Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_31246.65ON27425811201e-155
AGR270W6.65ON2942576645e-86
SAKL0A08426g6.65ON2991715393e-67
CAGL0L04620g6.65ON2642555233e-65
Kpol_1042.116.65ON2922624942e-60
Suva_8.2276.65ON2871694829e-59
Smik_15.3526.65ON2881714812e-58
NCAS0F003306.65ON2811954775e-58
Skud_15.3366.65ON2861894767e-58
YOR174W (MED4)6.65ON2841764672e-56
ZYRO0D14190g6.65ON2951914672e-56
KLTH0G15444g6.65ON2631684617e-56
TBLA0G005506.65ON3181834657e-56
NDAI0J013206.65ON3342634623e-55
Kwal_56.232426.65ON2562594503e-54
KAFR0G025006.65ON2892564507e-54
KLLA0F20185g6.65ON2851684384e-52
KNAG0M010206.65ON2791854252e-50
TPHA0F025906.65ON3061744134e-48
TDEL0G040606.65ON2201953961e-46
TBLA0C050107.356ON57282740.67
NCAS0E028407.356ON60768712.0
Kpol_1050.883.455ON121395676.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3124
         (274 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   436   e-155
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   260   5e-86
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   212   3e-67
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   206   3e-65
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   194   2e-60
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   190   9e-59
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   189   2e-58
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   188   5e-58
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   187   7e-58
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   184   2e-56
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   184   2e-56
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   182   7e-56
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   183   7e-56
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   182   3e-55
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   177   3e-54
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   177   7e-54
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   173   4e-52
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   168   2e-50
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   163   4e-48
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   157   1e-46
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    33   0.67 
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    32   2.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...    30   6.0  

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  436 bits (1120), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 222/258 (86%), Positives = 222/258 (86%)

Query: 17  DELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYD 76
           DELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYD
Sbjct: 17  DELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYD 76

Query: 77  SIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSG 136
           SIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLP                  IKSG
Sbjct: 77  SIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSG 136

Query: 137 VLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELN 196
           VLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELN
Sbjct: 137 VLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELN 196

Query: 197 SEEPQEPPQKGQSQEEDEVTPTHXXXXXXXXXXXXXXXXXXTGKAKNQQSTQYSETGAHE 256
           SEEPQEPPQKGQSQEEDEVTPTH                  TGKAKNQQSTQYSETGAHE
Sbjct: 197 SEEPQEPPQKGQSQEEDEVTPTHSSDTPSSKPDSKSESFEFTGKAKNQQSTQYSETGAHE 256

Query: 257 EADGSIDLDLDLFNPDEF 274
           EADGSIDLDLDLFNPDEF
Sbjct: 257 EADGSIDLDLDLFNPDEF 274

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  260 bits (664), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 138/257 (53%), Positives = 166/257 (64%), Gaps = 5/257 (1%)

Query: 18  ELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDS 77
           E N +  V +Y+DLCQ+EE LQ+LV SVDKF PDL+AAQ+LI  D KLYS L QLP YD 
Sbjct: 43  EQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDL 102

Query: 78  IDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGV 137
           ID QLK+L+ ES++IDERT KIL IL +CYN+LN LP                  + S V
Sbjct: 103 IDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSV 162

Query: 138 LLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNS 197
           LLEYAMKL+KFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKS+ELT +P     
Sbjct: 163 LLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLP----G 218

Query: 198 EEPQEPPQKGQSQEEDEVTPTHXXXXXXXXXXXXXXXXXXTGKAKNQQSTQYSETGAHEE 257
           +  QE  Q    +E D   P                    TG  K   ++  +++   ++
Sbjct: 219 QSDQEAEQASAGKEADTAGPGVSTLEPANGGHNRRGSFEFTGIRKPPPASD-ADSSVVDD 277

Query: 258 ADGSIDLDLDLFNPDEF 274
            D S+DLDL+LFNPDEF
Sbjct: 278 GDASMDLDLNLFNPDEF 294

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  212 bits (539), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 125/171 (73%)

Query: 22  VQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQ 81
           + +V +Y D+C++EE L KLV SVDKF PDL+ AQ+LI +D KL+  LE+ P YD ID +
Sbjct: 44  LSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGR 103

Query: 82  LKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLLEY 141
           L  L+ +SQE+D++T KIL +L+ C+  LN LP                  I SGVLL+Y
Sbjct: 104 LNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDY 163

