVIEAHKNSLASL-VLSPD---GSLLATASEKGTIVRIFSV 293

Query: 87  ---LRLNQC-VATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKI--DAPMR 140
              L+L Q    T Q    S   S D++   ++C T+       +H++ ++ +     + 
Sbjct: 294 ETGLKLYQFRRGTYQAKIYSMCFSSDNQFLAISCSTK------TVHVFKMESLVSGTALS 347

Query: 141 SFCDSHHDDITDIKF 155
           +  D     +TD +F
Sbjct: 348 TSDDDSETAVTDERF 362

>ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38123 Saccharomyces
           cerevisiae YBR175W SWD3 Subunit of the COMPASS complex
           which methylates histone H3 on lysine 4 and is required
           in transcriptional silencing near telomeres
          Length = 319

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 71  GNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLD-SRHGMLACGTELSGTDAEIH 128
           G    TAS+D +V I  L        V +   +P +SL  +  G L C + +   D  I 
Sbjct: 70  GQCIATASDDFTVGITHLSYGPLHRLVSH--TAPVVSLAFNPKGNLLCSSSM---DESIK 124

Query: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177
           ++D+  ++  +     +H + +  +     D ++L SGS DG + V+D+
Sbjct: 125 IWDV--LNGSLMRTIAAHSESVVSVDIPQLDSTILSSGSYDGLIRVFDM 171

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 58/130 (44%), Gaps = 17/130 (13%)

Query: 71  GNTFVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAE 126
           G  F +A  D  ++I+D R  +    ++   +  +   IS   + G L      SG D  
Sbjct: 335 GTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLA----SGDDNG 390

Query: 127 I-HLYDLKKIDA-------PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           +  ++DL++          P+  + D H   IT I F+  D S++   S D  V ++DL 
Sbjct: 391 VWGVWDLRQFSPDTANSVQPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLS 449

Query: 179 QQEEEEALHQ 188
            + ++E + Q
Sbjct: 450 VEADDEEIKQ 459

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/61 (21%), Positives = 32/61 (52%)

Query: 140 RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCG 199
           + F  S++  I DI++  ++ +V  S   DGY+ ++D + ++ + A+    +   ++   
Sbjct: 315 QPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVIS 374

Query: 200 W 200
           W
Sbjct: 375 W 375

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
           H   ITDI FH   P +L + S D YV  +D++  + 
Sbjct: 113 HFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQR 149

>NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa]
           {ON} Anc_3.259 YDR030C
          Length = 478

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 25/46 (54%)

Query: 134 KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179
           K+D    +  +SHH  IT +K++  D  +  +GS D  + ++D  Q
Sbjct: 160 KMDDLEAAQGESHHGGITTMKWYGEDNGMFFTGSNDKIIKIWDTNQ 205

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 7/82 (8%)

Query: 127 IHLYDL---KKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEE 183
           I +YD+   +K+D  + +    H   +    F+  D ++L+SG  DG + ++DL+     
Sbjct: 205 ISIYDINKAEKLDKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCIKIWDLRTGSLN 264

Query: 184 EALHQVINFA----SIHSCGWL 201
            +    IN      SI    W+
Sbjct: 265 GSTRSDININTASDSIRDVKWM 286

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 90/228 (39%), Gaps = 56/228 (24%)

Query: 139 MRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEAL---------HQV 189
           +R   + H+  +T +    + P++LLSGS D  +  + L  ++++  +         H V
Sbjct: 25  LRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIV 84

Query: 190 INFASIH------SCGWLSPKRIWALSH---METFSIHELNDKSDELVEPKPLEFGDIR- 239
            +    H      S  W    R+W L     ++ F  H+ +D     ++P+  +      
Sbjct: 85  QDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHK-SDVMSVSIDPRATQIVSASR 143

Query: 240 ----KPWNCDYVVDIFPGCIIT--GSTQEQSMLQLLPFSNEEVDTTNSIIIPRAHGDEVV 293
               K WN          C++T  G     S +++ P  +E+ D  +++ +  A  D+VV
Sbjct: 144 DKTVKVWNT------VGDCVVTLLGHNDWVSNVRIAP--SEKSD--DAVTVISAGMDKVV 193

Query: 294 RDALIHKTTSE--------------------LFYSGGEDGNIVLWKSN 321
           +   +   T E                    +F S G+DG I+LW  N
Sbjct: 194 KVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLN 241

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/60 (20%), Positives = 31/60 (51%)

Query: 141 SFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGW 200
           +F   ++  I DI+F  ++ +V  +   DGY+ ++D + ++ + A+    +   ++   W
Sbjct: 327 AFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISW 386

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 12/116 (10%)

Query: 70  SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           SG+  V+ S D +V+I+DLR  QC  T+        +++    G       L   D  + 
Sbjct: 496 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSL---DRAVR 552

