Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_31196.69ON37837820040.0
AGR274C6.69ON37535010781e-146
SAKL0A08206g6.69ON6451111283e-07
Kpol_1008.29singletonON538105970.002
ZYRO0B01936gsingletonON824132920.009
CAGL0D00924g4.238ON1980120870.045
ZYRO0E04708gsingletonON61150840.080
ZYRO0A11132gsingletonON69851810.19
Kwal_56.232566.69ON56781810.20
Smik_8.905.267ON192793770.63
TDEL0G045606.69ON48292750.87
TBLA0I028904.237ON1098129741.5
CAGL0M13827g5.14ON184086741.5
KLLA0D15158g3.442ON66690731.6
Suva_4.1914.238ON1782189731.8
Ecym_55145.414ON85498731.9
ADR145C2.633ON635114703.6
TBLA0E017305.702ON182028704.5
KNAG0A031708.636ON471122694.6
YHR023W (MYO1)5.267ON192880704.9
CAGL0I10901g8.604ON816145695.0
Suva_4.3633.369ON139277696.3
YDR259C (YAP6)5.619ON38395686.4
KLLA0C13145g7.39ON79233686.9
NCAS0G002305.702ON1735124687.5
KLLA0F04455g2.238ON305124677.6
Suva_10.5624.331ON138136648.1
Kpol_193.38.484ON934170678.5
Kwal_23.44242.16ON94892679.5
NOTE: 6 genes in the same pillar as Ecym_3119 were not hit in these BLAST results
LIST: Skud_15.344 Smik_15.362 YOR177C Suva_8.233 KLTH0G15334g TPHA0K01150

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3119
         (378 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar t...   776   0.0  
AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}...   419   e-146
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    54   3e-07
Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {O...    42   0.002
ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {...    40   0.009
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    38   0.045
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    37   0.080
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    36   0.19 
Kwal_56.23256 s56 complement(468118..469821) [1704 bp, 567 aa] {...    36   0.20 
Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W ...    34   0.63 
TDEL0G04560 Chr7 (831920..833368) [1449 bp, 482 aa] {ON} Anc_6.6...    33   0.87 
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    33   1.5  
CAGL0M13827g Chr13 (1362159..1367681) [5523 bp, 1840 aa] {ON} si...    33   1.5  
KLLA0D15158g Chr4 (1281895..1283895) [2001 bp, 666 aa] {ON} simi...    33   1.6  
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    33   1.8  
Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar...    33   1.9  
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...    32   3.6  
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...    32   4.5  
KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.6...    31   4.6  
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    32   4.9  
CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} simi...    31   5.0  
Suva_4.363 Chr4 complement(638701..642879) [4179 bp, 1392 aa] {O...    31   6.3  
YDR259C Chr4 complement(974631..975782) [1152 bp, 383 aa] {ON}  ...    31   6.4  
KLLA0C13145g Chr3 (1119411..1121789) [2379 bp, 792 aa] {ON} simi...    31   6.9  
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    31   7.5  
KLLA0F04455g Chr6 complement(428010..428927) [918 bp, 305 aa] {O...    30   7.6  
Suva_10.562 Chr10 (979014..979430) [417 bp, 138 aa] {ON} YLR445W...    29   8.1  
Kpol_193.3 s193 complement(3067..5871) [2805 bp, 934 aa] {ON} co...    30   8.5  
Kwal_23.4424 s23 complement(713602..716448) [2847 bp, 948 aa] {O...    30   9.5  

>Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar to
           Ashbya gossypii AGR274C
          Length = 378

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/378 (100%), Positives = 378/378 (100%)

Query: 1   MSSNNVHASEDGPCLLDLTFMKNKSVSEDPSFVEIAVNGILDQDTVVAQRKIKFNDCPMG 60
           MSSNNVHASEDGPCLLDLTFMKNKSVSEDPSFVEIAVNGILDQDTVVAQRKIKFNDCPMG
Sbjct: 1   MSSNNVHASEDGPCLLDLTFMKNKSVSEDPSFVEIAVNGILDQDTVVAQRKIKFNDCPMG 60

Query: 61  PKLTKNEVPAIPKKSILVNRENTTDTPTEQEIPNEEVLLLLRRCFNFCNLDTDGIEKRSI 120
           PKLTKNEVPAIPKKSILVNRENTTDTPTEQEIPNEEVLLLLRRCFNFCNLDTDGIEKRSI
Sbjct: 61  PKLTKNEVPAIPKKSILVNRENTTDTPTEQEIPNEEVLLLLRRCFNFCNLDTDGIEKRSI 120