Query: 142 AMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIP 192
           AMKLAKFTRVPPTF+K  +GPNNFIWPAEDA+RRGMLAMASLKS+ELTRIP
Sbjct: 164 AMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIP 214

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  206 bits (523), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 114/255 (44%), Positives = 152/255 (59%), Gaps = 7/255 (2%)

Query: 21  HVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDI 80
            + +V LY DLC +EE L KLV SVD F P L+  + LI +D KLYSTL+ LP YDS+  
Sbjct: 16  ELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVFT 75

Query: 81  QLKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLLE 140
           +L+ LD+E  ++D++T  ILSIL++C+++LN LP                  IKS VLLE
Sbjct: 76  RLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVLLE 135

Query: 141 YAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEEP 200
           YA KLAKFT++PPTF+K  IGPNNFIWPAEDA+R+GMLAMASL  +ELT++P + + EE 
Sbjct: 136 YATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPGQEDGEE- 194

Query: 201 QEPPQKGQSQEEDE-VTPTHXXXXXXXXXXXXXXXXXXTGKAKNQQSTQYSETGAHEEAD 259
                 G +  ED+ +                         A    +    +  A E+ D
Sbjct: 195 -----DGSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVFGANANDAEGDEDKNAGEDED 249

Query: 260 GSIDLDLDLFNPDEF 274
            ++D DLDLFNPDEF
Sbjct: 250 EAMDSDLDLFNPDEF 264

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  194 bits (494), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/262 (42%), Positives = 157/262 (59%), Gaps = 10/262 (3%)

Query: 17  DELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYD 76
           +E N + +V +Y D+ ++E  L KLV SVDKF PD++ A  LI+ D +L+ +L+    YD
Sbjct: 37  NESNDLSKVQIYNDISEYENTLFKLVESVDKFKPDVKLAHQLIDVDERLFKSLDSFVEYD 96

Query: 77  SIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSG 136
            I  +L++ D E+ E+D +T +IL  L++C+  LN LP                  I S 
Sbjct: 97  KISTKLEECDKEAAELDTKTKEILGTLNECHGLLNSLPMLEQVEFEKDIILKQRSKINSK 156

Query: 137 VLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELN 196
           +LL+YA KL+KFT++PPTFNK +IGPNNFIWPAEDA+RRGMLAMASL S+ELT++P    
Sbjct: 157 LLLDYATKLSKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTKLP---- 212

Query: 197 SEEPQEPPQKGQSQEEDEVT-PTHXXXXXXXXXXXXXXXXXX---TGKAKNQQSTQYSET 252
             EP+E  +  +S E D+ T P                       + K K  +  + +E 
Sbjct: 213 -NEPEEASEPDKSTEPDKSTEPIEEEKITVDNEGDISMGSIVYDGSHKVKENEKAEENEK 271

Query: 253 GAHEEADGSIDLDLDLFNPDEF 274
           G+  EAD ++DLDLDLFNPDEF
Sbjct: 272 GSEAEAD-NMDLDLDLFNPDEF 292

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  190 bits (482), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 123/169 (72%)

Query: 24  QVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQLK 83
           +V LY+DLC++E+ L KLV SVD+F P+L+ A+DLI +D  L++ ++ L  YD ID+ L+
Sbjct: 39  KVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLR 98

Query: 84  QLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLLEYAM 143
           ++D +S+E+D +T KIL IL++C++ L+ LP                  I S  LL+YA 
Sbjct: 99  KIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYAT 158

Query: 144 KLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIP 192
           KL+KFTR+PPTF+K  +GPNNFIWPAEDA+RRGMLAMASL S+ELTRIP
Sbjct: 159 KLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRIP 207

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  189 bits (481), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 87/171 (50%), Positives = 123/171 (71%)

Query: 22  VQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQ 81
           + +V LY+DLC++E+ L+KLV SVD+F PD+  A+DLI  D  L++ ++ L  YD+ID  
Sbjct: 37  LSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNIDRN 96

Query: 82  LKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLLEY 141
           L+++D +S+E+D +T +IL I+++C++ L  LP                  I S  LL+Y
Sbjct: 97  LRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTALLDY 156

Query: 142 AMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIP 192
           A KL+KFTR+PPTF+K +IGPNNFIWPAEDA+RRGMLAMASL S+ELTR+P
Sbjct: 157 ATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTRVP 207

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  188 bits (477), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 95/195 (48%), Positives = 126/195 (64%)

Query: 22  VQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQ 81
           + +V +Y DLC +E+ L  LV SVDKF PD+ AA++LI  D  L+ TL+    YD ID  
Sbjct: 41  ISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKIDNS 100