Query: 129 LYD------LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           ++D      ++++D+   S    H D +  + F   D   ++SGS D  V +++L+
Sbjct: 553 VWDSETGFLVERLDSENESGT-GHKDSVYSVVF-TRDGQSVVSGSLDRSVKLWNLQ 606

>KAFR0A04480 Chr1 (889486..890616) [1131 bp, 376 aa] {ON} Anc_6.143
           YBR234C
          Length = 376

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 72/167 (43%), Gaps = 30/167 (17%)

Query: 87  LRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSH 146
           LR+N+    VQ A N    ++ S   ++A    +   + E + +  K I  P++S     
Sbjct: 100 LRINRAATAVQWAPNGYKFAVGSSARIIA----VCYYEHENNWWVSKHIKKPIKS----- 150

Query: 147 HDDITDIKFHASDPSVLLSGSTDGYVNVYD--LKQQEEEEA---------------LHQV 189
              I  + +H S+  +L +G TDGY+ V+   +K  + +E+               + + 
Sbjct: 151 --TINCVSWH-SNGVLLAAGGTDGYMRVFSGFIKGLDTKESVANSPWGDKFPFGSLVREA 207

Query: 190 INFASIHSCGWLS-PKRIWALSHMETFSIHELNDKSDELVEPKPLEF 235
              A IH   W S  +++  ++H  T +I + N+    +  P  L F
Sbjct: 208 YQGAYIHDVQWRSNVEQVAYVAHDGTLNILDANNNVSSINAPDGLPF 254

>YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essential
           subunit of the COMPASS (Set1C) complex, which methylates
           histone H3 on lysine 4 and is required in
           transcriptional silencing near telomeres; WD40 beta
           propeller superfamily member and ortholog of mammalian
           WDR5
          Length = 315

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 9/108 (8%)

Query: 71  GNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLD-SRHGMLACGTELSGTDAEIH 128
           G    TAS+D SV+I  L        +     +P ISL  +R G L      S  D  I 
Sbjct: 67  GQCIATASDDFSVEIIHLSYGLLHTFI--GHTAPVISLTFNRKGNLL---FTSSMDESIK 121

Query: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD 176
           ++D   ++  +     +H + +  +    +D S+L SGS DG + ++D
Sbjct: 122 IWD--TLNGSLMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFD 167

>Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar to
           Ashbya gossypii ACR097W
          Length = 423

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 81/191 (42%), Gaps = 52/191 (27%)

Query: 30  SALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLR 88
           S  S+G++++ D  + TS+Q   V  + IS +K   N    G+T    S+D   +++DLR
Sbjct: 241 SGGSDGYLYIWDKRTPTSVQSFFVSDSDISKVKFFKN----GDTIAVGSDDGCARLYDLR 296

Query: 89  LNQCVA------TVQNAK-----------------NSPF-----------------ISLD 108
            +  +A      ++QNA                  NSP+                 ++LD
Sbjct: 297 SDCQIAQYSLSKSLQNATTRKPTYFPSSIEYNVHGNSPYSPSARTVESEFMDDQGIVALD 356

Query: 109 -SRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGS 167
            SR G L      S TDA   ++DL K +   +   D H D I+ +   + D   + +GS
Sbjct: 357 FSRSGRL---MYASYTDAGCVIWDLVKGEVIGK--LDGHSDRISGV-LTSPDGLAVCTGS 410

Query: 168 TDGYVNVYDLK 178
            D  + ++  K
Sbjct: 411 WDTTMKIWTPK 421

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 81/188 (43%), Gaps = 17/188 (9%)

Query: 14  DNWCLKLQPLYSRG-LLSALSNGHVHLIDWNSLTSIQDI-PVHGTSISALKVLDNDVDSG 71
           + + L   PL   G LL+   +G V+L   ++   I D  P    +  +++ +       
Sbjct: 284 EGYALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISDKEPFTVANNQSVEDIQWSRTES 343

Query: 72  NTFVTASEDS-VKIFDLRLNQ---CVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEI 127
             F +   D  ++++D R  +    ++   +  +   IS   + G L    + +GT    
Sbjct: 344 TVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGT---W 400

Query: 128 HLYDLKKID-------APMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180
            ++DL++         +P+  + D H   IT I F+  D S++   S D  V ++DL  +
Sbjct: 401 GVWDLRQFSPSNSNNTSPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVE 459

Query: 181 EEEEALHQ 188
            ++E + Q
Sbjct: 460 ADDEEIKQ 467

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 12/59 (20%), Positives = 31/59 (52%)

Query: 142 FCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGW 200
           F  +++  + DI++  ++ +V  S   DGY+ V+D + ++ + A+    +   ++   W
Sbjct: 325 FTVANNQSVEDIQWSRTESTVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISW 383

>CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006w LST8
          Length = 303

