Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30486.45ON67067028460.0
ACL019C6.45ON5755339071e-113
SAKL0E01958g6.45ON5243935727e-65
KLTH0C10604g6.45ON5155425402e-60
KLLA0C05874g6.45ON5533885264e-58
TDEL0G042506.45ON5174194727e-51
ZYRO0C07194g6.45ON5584104615e-49
Kwal_56.225226.45ON5133904561e-48
Smik_15.1576.45ON5504074412e-46
Skud_15.1486.45ON5484034324e-45
KAFR0A052406.45ON5534114324e-45
YOL013C (HRD1)6.45ON5514204299e-45
TBLA0B005606.45ON4923864012e-41
NCAS0D020106.45ON5104054023e-41
Kpol_1035.506.45ON6015233941e-39
NDAI0C027706.45ON6304453842e-38
TPHA0F024806.45ON6054083594e-35
KNAG0E027406.45ON5564333503e-34
CAGL0E02299g6.45ON5453963486e-34
Suva_15.1596.45ON5501412696e-24
KLTH0D07216g2.545ON747671332e-07
SAKL0A09812g2.545ON751591299e-07
AFR275W2.545ON753661281e-06
Skud_11.1922.545ON758601262e-06
ZYRO0E05632g2.545ON765671262e-06
TPHA0C042602.545ON757761252e-06
Kwal_26.80992.545ON750661243e-06
KAFR0B014602.545ON761601225e-06
TDEL0B063402.545ON762671225e-06
YKL034W (TUL1)2.545ON758601225e-06
Suva_11.1892.545ON758601226e-06
CAGL0L01947g2.545ON757601226e-06
Smik_11.2132.545ON759601201e-05
Ecym_72412.545ON758591182e-05
TBLA0I014902.545ON750591172e-05
Kpol_1002.72.545ON754751136e-05
KNAG0A070902.545ON762591136e-05
KLLA0F25674g2.545ON757581129e-05
KLLA0E04071g8.317ON704421073e-04
Kpol_1052.193.279ON10359973e-04
SAKL0C01760gsingletonON1474631073e-04
SAKL0C03586gsingletonON1474631074e-04
NCAS0A047602.545ON761571065e-04
Skud_15.1028.808ON406811020.001
NDAI0A074503.279ON17382980.001
YOL054W (PSH1)8.808ON406811010.001
NDAI0G052001.389ON1586491020.002
NDAI0H008405.628ON341541000.002
KLTH0G12408g8.317ON603321000.002
KNAG0A074303.405ON10255910.002
NDAI0K018102.545ON762561000.003
Smik_15.1138.808ON40681980.003
Kpol_1048.731.389ON154955990.003
TPHA0A039903.279ON17566940.003
CAGL0B05049g1.389ON147054990.003
CAGL0H10274g3.279ON17552930.004
NCAS0A087801.389ON150255980.004
KLLA0F18458g3.279ON14054910.005
AER390W5.628ON31650950.006
Suva_4.3023.279ON15054910.006
TDEL0F02870na 1ON26081940.006
NCAS0A04680singletonON27467940.007
NCAS0A113503.405ON42858950.007
Skud_2.1863.279ON17854910.009
KLTH0D07150g2.542ON54087940.011
Smik_2.1963.279ON18558900.011
TPHA0I005608.808ON39463930.013
KLLA0F12166g1.389ON152877940.013
AGR034W3.279ON15931880.014
Suva_15.1158.808ON41181920.015
TDEL0F044408.317ON55452920.017
TPHA0A033403.405ON38464920.017
Ecym_13285.628ON32051910.017
KLTH0C05258g3.279ON15280880.017
Skud_4.5285.628ON33750910.021
Ecym_54453.405ON32155900.024
YBR062C3.279ON18054870.024
NDAI0E004408.808ON41657900.026
TBLA0G023102.542ON67454910.027
NCAS0B009908.808ON39261900.027
Suva_2.4335.628ON33750890.029
KLLA0E16677g5.628ON30550890.029
ABR104W3.405ON32852890.030
TBLA0A096405.628ON32550890.032
SAKL0D08272g1.389ON149150910.032
Ecym_26583.279ON15976860.033
Kwal_56.239008.317ON58933900.035
CAGL0K08052g3.405ON30556880.038
ZYRO0C11176g5.628ON36850890.039
NCAS0C033108.317ON57032890.040
SAKL0G07370g5.628ON32149880.040
Ecym_42508.317ON65726890.042
AAL030C1.389ON153993890.045
ZYRO0C17424g3.405ON27352870.048
KNAG0I013801.389ON149329890.049
KAFR0A019902.542ON56054880.051
KAFR0B030708.317ON64326880.052
CAGL0M08690g5.628ON32849870.055
TBLA0B026708.808ON47856880.058
Smik_4.5165.628ON33749870.062
CAGL0K02563g2.542ON58666870.066
Kwal_26.80902.542ON52073870.066
YDR265W (PEX10)5.628ON33725860.068
Kpol_526.345.628ON328135860.077
KAFR0H005605.628ON32763860.079
YLR247C (IRC20)1.389ON155675870.085
Skud_12.3281.389ON155751870.085
ZYRO0E05192g1.389ON152050870.087
TDEL0A049405.628ON32651850.087
CAGL0E01441g8.317ON71726860.090
Kwal_14.12871.389ON151851870.097
ZYRO0B02244g2.542ON56373860.097
NDAI0G026308.317ON66139860.10
KNAG0C056602.542ON507103860.10
KLTH0G18150g1.389ON155467860.12
Suva_2.3048.317ON62426850.12
Kwal_27.105463.279ON10427780.13
Kwal_55.21206singletonON27551830.15
KNAG0J008503.279ON16259810.16
Skud_4.4028.317ON61226840.16
Smik_4.3878.317ON63426840.17
ZYRO0D05830g8.317ON78027840.18
TDEL0E028705.339ON28847820.19
Suva_10.3441.389ON156051840.20
TDEL0A031802.542ON56751830.20
TBLA0A039008.317ON69852830.21
Suva_8.422.542ON58550830.22
YDR143C (SAN1)8.317ON61026830.22
TPHA0C008508.317ON78146830.22
NDAI0B018202.542ON62551830.22
TDEL0D034603.279ON14427780.24
KLTH0E02464g5.628ON32925820.25
Skud_8.352.542ON58550820.27
YHL010C (ETP1)2.542ON58550820.27
Smik_8.322.542ON58550820.27
TPHA0B036501.389ON157650830.28
Kpol_480.228.808ON42587820.28
Smik_12.3201.389ON155351830.30
Kpol_1036.668.317ON66826820.31
TPHA0C042502.542ON55668820.31
KNAG0G023908.317ON68826820.34
Kpol_1002.82.542ON55868810.34
SAKL0H15686g8.317ON59932810.34
SAKL0H17116gsingletonON54431810.34
Skud_4.5765.339ON29364800.35
Kwal_55.199995.628ON15225780.35
Kwal_26.8030na 2ON66054810.36
KAFR0I020901.389ON146649820.38
TDEL0B061701.389ON147050810.39
NCAS0A125502.542ON57251810.42
KLTH0F11044g3.405ON29153790.43
KNAG0A012303.22ON132126810.46
KAFR0B046002.157ON40853800.50
KLTH0D06886gna 2ON66454800.50
KLLA0F25740g2.542ON51749800.51
KLLA0C08756g6.332ON42755800.52
TBLA0I019603.279ON18431770.56
Kwal_14.18686.100ON135757800.60
SAKL0D03058g3.279ON15527760.61
SAKL0A09526gna 2ON66253790.64
TPHA0C003505.628ON27825780.72
Kpol_538.53.405ON33554780.73
SAKL0A09746g2.542ON54851780.75
TBLA0F032803.405ON55551780.77
NCAS0C052905.628ON33025770.87
KLLA0E06469g7.440ON96561781.0
Smik_12.4074.139ON25963761.1
TDEL0A03090na 2ON58654771.1