Query: 82  LKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLLEY 141
           LK+L+ ES E+D RT +IL IL++C++ LN LP                  I S VLL+Y
Sbjct: 101 LKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLLDY 160

Query: 142 AMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEEPQ 201
           A KL+KFT++PPTF+K +IGPNNFIWPAEDA+RRGMLA+ASL ++ELT+ P     EE  
Sbjct: 161 ATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALASLHADELTKAPGAHEGEEEL 220

Query: 202 EPPQKGQSQEEDEVT 216
            P       +E+ VT
Sbjct: 221 IPKGSEPIAQEEPVT 235

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  187 bits (476), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 132/189 (69%), Gaps = 1/189 (0%)

Query: 22  VQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQ 81
           + +V LY+DLC++E  L KLV SVD+F PDL  A+DLI++D  L++ ++ L  YD+ID  
Sbjct: 37  LSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNIDRN 96

Query: 82  LKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLLEY 141
           L+++D +S+E+D ++ KIL IL++C++ L+ LP                  I S  LL+Y
Sbjct: 97  LQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALLDY 156

Query: 142 AMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEEPQ 201
           A KL+KFT++PPTF+K  +GPNNFIWPAEDA+RRGMLAMASL S+ELTR+P E + +E +
Sbjct: 157 ATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGE-DEQETE 215

Query: 202 EPPQKGQSQ 210
           E P    SQ
Sbjct: 216 EVPTAPLSQ 224

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  184 bits (467), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 91/176 (51%), Positives = 124/176 (70%), Gaps = 3/176 (1%)

Query: 17  DELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYD 76
           D+L+ VQ   LY+DLC++E+ L KLV SVD+F P+L  A+DLI +D  L+  ++ L  YD
Sbjct: 35  DKLSKVQ---LYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYD 91

Query: 77  SIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSG 136
           +I   L+++D +S+E+D +T KIL IL++C++ L  LP                  I S 
Sbjct: 92  NIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINST 151

Query: 137 VLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIP 192
            LL+YA KL+KFT++PPTF+K A+GPNNFIWPAEDA+RRGMLAMASL S+ELTRIP
Sbjct: 152 ELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIP 207

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  184 bits (467), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 93/191 (48%), Positives = 120/191 (62%), Gaps = 3/191 (1%)

Query: 17  DELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYD 76
           DEL+ VQ   +Y DL Q+EE L  LV SVD F PD++   +LI  D  LY +L+    YD
Sbjct: 41  DELSKVQ---IYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYD 97

Query: 77  SIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSG 136
            ID +L +LD ES E+D +T ++L  L +CY  LN LP                  + S 
Sbjct: 98  RIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSS 157

Query: 137 VLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELN 196
           VLL YA KL+KFT++PPTF+K  IGPNNF+WPAEDA+RRGMLA+ASL S+E+TRIP E  
Sbjct: 158 VLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPGEPE 217

Query: 197 SEEPQEPPQKG 207
            EE     ++G
Sbjct: 218 EEEADATEKQG 228

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  182 bits (461), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 85/168 (50%), Positives = 117/168 (69%)

Query: 20  NHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSID 79
           N + ++ +Y D+C+FE+ L KLV SVD+F+PDL+ A+ LI +D +LY +LE LP YD ID
Sbjct: 20  NPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEID 79

Query: 80  IQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLL 139
            + K LD E ++ DE+T +IL  L +C ++LN LP                  + + VLL
Sbjct: 80  TRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVLL 139

Query: 140 EYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEE 187
           +YAMKLAKFT VPPTF+K  +GPNNF+WPAEDA+RRGMLA+ASL++ E
Sbjct: 140 DYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASE 187

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  183 bits (465), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 121/183 (66%), Gaps = 3/183 (1%)

Query: 17  DELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYD 76
           DEL+ +Q    Y DL Q+EE L KL  SVDK+ PDLQ A DLI+ D KLYSTL+    YD
Sbjct: 35  DELSKIQT---YNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYD 91

Query: 77  SIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSG 136
            I  +LK+L+ +++ +DE+T  +L  L+ C+  LN LP                  I S 
Sbjct: 92  EISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSK 151

Query: 137 VLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELN 196
           VLL+YA KLAKFT++PPTFNK+ +GPNNFIWPAEDA+RRGMLA+AS  +EELT +P  + 
Sbjct: 152 VLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPGSVG 211