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 14/109 (12%)

Query: 127 IHLYDLKKIDA-PMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL------KQ 179
           I LYD+K  ++ P+ SF + H  ++T + F   D   +++ S DG + V+D+      + 
Sbjct: 55  IRLYDIKTSNSNPVASF-EGHRGNVTSVSFQ-QDNKWMVTSSEDGTIKVWDIRSPSVPRN 112

Query: 180 QEEEEALHQVI---NFASIHSCGWLSPKRIWALSHMETFSIHELNDKSD 225
            +    +++V+   N   + SC      RIW L   E    H+L  + D
Sbjct: 113 YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLG--ENQCTHQLTPEDD 159

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           H   ITDI F+  +P +L + S D YV+ +D++
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWDMR 148

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
           YOL138C (REAL)
          Length = 1332

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 9/83 (10%)

Query: 127 IHLYDLKK---IDAPM-RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
           I +YDL K   I+ P+  S C+ H   I    F+  + ++++SG  D  V ++DL+    
Sbjct: 236 ISIYDLNKSSSIENPLITSLCE-HTRSINSFDFNMVESNLIISGGQDSCVKIWDLRSNTS 294

Query: 183 EEALHQVINFA----SIHSCGWL 201
           + +    IN      SI    W+
Sbjct: 295 KSSNRADININTASDSIRDVKWM 317

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 93/204 (45%), Gaps = 33/204 (16%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  S+++L    +    G+  VT+S+D  +KI+D+    C+
Sbjct: 322 GQLLVYEWQSESYILKQQGHFDSMNSLTYSPD----GSRVVTSSDDGKIKIWDVVSGFCL 377

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
           AT  +  +S      ++ G +     L GT   +  +DL +     R+F  +       I
Sbjct: 378 ATFDDHTSSVTAVQFAKKGQVLFSASLDGT---VKAWDLIRY-RNFRTFTAAER-----I 428

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEALH------QVINFAS----IHSC 198
           +F+  A DPS  V+ +GS D + ++V+ ++     + L         ++F++    + S 
Sbjct: 429 QFNCLAVDPSGEVVCAGSVDSFEIHVWSVQTGNLLDTLAGHEGPVSCLSFSNENSVLASA 488

Query: 199 GWLSPKRIWAL----SHMETFSIH 218
            W    RIW++      +E F ++
Sbjct: 489 SWDKTIRIWSIFGRSQQVEPFDVY 512

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 57/127 (44%), Gaps = 14/127 (11%)

Query: 58  ISALKVLDNDVDSGNTFVTASEDSV-KIFDLRLNQCVATVQNAKNSPFISLDSRHGMLAC 116
           I+ALK+  N    G      S+  + +I+ L   + + +++ +     +  DS   ++A 
Sbjct: 63  ITALKLTPN----GEYLCFVSQAQLLRIYKLSSKKIIRSMKVSSPVYVMDCDSSSTLVAL 118

Query: 117 GTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSV---LLSGSTDGYVN 173
           G    GTD  + + D++       SF   H   I+ +KFH         L SG T G V 
Sbjct: 119 G----GTDGSVTVVDIEN-GYVTHSF-KGHGATISSVKFHGEQSGSIWRLASGDTSGMVK 172

Query: 174 VYDLKQQ 180
           V+DL ++
Sbjct: 173 VWDLVRR 179

>SAKL0G07040g Chr7 (577213..578250) [1038 bp, 345 aa] {ON} similar
           to uniprot|P26449 Saccharomyces cerevisiae YOR026W BUB3
           Kinetochore checkpoint WD40 repeat protein that
           localizes to kinetochores during prophase and metaphase
           delays anaphase in the presence of unattached
           kinetochores forms complexes with Mad1p-Bub1p and with
           Cdc20p binds Mad2p and Mad3p
          Length = 345

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 59/136 (43%), Gaps = 25/136 (18%)

Query: 58  ISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACG 117
           IS++ + D  V +G+      + S++I D R N      + A     +S+D     L   
Sbjct: 132 ISSICIQDASVIAGSW-----DGSLRIVDSRNND--TQFETALGHKVLSMDCHENKLC-- 182

Query: 118 TELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVL------LSGSTDGY 171
             +S T  E+ ++DL+K+ AP+             +KF A D  ++      +  S DG 
Sbjct: 183 --ISLTAGEVKIFDLRKLGAPV--------SRKAGLKFQARDIKIMPSYEGYVQSSLDGR 232

Query: 172 VNVYDLKQQEEEEALH 187
           V V    Q+E++ A  
Sbjct: 233 VAVEYFDQEEKKFAFR 248

>TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.77
           YGR145W
          Length = 713

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 55/127 (43%), Gaps = 17/127 (13%)