KNAG0J015605.628ON30956761.2
YOL138C (RTC1)3.22ON134126771.3
ZYRO0E06996g3.279ON17234741.3
KNAG0A012803.28ON11459711.4
KAFR0F028406.332ON44557761.4
KAFR0H007103.405ON22853751.4
TBLA0B012602.157ON88569761.4
NDAI0I004006.332ON48150761.5
Suva_15.223.22ON133626761.6
KLLA0C15697g3.405ON30451751.7
SAKL0B08976g3.405ON32253742.0
KLLA0E18503gna 2ON65053752.0
Kwal_55.220543.28ON11159702.1
Suva_2.4815.339ON28764742.1
SAKL0C13178g3.28ON13859712.2
TPHA0A028501.190ON84153752.4
CAGL0L06336g8.247ON60050742.5
KLLA0E20967g3.22ON132192752.5
NDAI0D02810na 1ON25260732.5
Kpol_339.65.339ON30938732.7
KAFR0C004603.279ON15724712.9
NCAS0A082803.279ON11824693.1
CAGL0I09988g8.808ON38788733.2
KLTH0F18502gsingletonON26751723.2
KNAG0H035102.157ON551106733.3
SAKL0A01474g6.332ON46850733.5
ZYRO0B02046gna 2ON44553723.8
Kwal_27.105917.440ON98142734.0
CAGL0L03960g2.157ON60368724.1
KAFR0D046405.339ON30243714.7
NCAS0F027705.339ON27743705.5
NDAI0E046007.440ON103458715.7
SAKL0G09284g5.339ON29641705.8
NDAI0G038103.22ON139392725.8
YPR093C (ASR1)3.405ON28851706.2
NCAS0G025202.157ON51852716.3
TPHA0E011805.339ON32341706.7
CAGL0J03586g6.332ON41144708.1
KLLA0E17711g3.190ON16256679.2
YLR323C (CWC24)4.139ON25983689.4
KLLA0C14542g5.339ON32641699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3048
         (670 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...  1100   0.0  
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...   353   e-113
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...   224   7e-65
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...   212   2e-60
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...   207   4e-58
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...   186   7e-51
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...   182   5e-49
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...   180   1e-48
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...   174   2e-46
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...   171   4e-45
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...   171   4e-45
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...   169   9e-45
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...   159   2e-41
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...   159   3e-41
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...   156   1e-39
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...   152   2e-38
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...   142   4e-35
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...   139   3e-34
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...   138   6e-34
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...   108   6e-24
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    56   2e-07
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    54   9e-07
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    54   1e-06
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    53   2e-06
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    53   2e-06
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    53   2e-06
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    52   3e-06
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    52   5e-06
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    52   5e-06
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    52   5e-06
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    52   6e-06
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    52   6e-06
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    51   1e-05
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    50   2e-05
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    50   2e-05
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    48   6e-05
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    48   6e-05
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    48   9e-05
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    46   3e-04
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    42   3e-04
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    46   3e-04
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    46   4e-04
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    45   5e-04
Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054...    44   0.001
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    42   0.001
YOL054W Chr15 (228614..229834) [1221 bp, 406 aa] {ON}  PSH1E3 ub...    44   0.001
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    44   0.002
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    43   0.002
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    43   0.002
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    40   0.002
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    43   0.003
Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054...    42   0.003
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    43   0.003
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    41   0.003
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    43   0.003
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    40   0.004
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    42   0.004
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    40   0.005