Query: 121 EENLESISYGIISTFRFHECCYKYAHELETTSKVKAECPIVPLVEGKSPADAELQHEAVV 180
           EENLESISYGIISTFRFHECCYKYAHELETTSKVKAECPIVPLVEGKSPADAELQHEAVV
Sbjct: 121 EENLESISYGIISTFRFHECCYKYAHELETTSKVKAECPIVPLVEGKSPADAELQHEAVV 180

Query: 181 WKIEAEALGIKNNVLMVENGKLINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFKLKDK 240
           WKIEAEALGIKNNVLMVENGKLINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFKLKDK
Sbjct: 181 WKIEAEALGIKNNVLMVENGKLINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFKLKDK 240

Query: 241 IKDNNIETQTKIKQLQDTTGRLEKVITQRTSTISNLKQDRHTLRKQLAKSTENNINLKGA 300
           IKDNNIETQTKIKQLQDTTGRLEKVITQRTSTISNLKQDRHTLRKQLAKSTENNINLKGA
Sbjct: 241 IKDNNIETQTKIKQLQDTTGRLEKVITQRTSTISNLKQDRHTLRKQLAKSTENNINLKGA 300

Query: 301 NNRLKQHVDNLLYLFNDCENPASENNPSQLPQQFEHLKLTSDIESDHIATTKKIRPLSSN 360
           NNRLKQHVDNLLYLFNDCENPASENNPSQLPQQFEHLKLTSDIESDHIATTKKIRPLSSN
Sbjct: 301 NNRLKQHVDNLLYLFNDCENPASENNPSQLPQQFEHLKLTSDIESDHIATTKKIRPLSSN 360

Query: 361 HCRSTRNRHISSKVPGYI 378
           HCRSTRNRHISSKVPGYI
Sbjct: 361 HCRSTRNRHISSKVPGYI 378

>AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR177C
           (MPC54)
          Length = 375

 Score =  419 bits (1078), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 214/350 (61%), Positives = 269/350 (76%), Gaps = 6/350 (1%)

Query: 1   MSSNNVHASEDGP-CLLDLTFMK-NKSVSEDPSFVEIAVNGILDQDTVVAQRKIKFNDCP 58
           M  +N  A+ED   CL+DLTFMK +K + +DPSFVE+A+NGIL+QD++VAQRK+KF++ P
Sbjct: 1   MCPSNAQANEDPSLCLIDLTFMKQHKGLPDDPSFVELAINGILNQDSIVAQRKVKFSELP 60

Query: 59  MGPKLTKNEVPAIPKKSILVNRENTTDTPTEQEIPNEEVLLLLRRCFNFCNLDTDGIEKR 118
           +GP+ +       P+KSILV+R+ T    ++ E   +EV LLL RCFNFCNLDTDG+ +R
Sbjct: 61  LGPQPSARSSMTTPRKSILVSRQTTETENSDNEEDPDEVELLLHRCFNFCNLDTDGVAER 120

Query: 119 SIEENLESISYGIISTFRFHECCYKYAHELETTSKVKAECP--IVPLVEGKSPADAELQH 176
            + ENLE ISYGIISTFRFHECCYKYAHELE +S VK E P  ++P V+  +  D ++Q 
Sbjct: 121 PLVENLELISYGIISTFRFHECCYKYAHELEASSTVKEEVPQRLLP-VDKTATLDTDMQD 179

Query: 177 EAVVWKIEAEALGIKNNVLMVENGKLINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFK 236
           E V+WKIEAE LGIKNNVLM ENGKLI ELT+LRQTIR L DEKE L+AQV+++DIQL K
Sbjct: 180 ELVLWKIEAEELGIKNNVLMTENGKLIAELTALRQTIRTLNDEKEKLRAQVHDRDIQLLK 239

Query: 237 LKDKIKDNNIETQTKIKQLQDTTGRLEKVITQRTSTISNLKQDRHTLRKQLAKSTENNIN 296
           LKD+ KD + ETQ K+++LQD  GRLEKVI+QR STISNL++DR  LR++LAKSTE  IN
Sbjct: 240 LKDQSKDIDTETQVKLRRLQDLAGRLEKVISQRASTISNLREDRQALRRELAKSTELTIN 299