Query: 197 SEE 199
            EE
Sbjct: 212 DEE 214

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  182 bits (462), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 106/263 (40%), Positives = 149/263 (56%), Gaps = 14/263 (5%)

Query: 22  VQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQ 81
           + +V +Y D+  +E+ L +L+ SVDKF P+L  AQ+LI +D  L+ TL     YD ID+ 
Sbjct: 76  LSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLH 135

Query: 82  LKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLLEY 141
           LK L+ ++ +IDE T   L  L++C+++LNKLP                  I S +LL+Y
Sbjct: 136 LKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDY 195

Query: 142 AMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEEPQ 201
           A KL+KFT++PPTF+K +IGPNNFIWPAED++RRGMLAMASLK+++LT IP +  S    
Sbjct: 196 ATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMS-- 253

Query: 202 EPPQKGQSQEEDEVTPTHXXXXXXXXXXXXXXXXXXTGKAKNQQ---------STQYSET 252
              +K    E  E                       +GK K ++         S +  E 
Sbjct: 254 --KEKALPTEVQETQEQTQTQQQDQEEQPRRESFVFSGKNKEEEEETTHTHEDSKRKQEE 311

Query: 253 GAHEEAD-GSIDLDLDLFNPDEF 274
             HE  D  ++D+DLDLFNPDEF
Sbjct: 312 KDHESGDEDAMDIDLDLFNPDEF 334

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  177 bits (450), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 109/259 (42%), Positives = 150/259 (57%), Gaps = 26/259 (10%)

Query: 20  NHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSID 79
           + + +  +Y D+C+FEE L KLV SVDKF+PDL+ A+ LI  D +L  TLE LP YD ID
Sbjct: 20  SRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEID 79

Query: 80  IQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLL 139
           ++ K+LD +  E DER  +IL  L +C  +LN LP                  + + VLL
Sbjct: 80  LRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLL 139

Query: 140 EYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEE 199
           +YAMKLAKFT VPPTF+K A+GPNNF+WPAEDA+RRGMLA+ASL++ E  + P    ++ 
Sbjct: 140 DYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKPETGAAQT 199

Query: 200 PQEPPQKGQSQEEDEVTPTHXXXXXXXXXXXXXXXXXXTGKAKNQQSTQYSETGAH---- 255
            +E  ++ QS  + +V                          + + S +++ TG      
Sbjct: 200 AEETTKQPQSSPQLKVE----------------------EPMQRRDSFEFNGTGTKSPES 237

Query: 256 EEADGSIDLDLDLFNPDEF 274
           E+AD  IDLDLDLFN DE 
Sbjct: 238 EKADDDIDLDLDLFNSDEL 256

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  177 bits (450), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 100/256 (39%), Positives = 150/256 (58%), Gaps = 10/256 (3%)

Query: 22  VQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQ 81
           + +V +Y DL Q+EE L +L+ S+D + PD + AQ+LI+ D KL+++L+    YD I  +
Sbjct: 41  ITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSR 100

Query: 82  LKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLLEY 141
           LK  + + +E   +T +IL  L++C+N LN LP                  I S VLL+Y
Sbjct: 101 LKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDY 160

Query: 142 AMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIP-VELN-SEE 199
           A KL+KFT++PPTF+K +IGPNNF+WPAEDA+RRGMLA+A+  ++ELT+I  VE++ S++
Sbjct: 161 ATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDD 220

Query: 200 PQEPPQKGQSQEEDEV-TPTHXXXXXXXXXXXXXXXXXXTGKAKNQQSTQYSETGAHEEA 258
                 + +S +  E   P                      + KN +  +       EEA
Sbjct: 221 NSIALDEIKSVDAGEGPIPEKKDSSSRRGSYIFAGQSGKNAEHKNNEENK-------EEA 273

Query: 259 DGSIDLDLDLFNPDEF 274
           D ++DLDLDLFNPD+F
Sbjct: 274 DNAVDLDLDLFNPDDF 289

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  173 bits (438), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 111/168 (66%)

Query: 21  HVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDI 80
            +Q V +Y+DL ++EE +Q+L  SVD F PDL     +I  D KLY TLE+   Y  I+ 
Sbjct: 31  ELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYKIEE 90

Query: 81  QLKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLLE 140
           +L +LD E + ID +T +IL  L+ CYN+LN+LP                  I S V+L+
Sbjct: 91  ELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLD 150

Query: 141 YAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEEL 188
           YAMKLAKFTR PPTF+K  IGPNNFIWPAED++R+GMLAMASLK +EL
Sbjct: 151 YAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLKKKEL 198