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    41   0.006
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    40   0.006
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      41   0.006
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      41   0.007
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    41   0.007
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    40   0.009
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    41   0.011
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    39   0.011
TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.8...    40   0.013
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    41   0.013
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    39   0.014
Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054...    40   0.015
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    40   0.017
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    40   0.017
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    40   0.017
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    39   0.017
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    40   0.021
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    39   0.024
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    38   0.024
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    39   0.026
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    40   0.027
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    39   0.027
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    39   0.029
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    39   0.029
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    39   0.030
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    39   0.032
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    40   0.032
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    38   0.033
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    39   0.035
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    39   0.038
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    39   0.039
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     39   0.040
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    39   0.040
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    39   0.042
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    39   0.045
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    38   0.048
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    39   0.049
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    39   0.051
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    39   0.052
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    38   0.055
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    39   0.058
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    38   0.062
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    38   0.066
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    38   0.066
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    38   0.068
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    38   0.077
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    38   0.079
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    38   0.085
Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] ...    38   0.085
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    38   0.087
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    37   0.087
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    38   0.090
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    38   0.097
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    38   0.097
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     38   0.10 
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    38   0.10 
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    38   0.12 
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    37   0.12 
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    35   0.13 
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    37   0.15 
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    36   0.16 
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    37   0.16 
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    37   0.17 
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    37   0.18 
TDEL0E02870 Chr5 (548115..548981) [867 bp, 288 aa] {ON} Anc_5.33...    36   0.19 
Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] ...    37   0.20 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    37   0.20 
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    37   0.21 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    37   0.22 
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    37   0.22 
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    37   0.22 
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     37   0.22 
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    35   0.24 
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    36   0.25 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    36   0.27 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    36   0.27 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    36   0.27 
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    37   0.28 
Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON} (52842..5...    36   0.28 
Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] ...    37   0.30 
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    36   0.31 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    36   0.31 
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    36   0.34 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    36   0.34 
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    36   0.34 
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    36   0.34 
Skud_4.576 Chr4 complement(1031529..1032410) [882 bp, 293 aa] {O...    35   0.35 
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    35   0.35 
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    36   0.36 
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    36   0.38 
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    36   0.39 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    36   0.42 
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    35   0.43 
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    36   0.46 
KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {O...    35   0.50 
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    35   0.50 
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    35   0.51 
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    35   0.52 
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    34   0.56 
Kwal_14.1868 s14 complement(501965..506038) [4074 bp, 1357 aa] {...    35   0.60 
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    34   0.61 
SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conser...    35   0.64 
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    35   0.72 
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    35   0.73 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    35   0.75 
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    35   0.77 
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    34   0.87 
KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {...    35   1.0  
Smik_12.407 Chr12 complement(716407..717186) [780 bp, 259 aa] {O...    34   1.1  
TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON}               34   1.1  
KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.6...    34   1.2  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    34   1.3  
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    33   1.3  
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    32   1.4  
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    34   1.4  
KAFR0H00710 Chr8 (132097..132783) [687 bp, 228 aa] {ON} Anc_3.40...    33   1.4  
TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.1...    34   1.4  
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    34   1.5  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    34   1.6  
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    33   1.7  
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    33   2.0  
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    33   2.0  
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    32   2.1  
Suva_2.481 Chr2 complement(853097..853960) [864 bp, 287 aa] {ON}...    33   2.1  
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    32   2.2  
TPHA0A02850 Chr1 complement(616183..618708) [2526 bp, 841 aa] {O...    33   2.4  
CAGL0L06336g Chr12 (715056..716858) [1803 bp, 600 aa] {ON} some ...    33   2.5  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    33   2.5  
NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON}      33   2.5  
Kpol_339.6 s339 complement(10896..11825) [930 bp, 309 aa] {ON} c...    33   2.7  
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    32   2.9  
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    31   3.1  
CAGL0I09988g Chr9 complement(951638..952801) [1164 bp, 387 aa] {...    33   3.2  
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    32   3.2  
KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {O...    33   3.3  
SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {...    33   3.5  
ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conser...    32   3.8  
Kwal_27.10591 s27 complement(407375..410320) [2946 bp, 981 aa] {...    33   4.0  
CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa] ...    32   4.1  
KAFR0D04640 Chr4 complement(911653..912561) [909 bp, 302 aa] {ON...    32   4.7  
NCAS0F02770 Chr6 (558470..559303) [834 bp, 277 aa] {ON} Anc_5.33...    32   5.5  
NDAI0E04600 Chr5 (1039124..1042228) [3105 bp, 1034 aa] {ON} Anc_...    32   5.7  
SAKL0G09284g Chr7 (795241..796131) [891 bp, 296 aa] {ON} similar...    32   5.8  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    32   5.8  
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    32   6.2  
NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.1...    32   6.3  
TPHA0E01180 Chr5 (240374..241345) [972 bp, 323 aa] {ON} Anc_5.33...    32   6.7  
CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa] ...    32   8.1  
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...    30   9.2  
YLR323C Chr12 complement(778173..778952) [780 bp, 259 aa] {ON}  ...    31   9.4  
KLLA0C14542g Chr3 (1272215..1273195) [981 bp, 326 aa] {ON} simil...    31   9.7  