Query: 85  FDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCD 144
           F L +N+  AT         +S++S +G++A G E    D+ +  +D +      + + +
Sbjct: 176 FKLDINEEKATAVGGGGVNHVSINSANGLVAVGLE----DSVVEFWDPRARSRVSKLYLE 231

Query: 145 SHHDD----ITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGW 200
           +  D+    +T   F  +D      G+++GY  +YDL+  E         +    H  G+
Sbjct: 232 NTIDNSDFTVTTTSFR-NDGINFACGTSNGYSYLYDLRASEP--------SIVKDHGYGF 282

Query: 201 LSPKRIW 207
              K IW
Sbjct: 283 EIKKLIW 289

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 102 SPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPS 161
           S F  +DS        +  +   A+I L+D+ ++  P+ S      D+IT +KF+ ++  
Sbjct: 180 SAFQGIDSHR----VNSTFATGGAKIQLWDVNRV-KPV-SNLSWGADNITSVKFNQNETD 233

Query: 162 VLLSGSTDGYVNVYDLKQQEEEEALHQVINFASI 195
           +L S  +D  + +YDL+     + + Q +   +I
Sbjct: 234 ILASTGSDNSIVLYDLRTNSPTQKIVQTMRTNAI 267

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 11/112 (9%)

Query: 69  DSGNTFVTASEDSVKIFDLRLNQCVATVQ--NAKNSPFISLDSRHGMLACGTELSGTDAE 126
           D      TAS  S+KI++++ ++C+ T +   A +  F+      G+L     L     E
Sbjct: 401 DDNKLLATASNGSLKIWNVKTHKCIRTFECGYALSCKFLP----GGLLVI---LGTRTGE 453

Query: 127 IHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           + L+DL    + + +  D+H   I  +    SD   L++GS D  V  +D +
Sbjct: 454 LQLFDLAS-SSLLDTVEDAHDAAIWSLDL-TSDGKRLVTGSADKTVKFWDFQ 503

>KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 875

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 20  LQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSI-----SALKVLDNDVDSGNT 73
           ++ LY+  LL   ++G V+  DW+S + ++ I V    +       L ++ N+VD  NT
Sbjct: 436 VEKLYAGALLGVKADGFVYFFDWDSGSLVRRIDVDANDVVWSENGELLMIINNVDENNT 494

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 71/163 (43%), Gaps = 13/163 (7%)

Query: 28  LLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASED-SVKIFD 86
           +L+ L +G V + ++ + T ++ I V  T + A K +       N  V  S+D  +++F+
Sbjct: 28  VLTTLYSGRVEIWNFETQTEVKSITVTETPVRAGKFIARK----NWIVVGSDDFKIRVFN 83

Query: 87  LRLNQCVATVQNAKN--SPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCD 144
               + +A  +   +         +R  +L+   +L+     +  ++ +K  +  ++F +
Sbjct: 84  YNTGEKIADFEAHPDYIRSIAVHPTRPYVLSASDDLT-----MKFWNWEKNWSLEQTF-E 137

Query: 145 SHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALH 187
            H   +  + F+  DPS   S   D  V ++ L Q      LH
Sbjct: 138 GHEHFVMGVAFNPKDPSTFASACLDHTVKIWSLGQPTANFTLH 180

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 33/61 (54%)

Query: 140 RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCG 199
           + F   ++  I DIK+  S+ +V  +   DG+V ++D++ ++ + AL   ++   ++   
Sbjct: 325 QPFTVDNNKSIEDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMS 384

Query: 200 W 200
           W
Sbjct: 385 W 385

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 53/252 (21%), Positives = 93/252 (36%), Gaps = 41/252 (16%)

Query: 77  ASEDSVKIFDLRLNQCVATVQNAKNSPF-ISLDSRHGMLACGTELSGTDAEIHLYDLKKI 135
           +S+ ++ IFD   +      Q+  + PF   L   HG++     +  + A+I        
Sbjct: 149 SSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDTSSADI-------- 200

Query: 136 DAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASI 195
                       ++ T + ++    ++LLS  ++G V V+D+KQ   E  +   +   SI
Sbjct: 201 ------------NEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIID-LPLVSI 247

Query: 196 HSCGWLSPKRIWALSHMETF---------SIHELNDKSDELVEPKPLEFGDIRKPWNCDY 246
           +S G       W  +H   F         S+ +L  K ++L   +    G +    +C +
Sbjct: 248 NSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVN---SCRF 304

Query: 247 VVDIFPGCIITGSTQEQSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIHKTTSELF 306
               +   +I  S      L L    N       S I    HG  V          + L 
Sbjct: 305 N---YKNSLILASADSNGRLNLWDIRN----MNKSPIATMEHGTSVSTLEWSPNFDTVLA 357

Query: 307 YSGGEDGNIVLW 318
            +G EDG + LW
Sbjct: 358 TAGQEDGLVKLW 369

>TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON}
           Anc_8.631 YOR212W
          Length = 433