Query: 297 LKGANNRLKQHVDNLLYLFNDCENPASENNPSQLPQQFEHLKLTSDIESD 346
           LKG N RLK HVD+LL+LFNDCEN    ++ + LP Q + LKLTS  E D
Sbjct: 300 LKGDNRRLKAHVDSLLHLFNDCENEGPSSSVT-LPHQLQSLKLTSKHEKD 348

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
           hypothetical protein
          Length = 645

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 53/111 (47%), Gaps = 21/111 (18%)

Query: 38  NGILDQDTV--VAQRKIKFNDCPMGPKLTKNEVPAIPKKSILVNRENTTDTPTEQEIPNE 95
           NG L  D+V  V   K   N CP+  K +                 +T D   E  +P E
Sbjct: 169 NGNLKHDSVKSVLVEKNSDNACPLKSKDS-----------------DTADQDWEVNVPIE 211

Query: 96  EVLLL--LRRCFNFCNLDTDGIEKRSIEENLESISYGIISTFRFHECCYKY 144
             + L  + RCFN CN+  + +++  +  +L+ +S+GI+S F+  E CYKY
Sbjct: 212 NTVALEAITRCFNLCNVPLEDLDEDDLVMSLQRLSFGIVSAFKTQEMCYKY 262

>Kpol_1008.29 s1008 complement(62595..64211) [1617 bp, 538 aa] {ON}
           complement(62595..64211) [1617 nt, 539 aa]
          Length = 538

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (48%), Gaps = 12/105 (11%)

Query: 40  ILDQDTVVAQRKIKFNDCPMGPKLTKNEVPAIPKKSILVNRENTTDTPTEQEIPNEEVLL 99
           I DQD  V++  I+         LTK    +  +KSIL  RE+  D   +    ++E+  
Sbjct: 83  IFDQDKEVSKSGIQ-------KILTK---SSSSQKSILKKRED--DIEDKLYPQDDEITQ 130

Query: 100 LLRRCFNFCNLDTDGIEKRSIEENLESISYGIISTFRFHECCYKY 144
           +++R F  C ++   IE  S +E LE +S  I + F   E C KY
Sbjct: 131 IVKRMFTLCGVNLKHIEGISFKEQLERLSVSITNAFNTKEMCSKY 175

>ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {ON}
           weakly similar to uniprot|P25386 Saccharomyces
           cerevisiae YDL058W USO1 involved intracellular protein
           transport, coiled-coil protein necessary for protein
           transport from ER to Golgi; Integrin analogue gene
          Length = 824

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 25/132 (18%)

Query: 84  TDTPTEQEIPNEEVLLLLRRCFNFCNLDTDGIEKRSIEENL----ESISYGIISTFRFHE 139
           +D  T+ +  N++V+ LL+R F        GI    I+E+L    + ++ G++++F+  E
Sbjct: 140 SDEETQVKTSNQDVITLLQRIFTL-----HGIPPCEIKEDLLGTLQRLARGVVASFKQRE 194

Query: 140 CCYKYA------HELETTSKV--KAECPIVPLVEGKSPADAELQHEAVVWKIEAEALGIK 191
            CYKY        EL+    V  K +C +  L       + +L  E V W++  E   I+
Sbjct: 195 QCYKYVGRKQSIEELDELEYVNDKLKCEVAGL-------NKKLSQEKVRWEVVDEVF-IE 246

Query: 192 NNVLMVENGKLI 203
           N+ L  +  +LI
Sbjct: 247 NDSLKAKVEELI 258

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 67/120 (55%), Gaps = 10/120 (8%)

Query: 198  ENGKLINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFKLKDKIKD--NNIETQ-----T 250
            EN  LI+E  +L + + N +DE  NLK+ + EK+  L    D++KD  N +ET+     T
Sbjct: 1634 ENSSLISERKTLVEKVENFQDEITNLKSSL-EKNDSLSSSHDELKDKFNELETELKRNLT 1692

Query: 251  KIKQLQDTTGRLEKVITQRTSTISNLKQDRHTLRKQLAKSTENNIN-LKGANNRLKQHVD 309
            ++ +L+    +L   + +    +S ++++  T +K L K  E+ IN LK +NN L + +D
Sbjct: 1693 ELNKLESENKQLSDKVIEHEEKVSMVEKELSTAQKTL-KEREDVINKLKDSNNELNKTID 1751