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score = 1100 bits (2846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/670 (83%), Positives = 559/670 (83%)

Query: 1   MPREVSWSIRLQFIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYF 60
           MPREVSWSIRLQFIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYF
Sbjct: 1   MPREVSWSIRLQFIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYF 60

Query: 61  IGGWLVVRMLFGRLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFHVLCQV 120
           IGGWLVVRMLFGRLTLLEYEHIFERLHLT        ITMDRKNSKIGVIAIPFHVLCQV
Sbjct: 61  IGGWLVVRMLFGRLTLLEYEHIFERLHLTVLSSLSVLITMDRKNSKIGVIAIPFHVLCQV 120

Query: 121 LHWVVRDRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYL 180
           LHWVVRDRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYL
Sbjct: 121 LHWVVRDRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYL 180

Query: 181 YYLLFSDNGQNTSEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKAGRRVQEHQXXX 240
           YYLLFSDNGQNTSEDRLSLSLGVDFG            NCLKFVELFKAGRRVQEHQ   
Sbjct: 181 YYLLFSDNGQNTSEDRLSLSLGVDFGLLFLDWLQVVLLNCLKFVELFKAGRRVQEHQLLD 240

Query: 241 XXXXXXXXXXXGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSI 300
                      GAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSI
Sbjct: 241 NNELENDIEDDGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSI 300

Query: 301 ETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNKKAKM 360
           ETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNKKAKM
Sbjct: 301 ETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNKKAKM 360

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANSNGIVPTQSEXXXXXXXX 420
           LPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANSNGIVPTQSE        
Sbjct: 361 LPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANSNGIVPTQSEQQQQLQQQ 420

Query: 421 XXXXXXXXXXXXXXXXXXRRSSWHSENEIPHDPAHPVRNSEQSGFSATNNNDGDDPNNQL 480
                             RRSSWHSENEIPHDPAHPVRNSEQSGFSATNNNDGDDPNNQL
Sbjct: 421 QQQQQQQQQQQQQQQQQQRRSSWHSENEIPHDPAHPVRNSEQSGFSATNNNDGDDPNNQL 480

Query: 481 RPVNNSNQQKNEPSWISFPTQYQANGKLYFKLQEFQSDKEWEAVFTSRPNPIINKQQVQM 540
           RPVNNSNQQKNEPSWISFPTQYQANGKLYFKLQEFQSDKEWEAVFTSRPNPIINKQQVQM
Sbjct: 481 RPVNNSNQQKNEPSWISFPTQYQANGKLYFKLQEFQSDKEWEAVFTSRPNPIINKQQVQM 540

Query: 541 QSDAQPYLGXXXXXXXXXXXXXXXXXXXAEQGKEEKHEKXXXXXXXXXXXXXXXXXXXXX 600
           QSDAQPYLG                   AEQGKEEKHEK                     
Sbjct: 541 QSDAQPYLGLQDHRQRQQLQQQESQEHSAEQGKEEKHEKQQQVQQQQVQQQQVQQQQVQQ 600