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 122 GTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           G+D  I+L+D++        F      DI  ++F   D + L SGS DG + ++DL+
Sbjct: 256 GSDGYIYLWDVRTGSVAQTFFV--SDSDINAVQFF-KDGNALASGSDDGIIRLFDLR 309

>KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {ON}
           Anc_2.469 YMR093W
          Length = 508

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 45/113 (39%), Gaps = 4/113 (3%)

Query: 74  FVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLK 133
           F   S   V+IF  +  Q V T    K+  + +     G L    + +G  +    Y+ +
Sbjct: 55  FAVTSSTRVQIFSSKTRQVVKTFSRFKDVVYSASFRNDGKLLVAGDATGLVSVYDAYNPR 114

Query: 134 KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEAL 186
            I   +     +H   +T  KFH  D   L++ S D    ++D+    E + L
Sbjct: 115 SILLSIN--ASTHPTHVT--KFHPQDNKTLVTTSDDRVTRIWDISHAYEAQEL 163

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 12/116 (10%)

Query: 70  SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           SG+  V+ S D +V+I+DLR  QC  T+        +++    G       L   D  + 
Sbjct: 496 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSL---DRAVR 552

Query: 129 LYD------LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           ++D      ++++D+   S    H D +  + F   D   ++SGS D  V +++L+
Sbjct: 553 VWDSETGFLVERLDSENESGT-GHKDSVYSVVF-TRDGQSVVSGSLDRSVKLWNLQ 606

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 11/122 (9%)

Query: 75  VTASEDS-VKIFDLRLNQCVATVQNAKNSPFISL--DSRHGMLACGTELSGTDAEIHLYD 131
           V+AS+D+ VK++D R  QC++T+   K++   +    +R  +LA  ++    D    ++D
Sbjct: 232 VSASKDNLVKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAISK----DKSCRVFD 287

Query: 132 LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVIN 191
           ++     +   C     D   + ++  + S+   G+ DG +  +DL Q  + E    VI 
Sbjct: 288 IRHSMKEL--MCVRDEVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQ--DLEGPSHVIP 343

Query: 192 FA 193
           +A
Sbjct: 344 YA 345

>Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AEL269C
          Length = 465

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 69/173 (39%), Gaps = 24/173 (13%)

Query: 8   TISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDND 67
           T+ F +D   L    L S GL+  L +G            I ++  H   I  L    N 
Sbjct: 312 TLGFQTDGSLLASGGLDSIGLIWDLRSGE----------PIMNLVGHQKPIYGLDWSPN- 360

Query: 68  VDSGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPF-ISLDSRHG-MLACGTELSGTD 124
              G    TAS D S+KI+DLR    V+T+   +N  F I  D  +G  L  G    G D
Sbjct: 361 ---GYQVATASGDGSIKIWDLRKQSIVSTLLAHRNVAFDIKFDKANGHFLVSG----GYD 413

Query: 125 AEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDL 177
            E+ +++    +  +    + H D I  +    SD S   S   D  V  + L
Sbjct: 414 RELKIFNADNWE--LIKTLEGHTDKILSVDL-VSDGSKFFSTGWDRTVKQWTL 463

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 84/190 (44%), Gaps = 27/190 (14%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVA 94
           G + + +W S + I     H  S++ L       D       A++  +K++D+    C+A
Sbjct: 318 GQLLVYEWQSESYILKQQGHFDSLNGLTY---SPDGARVVTAANDGKIKVWDVVSGFCLA 374

Query: 95  TVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIK 154
           T     +S      ++ G +   + L GT   +  +DL +     R+F  +       I 
Sbjct: 375 TFSEHTSSVTAVQFAKRGQVLFSSSLDGT---VRAWDLIRF-RNFRTFTSTQR-----IP 425

Query: 155 FH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEAL--HQ----VINFAS----IHSCG 199
           F+  A DPS  V+ +GS+D + ++V+ ++  +  ++L  H+     + F+     + S  
Sbjct: 426 FNCLAVDPSGEVVCAGSSDSFEIHVWSVQTGQLLDSLDGHEGPVSCLAFSQENSVLASAS 485

Query: 200 WLSPKRIWAL 209
           W    RIW++
Sbjct: 486 WDKTIRIWSI 495

>YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subunit
           of the SEA (Seh1-associated) complex, a coatomer-related
           complex that associates dynamically with the vacuole;
           has N-terminal WD-40 repeats and a C-terminal RING
           motif; mtc5 is synthetically sick with cdc13-1
          Length = 1148

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           H   ITDI F+   P VL + S D YV+ +D++
Sbjct: 113 HSRAITDINFNPQHPDVLATCSVDTYVHAWDMR 145

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 1/67 (1%)