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
           conserved hypothetical protein
          Length = 611

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 95  EEVLLLLRRCFNFCNLDTDGIEKRSIEENLESISYGIISTFRFHECCYKY 144
           E +  + RRC+  CNL     ++ +  ++L+ +  GI  +F+  + CYKY
Sbjct: 138 ERLFEVFRRCYTLCNLPMSQFDENNPFKSLKKLCEGIKKSFKAKDECYKY 187

>ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {ON}
           some similarities with uniprot|Q22X91 Tetrahymena
           thermophila SB210 TTHERM_00561660 Viral A-type inclusion
           protein repeat containing protein
          Length = 698

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 95  EEVLLLLRRCFNFCNLDTDGIEKRSIEENLESISYGIISTFRFHECCYKYA 145
           +EV++   +C+N C +  D ++   + ++L  + +GI + F+  E C+ Y 
Sbjct: 153 QEVMI---KCYNMCGISVDYLDIDKMFDSLGKLMFGISNEFKMKELCFNYV 200

>Kwal_56.23256 s56 complement(468118..469821) [1704 bp, 567 aa] {ON}
           YDL058W (USO1) - Integrin analogue gene [contig 183]
           FULL
          Length = 567

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 65  KNEVPAI-PKKSILVNRENT-------TDTPTEQEIP--NEEVLLLLRRCFNFCNLDTDG 114
           K E P + P+ SILV +E         + +  EQ+IP  N  VL  L RC++ C +    
Sbjct: 115 KKEPPRLTPRDSILVVKEQNPQYLEEDSQSDWEQDIPISNPVVLEGLLRCWDACGIPESE 174

Query: 115 IEKRSIEENLESISYGIISTF 135
            +   +   ++ +SYGI+  F
Sbjct: 175 FDDEDLIMTVQKLSYGILQAF 195

>Smik_8.90 Chr8 (131286..137069) [5784 bp, 1927 aa] {ON} YHR023W
            (REAL)
          Length = 1927

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 44/93 (47%)

Query: 193  NVLMVENGKLINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFKLKDKIKDNNIETQTKI 252
            N+ M     L+ E + LR    N + EKE L  Q+  KD QL K+K+KI ++  E     
Sbjct: 1057 NIAMSRLQSLVAENSDLRSKNENCKKEKELLNNQLKNKDNQLEKMKEKIDNHKKELAIFS 1116

Query: 253  KQLQDTTGRLEKVITQRTSTISNLKQDRHTLRK 285
            KQ  D      K+ T+   T + L + +   +K
Sbjct: 1117 KQRDDAVNEYGKITTELKETRTQLTEYKSNFQK 1149

>TDEL0G04560 Chr7 (831920..833368) [1449 bp, 482 aa] {ON} Anc_6.69
           YOR177C
          Length = 482

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 2/92 (2%)

Query: 52  IKFNDCPMGPKLTKNEVPAIPKKSILVNRENTTDTPTEQEIPNEEVLLLLRRCFNFCNLD 111
           + F +  + PK  K+    I  KSIL      + +   ++I   E+   + R +N C+L 
Sbjct: 115 VHFEESDIVPK--KSVGGPIRGKSILKRSSFNSPSTDYEKIGRRELQNAIARIYNLCDLP 172

Query: 112 TDGIEKRSIEENLESISYGIISTFRFHECCYK 143
                K     +LE ++ G+ + F+ HE C+K
Sbjct: 173 FTLFRKDDPLLSLELLARGVCNAFKSHEICWK 204

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
           YLR383W
          Length = 1098

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 16/129 (12%)

Query: 174 LQHEAVVWKIEAEALGIKNNVLMVENGKLINELTSLRQ-TIRNLRDEKENLKAQVYEKDI 232
           +Q+  V ++   E L    N L+ E  + +N++    Q T RN++ E E LK ++ ++DI
Sbjct: 761 IQNAIVSYETALEGLKENMNTLL-EKARPLNDIRDTAQKTYRNIKKEFEALKQELEDRDI 819