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  168 bits (425), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 124/185 (67%)

Query: 22  VQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQ 81
           +++V +Y  + ++E+ L  LV SVD + PD+  AQ L+++D +L+++L++   YD I  +
Sbjct: 40  LKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTR 99

Query: 82  LKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLLEY 141
           L +L  +S  +D +T  IL  L++C++ LNKLP                  I S  LL+Y
Sbjct: 100 LGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDY 159

Query: 142 AMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEEPQ 201
           A KL+KFTR+PPTF+K +IGPNNFIWPAEDA+R+GMLA+A+L S ELTRIP + ++E+ +
Sbjct: 160 ATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELTRIPGQDDAEDKK 219

Query: 202 EPPQK 206
           +  +K
Sbjct: 220 KQTEK 224

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  163 bits (413), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 112/174 (64%)

Query: 19  LNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSI 78
           ++ +  V +Y D+  +E+ L KLV S+D F PD++ A+ LI  D +LY  L     YD I
Sbjct: 54  VDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEI 113

Query: 79  DIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVL 138
           D ++ ++ ++S+++D +T  IL IL+   N LN LP                  I S +L
Sbjct: 114 DTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKIL 173

Query: 139 LEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIP 192
           L+YA K++KFT++PPTFNK +IGPNNFIWPAEDA+RRGMLA+AS+   ELT++P
Sbjct: 174 LDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIHRSELTKLP 227

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  157 bits (396), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 115/195 (58%), Gaps = 5/195 (2%)

Query: 27  LYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQLKQLD 86
           +Y DL ++EE L +LV SVD+F PDL  A++L+ +D  L  +L++  LYD +D +L++LD
Sbjct: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63

Query: 87  NESQEIDERTGKILSILDKCYNNLNKLPXXXXXXXXXXXXXXXXXXIKSGVLLEYAMKLA 146
            ES+ ++  T + L  LD+CY  L+ LP                  + S VLLEYA KL+
Sbjct: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123

Query: 147 KFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELT--RIPVELNSEEPQEPP 204
           KFT+ P      A+GPNNF+WPAEDA+RRG LA+A+L SEE+T         S E  EP 
Sbjct: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEITLGSTGERSGSVESSEPV 180

Query: 205 QKGQSQEEDEVTPTH 219
           Q  +S E  +  P  
Sbjct: 181 QPSESAEPRKYEPRR 195

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 34  FEEDLQKLVVSVDKFSPDLQAAQDLI----NSDLKLYSTLEQLPLYDSIDIQLKQLDNES 89
              DL    V    F+PD++    +I       LKL+       +  + D +L+ L N +
Sbjct: 471 LSRDLGVGNVLTSAFAPDIEIGATMIVGGVTGGLKLWDAFSNRTVRKTFDTELRALQNNA 530

Query: 90  QEIDERTGKILSILDKCYNNLN 111
           +E+ ++TG+   I  K  +N N
Sbjct: 531 RELAKQTGRSSRISRKYIHNNN 552

>NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.356
           YLR196W
          Length = 607

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 48  FSPDLQAAQDLI----NSDLKLYSTLEQLPLYDSIDIQLKQLDNESQEIDERTGKILSIL 103
           F+PDL+ +  ++    N DLKL+       +  S   +LK + N +++  E++GK   I 
Sbjct: 520 FAPDLEVSGTMVIGGVNKDLKLWDVFTNRTVRKSFASELKDVQNRARQEAEQSGKSSRIA 579

Query: 104 DKCYNNLN 111
            K   N N
Sbjct: 580 RKYTQNDN 587

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 18   ELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDL---QAAQDLINSDLKLYSTLEQLPL 74
            +LN ++ +TL K L  FEE++    V+  K S  +    A Q+++N   K +  LE    
Sbjct: 1055 DLNFIKHLTLKKYLKFFEENISISSVNRSKLSVAITSPMATQEIMNR--KFFLQLEGFLK 1112

Query: 75   YDSIDIQLKQLDNESQEIDERTGKILSILDKCYNN 109
             +   I    L +   E   R GK+  +L   ++N
Sbjct: 1113 LNGFTINNDTLKSMVSESQGRPGKLFKLLFNYFSN 1147

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.131    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,006,695
Number of extensions: 955368
Number of successful extensions: 3533
Number of sequences better than 10.0: 57
Number of HSP's gapped: 3597
Number of HSP's successfully gapped: 60
Length of query: 274
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 166
Effective length of database: 41,097,471
Effective search space: 6822180186
Effective search space used: 6822180186
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)