Query: 126 EIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEA 185
           +I ++DL+K   P+ S    H   +  I F+    S ++S S DG V  +D  +   E  
Sbjct: 181 DIFVWDLRKGSTPLCSL-KGHVSSVNSIDFNRFKYSEIMSSSNDGTVKFWDYSKSTTESK 239

Query: 186 LHQVINF 192
                NF
Sbjct: 240 RTVTTNF 246

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 76/166 (45%), Gaps = 16/166 (9%)

Query: 28  LLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKI-FD 86
           LLS   +  V L D  S  S +++  H   +S +KV      SG    +AS D   I +D
Sbjct: 230 LLSGGGDNLVKLWDMTS-NSFEELRGHAGRVSRVKVHP----SGRLAASASFDLTWILWD 284

Query: 87  L-RLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDS 145
           L R  +      ++K    I+  S   +LA     +G DA   ++DL+  +  M+   + 
Sbjct: 285 LERKVELQLQEGHSKAVYTIAFQSDGALLAS----AGLDAVCAIWDLRSGEPIMK--LEG 338

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEAL--HQV 189
           H   I+ + +  +   +  +G+ DG V V+D++    E AL  HQV
Sbjct: 339 HAGAISGVDWSPNGYQLATAGA-DGTVRVWDIRNVGTESALLAHQV 383

>Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           H   ITDI F+   P VL + S D YV+ +D++
Sbjct: 112 HSRAITDINFNPQHPDVLATCSVDTYVHAWDMR 144

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 1/67 (1%)

Query: 126 EIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEA 185
           +I ++DL+K   P+ S    H   +  I F+    + ++S S DG V  +D  +   E  
Sbjct: 180 DIFVWDLRKGSTPLCSL-KGHVSSVNSIDFNRFKSTEIMSSSNDGTVKFWDYSKSTTESK 238

Query: 186 LHQVINF 192
                NF
Sbjct: 239 RTVTTNF 245

>AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR128W
          Length = 1125

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           H   ITDI FH   P +L + S D YV+ +D++
Sbjct: 113 HTRAITDINFHPIHPELLATCSIDTYVHAWDMR 145

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           H   ITDI F++  P +L + S D YV+ +D++
Sbjct: 114 HSRAITDINFNSQHPDILATCSIDTYVHAWDMR 146

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 126 EIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
           ++ ++DL+    P+      H+  +  I F   + + ++S S DG V  +DL ++E+
Sbjct: 182 DVFIWDLRHGSTPLHKLT-GHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSKEEK 237

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           H   ITDI F+   P VL + S D YV+ +D++
Sbjct: 112 HSRAITDINFNPQHPDVLATCSVDTYVHAWDMR 144

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 1/67 (1%)

Query: 126 EIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEA 185
           ++ ++DL+K   P+ S    H   +  I F+    + L+S S DG V  +D  +   E  
Sbjct: 180 DVFVWDLRKGSTPLCSL-KGHVSSVNSIDFNRFKSTELMSSSNDGTVKFWDYSKSTTESK 238

Query: 186 LHQVINF 192
                NF
Sbjct: 239 RTVTTNF 245

>Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON}
           (40266..43685) [3420 nt, 1140 aa]
          Length = 1139

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 145 SHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           +H   ITDI F+   P +L + S D Y++ +DL+
Sbjct: 112 AHFRAITDINFNRQHPDILATCSIDTYIHAWDLR 145

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 61/128 (47%), Gaps = 14/128 (10%)

Query: 58  ISALKVLDNDVDSGNTFVTASEDSV-KIFDLRLNQCVATVQNAKNSPFISLDSRHGMLAC 116
           I+ALKV  +    G   +  S+  + KI ++   + + +++ +  S  I  D    ++  
Sbjct: 32  ITALKVTPD----GKYLIFVSQAQLLKIVNVSTGKIIKSMKVSSPSYIIDCDKTSTLVTI 87

Query: 117 GTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHA---SDPSVLLSGSTDGYVN 173
           G    GTD  + + D++  +  +      H   I+ +KF     S+  +L SG T+G V 
Sbjct: 88  G----GTDGSVVVIDIE--NGYITHSLKGHGGTISSLKFFGELNSNIWLLCSGDTNGMVK 141

Query: 174 VYDLKQQE 181
           ++DL +++
Sbjct: 142 IWDLVKRK 149

>SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {ON}
           conserved hypothetical protein
          Length = 959

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 5/82 (6%)

Query: 100 KNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHD-DITDIKFHAS 158
           K +  +SL      L  G   +G    + LY L        +F   HH   I ++KFH +
Sbjct: 136 KTTSCLSLSPDEKFLIVGE--TGHHPRVLLYSLAPDSNDFPAFVIHHHSYGIANLKFHPT 193