Query: 233 QLFKLKDKI---KDNNIETQTKIKQLQDTTGRLEKVI-----------TQRTSTISNLKQ 278
           ++ + KD I    D     Q KI ++Q     L   I           ++  ST  NL  
Sbjct: 820 RIRRYKDDITIQNDEKARIQEKIDRVQSNINDLMSGIETQIENASEFCSEEESTSENLPD 879

Query: 279 DRHTLRKQL 287
           ++  +RK+L
Sbjct: 880 NQDDIRKEL 888

>CAGL0M13827g Chr13 (1362159..1367681) [5523 bp, 1840 aa] {ON}
           similar to uniprot|Q04952 Saccharomyces cerevisiae
           YMR306w FKS3
          Length = 1840

 Score = 33.1 bits (74), Expect = 1.5,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 81  ENTTDTPTEQEIPNEEVLLLLRRCFNFCNLDTDGIEKRSIEENLESIS-YGIISTFRFHE 139
           E+     TE+++ NE++  +  RCF FC+ +     +  I  +L S + Y  I+ F  + 
Sbjct: 872 ESVGSISTERDLLNEQMKDMPYRCFGFCSSENIYTIRTRIWASLRSQTLYRTITGFMNYS 931

Query: 140 CCYKYAHELETTSKVKAECPIVPLVE 165
              K  + +E  S V      VPL+E
Sbjct: 932 KAIKLLYRIENPSMVALYGDNVPLLE 957

>KLLA0D15158g Chr4 (1281895..1283895) [2001 bp, 666 aa] {ON} similar
           to uniprot|P53038 Saccharomyces cerevisiae YGR099W TEL2
           Essential DNA-binding protein specific to
           single-stranded yeast telomeric DNA repeats required for
           telomere length regulation and telomere position effect,
          Length = 666

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 40/90 (44%), Gaps = 7/90 (7%)

Query: 251 KIKQLQDTTGRLEKVITQRTSTISNLKQDRHTLRKQ-------LAKSTENNINLKGANNR 303
           KI+ + + TG      ++R  T S + Q ++  RK        LA +  N INL   +  
Sbjct: 563 KIQDITEITGSKVTWRSKRLETDSKITQQQNNFRKYATLFFYPLAHAWLNGINLGAFDKV 622

Query: 304 LKQHVDNLLYLFNDCENPASENNPSQLPQQ 333
            K+H  ++L +   C +P  E    Q+  Q
Sbjct: 623 FKRHYISMLKIILTCASPHYELEEMQILMQ 652

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
            (REAL)
          Length = 1782

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 85/189 (44%), Gaps = 28/189 (14%)

Query: 200  GKLINELTSLRQTIRNLRDEKENLKAQV----YEKDIQLFKLKDKIKDNNIETQT----- 250
             KL  +L SL    R+L+ + E+L   +     E D QL  L+DK    + E ++     
Sbjct: 956  AKLTEKLKSLANNYRDLQAKHESLMQSIEVTKSENDTQLSNLQDKFDSLSREKESFQTEK 1015

Query: 251  -----KIKQLQDTTGRLEKVITQRTSTISNLKQDRHT----LRKQLAKSTENNINLKGAN 301
                  IK+L++T  RLE    + TS  ++ K D  +    L++QL  +T    +     
Sbjct: 1016 EHLTDDIKELKETISRLEHKNEETTSRYTSAKDDYESQINQLKEQLETATTTQDDNMDKI 1075

Query: 302  NRLKQHVDNLLYLFNDCENP---------ASENNPSQLPQQFEHLK-LTSDIESDHIATT 351
            + L +++ NL  L   C++          ASE   +++ +  E LK   + +E + + T 
Sbjct: 1076 SELSKNIRNLEMLLETCKSSKHDLQTKLEASEKTLAEMHENEERLKEEKAQLEKEVVNTK 1135

Query: 352  KKIRPLSSN 360
            K++  L  N
Sbjct: 1136 KELSTLREN 1144

>Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar to
           Ashbya gossypii AER241W
          Length = 854

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 53/98 (54%), Gaps = 9/98 (9%)

Query: 224 KAQVYEKD-IQLFKLKDKIKDNNIETQTKI----KQLQDTTGRLEKVITQRTSTISNLK- 277
           K ++ EKD  +L K+KD ++ NN E   K+    KQ+Q      E++++++   I +L+ 
Sbjct: 378 KMEILEKDNSKLSKMKDSLEQNNREFDVKLKKAEKQIQTLERERERILSEQQDAIHDLRL 437

Query: 278 --QDR-HTLRKQLAKSTENNINLKGANNRLKQHVDNLL 312
             Q R  +L K+++   E N  L+G N   K+  + L+
Sbjct: 438 EHQKRVQSLHKEVSNLREMNSKLEGDNQSYKKRFEQLV 475

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 59/114 (51%), Gaps = 3/114 (2%)

Query: 195 LMVENGKLINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFKLKDKIKDNNIETQTKIKQ 254
           L+ EN KL  ++ SL+  + N R +  + +  +   D+ L KL +K  +  +E Q+++  
Sbjct: 413 LLAENTKLRAQVDSLK-VLLNPRTDSLDTEQHISVDDL-LTKLMEKC-ELVVELQSRLDD 469

Query: 255 LQDTTGRLEKVITQRTSTISNLKQDRHTLRKQLAKSTENNINLKGANNRLKQHV 308
             D    L+K++T    T + L +  H L +QLA +  +N+NL   N  L + +
Sbjct: 470 QADKEKALKKLMTDLKHTEAQLVEKNHQLAEQLAIAQLDNLNLTNENMTLSKDI 523

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 20/28 (71%)

Query: 63   LTKNEVPAIPKKSILVNRENTTDTPTEQ 90
            +T  E P +P+  +L  RENTT+TP+++
Sbjct: 1758 VTPTETPEVPEDDLLSTRENTTETPSQE 1785

>KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.636
           YOR216C
          Length = 471

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 13/122 (10%)

Query: 202 LINELTSLRQTIRNLRDEK---ENLKAQVYEKDIQLFKLKDKIKDNNIETQTKIKQLQDT 258
           L++ ++S++   +NLRD K   EN++ Q+ E + Q  +LK+K+   + E +    +L+ T
Sbjct: 122 LLSRISSMKDVFQNLRDSKQELENVQEQLQEYESQNLRLKNKVSSTSKENE----ELRTT 177

Query: 259 TGRLEKVITQRTSTISNLKQDRHTLRKQLAKSTENNINLKGANNRLKQHVDNLLYLFNDC 318
              L K      S   NL++   +  +Q+ K     I L+ A    + H D L     + 
Sbjct: 178 VTTLNKEYDSMESEYENLQKQVTSYERQIEKC---EIKLEHAT---ESHSDELNAYIKEI 231

Query: 319 EN 320
           EN
Sbjct: 232 EN 233

>YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type II
            myosin heavy chain, required for wild-type cytokinesis
            and cell separation; localizes to the actomyosin ring;
            binds to myosin light chains Mlc1p and Mlc2p through its
            IQ1 and IQ2 motifs respectively
          Length = 1928

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%)

Query: 193  NVLMVENGKLINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFKLKDKIKDNNIETQTKI 252
            N+ M     L+ E + LR    N + EK  L  Q+  K+ +L K+K+KI ++  E  T  
Sbjct: 1057 NIAMSRLQSLVTENSDLRSKNENFKKEKAALNNQLKNKESELLKMKEKIDNHKKELATFS 1116

Query: 253  KQLQDTTGRLEKVITQRTST 272
            KQ  D      K+  +   T
Sbjct: 1117 KQRDDAVSEHGKITAELKET 1136

>CAGL0I10901g Chr9 (1075178..1077628) [2451 bp, 816 aa] {ON} similar
           to uniprot|Q08581 Saccharomyces cerevisiae YOR195w
           involved in control of spindle dynamics
          Length = 816

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 69/145 (47%), Gaps = 30/145 (20%)

Query: 205 ELTSLRQTIRNLRDEKENLKAQVYEKDIQLFKLKDK-------------------IKDNN 245
           E+T L   I +LR++ ENL++ + EKD  + KLK++                   +K+NN
Sbjct: 593 EVTELNYKIDDLREKVENLESSLQEKDDYINKLKEELQSKKDEHSKTLLELESVHLKNNN 652

Query: 246 IETQ--TKIKQLQDTTGRLEKVITQRT-------STISNLKQDRHTLRKQLAKSTENNIN 296
           IE +   +++ L ++   LE+ +  +T         IS L+ ++      ++K    +IN
Sbjct: 653 IEKEHLAELEGLHESLSHLEEELKSKTICVNDMKDEISKLEDEKKEYLSSVSKQNTTSIN 712