Query: 159 DPSVLLSGS--TDGYVNVYDLK 178
           DP + LS     DG+++++ L+
Sbjct: 194 DPKIFLSLGLINDGFLHIWRLQ 215

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 135 IDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           ID+P     ++H D++T +     DPS L+SGS D  +  +DL+
Sbjct: 488 IDSPCVYTFEAHTDEVTALSL---DPSFLVSGSQDRTIRQWDLR 528

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 92/204 (45%), Gaps = 33/204 (16%)

Query: 35  GHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCV 93
           G + + +W S + I     H  S ++L    +    G+  VTA++D  +K++D+    C+
Sbjct: 321 GQLLVYEWQSESYILKQQGHFDSTNSLTYSPD----GSRVVTAADDGKIKVWDVVSGFCL 376

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDI 153
           AT     +S      ++ G +   + L GT   +  +DL +     R+F  +       I
Sbjct: 377 ATFTEHTSSVTQVQFAKKGQVLFSSSLDGT---VRAWDLIRY-RNFRTFTAAER-----I 427

Query: 154 KFH--ASDPS--VLLSGSTDGY-VNVYDLKQQEEEEALH------QVINFAS----IHSC 198
           +F+  A DPS  V+ +GS D + ++V+ ++  +  + L         ++F+     + S 
Sbjct: 428 QFNCLAVDPSGEVVCAGSIDSFDIHVWSVQTGQLLDTLSGHEGPVSCLSFSQENSVLASA 487

Query: 199 GWLSPKRIWAL----SHMETFSIH 218
            W    RIW++      +E F ++
Sbjct: 488 SWDKTVRIWSIFGRSQQVEPFEVY 511

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 51/111 (45%), Gaps = 4/111 (3%)

Query: 93  VATVQNAKNSPFISLDSRHGMLACGTELSG-TDAEIHLYD--LKKIDAPMRSFCDSHHDD 149
           V T++N  N     LD    ++  G  LSG    +I+L      K     +++   ++  
Sbjct: 267 VHTIRNHGNVEGYGLD-WSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKS 325

Query: 150 ITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGW 200
           I DI++  ++ +V  +   DGY+ V+D + ++ + A+    +   ++   W
Sbjct: 326 IEDIQWSKTESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISW 376

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 12/116 (10%)

Query: 70  SGNTFVTASED-SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIH 128
           SG+  V+ S D +V+I+DLR  QC  T+        +++    G       L   D  + 
Sbjct: 500 SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSL---DRAVR 556

Query: 129 LYD------LKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           ++D      ++++D+   S    H D +  + F     SV +SGS D  V +++L+
Sbjct: 557 VWDSETGFLVERLDSENESGT-GHKDSVYSVVFTRDGESV-VSGSLDRSVKLWNLQ 610

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 78/189 (41%), Gaps = 47/189 (24%)

Query: 148 DDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEEEEALHQVINFASIHSCGWLSPKRIW 207
           D+I  +KF+ +D +VL S  +D  + +YDL+      A  +++    ++S  W +P    
Sbjct: 217 DNINTVKFNQNDANVLGSAGSDNSIVLYDLRTN---SATQKIVQTMRVNSMCW-NP---- 268

Query: 208 ALSHMETFSIHELNDKSDELVEPKPLEFGDIRKPWNC--DYV-----VDIFPGC--IITG 258
               ME F+    ++  +        +  ++ +  N   D+V     VDI P    ++T 
Sbjct: 269 ----MEAFNFVVASEDHNAYY----YDMRNMSRALNVFKDHVSAVMDVDISPTGEEVVTA 320

Query: 259 STQEQSMLQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH-------KTTSELFYSGGE 311
           S  +   +++ P             I + H  E+     +           S+   SG +
Sbjct: 321 SYDK--TIRIFP-------------INKGHSREIYHTKRMQHVFQAKFSMDSKYVMSGSD 365

Query: 312 DGNIVLWKS 320
           DGN+ LW++
Sbjct: 366 DGNVRLWRA 374

>NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa]
           {ON} Anc_5.429 YDR364C
          Length = 435

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 64/128 (50%), Gaps = 8/128 (6%)

Query: 9   ISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDV 68
           + FG     +K +PL S   +  LSN  ++  D         + V+   +S++  L+   
Sbjct: 224 LRFGCIPNAIKFRPLNSNEFIVGLSNSKIYHYDDRISAKDGRVQVYDHHMSSILALEYFP 283

Query: 69  DSGNTFVTASED-SVKIFDLRLNQCVATVQN-AKNS-PFISLDSRHGMLACGTELSGTDA 125
           D G+ F+++SED +V++++ ++N  +  + + A++S P+IS+        C   +   D 
Sbjct: 284 D-GSKFISSSEDKTVRLWENQINIPIKQISDTAQHSMPYISIHPEEKYF-CTQSM---DN 338