Query: 297 LKGANN--RLKQHVDNLLYLFNDCE 319
            +G  N   L++ +D L    N+ E
Sbjct: 713 TEGIMNLQNLQREIDQLRDKLNNSE 737

>Suva_4.363 Chr4 complement(638701..642879) [4179 bp, 1392 aa] {ON}
           YBR115C (REAL)
          Length = 1392

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 15  LLDLTFMKNKSVSEDPSFVEIAVNGILDQDTVVAQRKIKFNDCPMGPKLTKNEVPAIPKK 74
            LD+   K  SVS D SF ++  + IL    +   +K    D P+G   T  + P I   
Sbjct: 856 WLDILPTKPASVSPDDSFFDLGGHSILATKMIFTLKKKLQIDLPLG---TIFKYPTIRAF 912

Query: 75  SILVNRENTTDTPTEQE 91
           +  +NR  T+D  ++ E
Sbjct: 913 AAEINRIQTSDGSSQGE 929

>YDR259C Chr4 complement(974631..975782) [1152 bp, 383 aa] {ON}
           YAP6Basic leucine zipper (bZIP) transcription factor;
           physically interacts with the Tup1-Cyc8 complex and
           recruits Tup1p to its targets; overexpression increases
           sodium and lithium tolerance; computational analysis
           suggests a role in regulation of expression of genes
           involved in carbohydrate metabolism
          Length = 383

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 175 QHEAV-----VWKIEAEALGIKNNVLMVENGKLINELTSLRQTIRNLRDEKENLKAQVYE 229
           QHEA+     + + E + L  +NN+L  EN  + NE    R    NL+ E +   A+   
Sbjct: 283 QHEAIRNAITMLRSEYDVLCNENNMLKNENSIIKNEHNMSRNENENLKLENKRFHAEYIR 342

Query: 230 --KDIQLFKLKDKIKDNNIET-QTKIKQLQDTTGR 261
             +DI+  K K++ + + IE  + KI+ L++  GR
Sbjct: 343 MIEDIENTKRKEQEQRDEIEQLKKKIRSLEEIVGR 377

>KLLA0C13145g Chr3 (1119411..1121789) [2379 bp, 792 aa] {ON} similar
           to uniprot|Q08817 Saccharomyces cerevisiae YOR353C SOG2
           Protein required for cell viability
          Length = 792

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 304 LKQHVDNLLYLFNDCENPASENNPSQLPQQFEH 336
           LK H+DNL+ +    EN + +N+PS    QF H
Sbjct: 340 LKSHIDNLVEVLEQFENNSQQNDPSITQSQFLH 372

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1735

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 2/124 (1%)

Query: 202 LINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFK-LKDKIKDNNIETQTKIKQLQDTTG 260
           L N+   +R  + N + E + LK++ YE+ ++ F+ LK+         +T  K+L + + 
Sbjct: 151 LQNDNIDIRTQLNNFKSETKGLKSK-YERKVKDFEELKNAYSSMKTYEETSRKELSEMSN 209

Query: 261 RLEKVITQRTSTISNLKQDRHTLRKQLAKSTENNINLKGANNRLKQHVDNLLYLFNDCEN 320
           +   + T  ++ + N K   H+L KQ     E N   K  NN L   V + L+     EN
Sbjct: 210 KFYTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFKKKSLEN 269

Query: 321 PASE 324
             +E
Sbjct: 270 DLNE 273

>KLLA0F04455g Chr6 complement(428010..428927) [918 bp, 305 aa] {ON}
           similar to uniprot|P40471 Saccharomyces cerevisiae
           YIL124W AYR1 NADPH-dependent 1-acyl dihydroxyacetone
           phosphate reductase found in lipid particles and ER
           involved in phosphatidic acid biosynthesis and required
           for spore germination capable of metabolizing mammalian
           steroid hormones
          Length = 305

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 51/124 (41%), Gaps = 4/124 (3%)

Query: 71  IPKKSILVNRENTTDTPT--EQEIPNEEVLLLLRRCFNFCNLDTDGIEKRSIEENLESIS 128
           IP+K  + N+ + T      EQE+P++++ LL       C+L    + +  I+       
Sbjct: 53  IPRKLDVSNQNDITQLKLKLEQELPDQKLHLLYNNAGQSCSLPAIDVSEEIIDNTFRVNV 112

Query: 129 YGIISTFR-FHECCYKYAHELETTSKVKAECPIVPLVEGKSPADAELQHEAVVWKIEAEA 187
           YG I++ R F          +  T  +   CP  P     S + A +   A V   E   
Sbjct: 113 YGPINSCREFAPLIINAKGTIVFTGSLAGICPF-PFGAVYSASKAAIHQYARVLHGELGP 171

Query: 188 LGIK 191
           LG++
Sbjct: 172 LGVR 175

>Suva_10.562 Chr10 (979014..979430) [417 bp, 138 aa] {ON} YLR445W
           (REAL)
          Length = 138

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 64/136 (47%), Gaps = 15/136 (11%)

Query: 149 ETTSKVKAECPIVPLVEGKSPADAELQHEAVVWKIEAEALGIKNNVLMVENGKLINELTS 208
           + T+  K   P  P +  K P+  +L   A  W++      I+N+++  E  + INE+T 
Sbjct: 16  QDTASPKLTSPDNPSLNNKVPSLFKL---AAQWQLNNPQENIQNHIMENEVLQRINEITG 72

Query: 209 L-RQTIRNLRDEKENLKAQVYEK-DIQLFKLKDKIKDNNIETQTKIKQLQDTTGRLEKVI 266
           L R++ ++L  +   +  +  EK D  LF     +  N IE  T  K + D  G++E   
Sbjct: 73  LIRESYKDLSSQDGMMSKEPQEKLDWDLFC---TVPVNIIEQYT--KDMDDIFGKME--- 124

Query: 267 TQRTSTISNLKQDRHT 282
             R S +S  KQ  +T
Sbjct: 125 --RLSKVSITKQTNNT 138

>Kpol_193.3 s193 complement(3067..5871) [2805 bp, 934 aa] {ON}
           complement(3067..5871) [2805 nt, 935 aa]
          Length = 934

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 73/170 (42%), Gaps = 41/170 (24%)

Query: 181 WKIEAEALGIKNNVLMVENGKLINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFKLKDK 240
           W I ++ + +K N           E+ +L   I+ LR+  E+LK  + E+D  + +LK  
Sbjct: 368 WFIRSDDVTVKEN-----------EIDNLNIDIQQLRENIESLKLTIQERDNTIDQLK-- 414

Query: 241 IKDNNIETQTKIKQLQDTTGRLEKVITQRTSTISNLKQDRHTLRKQLAKSTENN------ 294
               NIE Q K++Q Q     L+K IT   + + N++  +H +    A+S E N      
Sbjct: 415 ----NIENQNKLEQDQ-----LQKQITFMRTEL-NVQAKKHEIELLEAQSQEVNNGVQQL 464

Query: 295 ------INLKGANNRLKQHVDNLLY------LFNDCENPASENNPSQLPQ 332
                   ++ +N    Q V  + Y      + ND E  AS   P   P+
Sbjct: 465 SMDMEKTPMRASNGSQVQKVQEMEYTSSGTPILNDLEEFASYGVPYGTPE 514

>Kwal_23.4424 s23 complement(713602..716448) [2847 bp, 948 aa] {ON}
           YKR095W (MLP1) - colied-coil protein (putative), similar
           to myosin and TPR [contig 1] FULL
          Length = 948

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 45/92 (48%), Gaps = 4/92 (4%)

Query: 188 LGIKNNVLMVENGKLINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFKLKDKIKDNNIE 247
           LG+K   L  ++    NELT +++ +  LR EKE    +    D Q  +   KI+D   E
Sbjct: 443 LGLKTEELTTKSTSFENELTIVKEQVVELRLEKEKAVLRCSMLDTQ-HEESRKIRDGLEE 501

Query: 248 TQTKIKQLQDTTGRLEKVITQRTSTISNLKQD 279
           T    K L+    RLE + T +  TI  L+++
Sbjct: 502 TN---KGLKSVISRLENITTDQLQTIKRLEEE 530

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,433,573
Number of extensions: 2004875
Number of successful extensions: 9602
Number of sequences better than 10.0: 745
Number of HSP's gapped: 9594
Number of HSP's successfully gapped: 1176
Length of query: 378
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 267
Effective length of database: 40,753,473
Effective search space: 10881177291
Effective search space used: 10881177291
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)