Query: 126 EIHLYDLK 133
            I+ Y +K
Sbjct: 339 TIYTYGMK 346

>ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} similar
           to uniprot|Q03177 Saccharomyces cerevisiae YMR102C
           Protein of unknown function transcription is activated
           by paralogous transcription factors Yrm1p and Yrr1p
           along with genes involved in multidrug resistance
          Length = 880

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 54  HGTSISALKVLDNDVDSGNTFVTASEDS-VKIFDLRLNQCVATVQ 97
           HG  ++ L+   +  D  +  +T S DS V+IFDL+  +CV  ++
Sbjct: 434 HGPRVTYLQYFKSPNDESSKLMTVSNDSRVRIFDLKTKKCVEILR 478

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 68/173 (39%), Gaps = 25/173 (14%)

Query: 32  LSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQ 91
           + NG + +ID ++   + +     T      V  N++   +  V   + S+++FD++LN 
Sbjct: 35  VGNGKLFIIDIDNQGRMLETKSFVTQDGLFDVAWNELHENHVLVAQGDGSLRLFDIQLND 94

Query: 92  C-VATVQ-----------NAKNSPFISLDSRHGMLACG--------TELSGTDAEIHLYD 131
             VA  Q           N  N       S  G +           T L+      H   
Sbjct: 95  YPVAIFQEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWTPMRQSSLTTLTPKPMTAHNSA 154

Query: 132 LKKIDAPM-----RSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179
           L   D PM      +    + + I   +F   DP++++S + + YV ++DL+Q
Sbjct: 155 LSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFDLRQ 207

>CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178w PRP4
           U4/U6 snRNP
          Length = 500

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 8/107 (7%)

Query: 71  GNTFVTASEDSVKI-FDLRLNQCVATVQNAKNSPFISLDSRHG-MLACGTELSGTDAEIH 128
           G    TA  D   I +DLR  + V+ +Q    + +    S  G  LA G    G D  I 
Sbjct: 352 GALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATG----GGDGVIT 407

Query: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVY 175
           ++DL+K D   +     H   +T +KF  ++   L+S   D  + VY
Sbjct: 408 IWDLRKSDKLTK--ITEHKSIVTSLKFDKANDHNLISSGYDRSIFVY 452

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 64/156 (41%), Gaps = 29/156 (18%)

Query: 34  NGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCV 93
           NG V +ID N+L   Q +  H   +  +    ND    +  +T  ED            +
Sbjct: 233 NGEVSIIDSNTLEVTQTLQNHDGKVGGIAWTSND----SVLITGGEDH-----------L 277

Query: 94  ATVQNAKNSPFISLDSRHGMLACGTEL-----------SGTDAEIHLYDLKKIDAPMRSF 142
            TV N  +  FI+ +S  G     T+L           S  D+   L+D++K    +   
Sbjct: 278 ITVSNRSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLL--L 335

Query: 143 CDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
            + H  ++  + F A D +++ +  TD    ++DL+
Sbjct: 336 QEGHSKELYCLAFQA-DGALVSTAGTDKTAIIWDLR 370

>TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.469
           YMR093W
          Length = 511

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 45/100 (45%), Gaps = 12/100 (12%)

Query: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYD---- 176
           S  D    L+D+     P+  F  +  D +    F  S P ++++GS DG++ +YD    
Sbjct: 143 SSDDRVTRLWDISHAYEPISEFTGAS-DYVRTACFIPSAPQLVVTGSYDGFIRLYDSRAN 201

Query: 177 ----LKQQEEEEALHQVINFASIH--SCGWLSPKRIWALS 210
               +   + E+ +  VI  +     SCG  S  ++W L+
Sbjct: 202 NSSPIYSMKHEQPVEDVIAISPTQLVSCGG-SNFKVWDLT 240

>KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {ON}
           Anc_2.663 YKL021C
          Length = 381

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%)

Query: 11  FGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVDS 70
           F + +  +K   +  R L+S  ++ H+ + D      +  +  H  SI+ALK   N+  +
Sbjct: 37  FQAHSLSVKTLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITALKFSKNEAST 96

Query: 71  GNTFVTASED 80
               ++ASED
Sbjct: 97  NKWLLSASED 106

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLK 178
           H   ITDI F+  +P +L + S D YV+ +D++
Sbjct: 112 HSRAITDINFNPENPDILATCSIDTYVHAWDMR 144

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 146 HHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182
           H   ITDI F    P +L + S D YV+ +DL+  + 
Sbjct: 113 HFRAITDINFSPQHPDILATCSIDTYVHAWDLRSPQR 149

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,589,425
Number of extensions: 2283937
Number of successful extensions: 9697
Number of sequences better than 10.0: 398
Number of HSP's gapped: 9866
Number of HSP's successfully gapped: 475
Length of query: 409
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 297
Effective length of database: 40,638,807
Effective search space: 12069725679
Effective search space used: 12069725679
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)