Query: 601 XXXXXXXXXXXGLRFFNSFRNGLDTRHTIDSLPVIPTSRLEQTEELERLKRRISELENTV 660
                      GLRFFNSFRNGLDTRHTIDSLPVIPTSRLEQTEELERLKRRISELENTV
Sbjct: 601 QQVQQQQVQQQGLRFFNSFRNGLDTRHTIDSLPVIPTSRLEQTEELERLKRRISELENTV 660

Query: 661 GDLLKRIKTD 670
           GDLLKRIKTD
Sbjct: 661 GDLLKRIKTD 670

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score =  353 bits (907), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/533 (36%), Positives = 282/533 (52%), Gaps = 52/533 (9%)

Query: 1   MPREVSWSIRLQFIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYF 60
           MPREVSW +   FI  TYALA WS Y+C ++    L A++ A+ GVH +IWGNFL+VHY 
Sbjct: 1   MPREVSWPMWAMFITATYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYC 60

Query: 61  IGGWLVVRMLFGRLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFHVLCQV 120
           +  W ++R+LFG+LT +EY+HIFERLH+         ITM RK    G + I F+ LC V
Sbjct: 61  LFVWAIIRVLFGQLTAIEYDHIFERLHVVLVTLASIVITM-RKTYMAGHMTILFYTLCLV 119

Query: 121 LHWVVRDRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYL 180
            HWV+RDRM+FVF    GT  ++  +L SRFM S++VLG+VD+K++ +            
Sbjct: 120 AHWVLRDRMDFVFQVH-GTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCV---------- 168

Query: 181 YYLLFSDNGQNTSED----RLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKAGRRVQEH 236
                    QNT+ D     L L L + F               L   E+ ++ RR +  
Sbjct: 169 ---------QNTNVDGKRHELYLMLALSFAQLILDVLHVVLLTSLNLFEMVRS-RRTRSA 218

Query: 237 QXXXXXXXXXXXXXXGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIF 296
                            FILE K+IYE + +  + +LK++L+I        S  V Y+IF
Sbjct: 219 NLVYEGGTTDDDADDEVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIF 278

Query: 297 IKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNK 356
           ++SI+  E  +L++NYWKNN++L+EKL DV+   LD  D  C ICMDDMLP+ +    N+
Sbjct: 279 VRSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNR 338

Query: 357 KAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANSNGIVPTQSEXXXX 416
           +AKMLPCGHMLHFGCLKSWM+R+QTCPICR  VF +         +SN    TQ+     
Sbjct: 339 RAKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFAN---------DSNSHATTQAR---- 385

Query: 417 XXXXXXXXXXXXXXXXXXXXXXRRSSWHSENEIPHDPAHPVRNSEQSGFSATNNNDGDDP 476
                                  R      + I          S   G +      G+  
Sbjct: 386 -------------EQTPPDLLQERGIDEHIDVIGMQDMSVQSISLHEGTAVRRGTTGNCM 432

Query: 477 NNQLRPVNNSNQQKNEPSWISFPTQYQANGKLYFKLQEFQSDKEWEAVFTSRP 529
           N        S++++++  W++FP +++A+ K++F L + Q D++W A +TS P
Sbjct: 433 NQAYDGGLLSHEERDQAGWVAFPIEFRADNKVFFNLNDSQGDRQWMASYTSYP 485

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 31/37 (83%)

Query: 634 VIPTSRLEQTEELERLKRRISELENTVGDLLKRIKTD 670
           VI TS+LEQT+E+E LKR++ ELE+ V +L KRIKTD
Sbjct: 537 VIATSKLEQTKEVEHLKRKVEELESRVEELSKRIKTD 573

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score =  224 bits (572), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 140/393 (35%), Positives = 206/393 (52%), Gaps = 32/393 (8%)

Query: 1   MPREVSWSIRLQFIA---VTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLV 57
           MP  VS + R QFI     TY+ A WS+Y+  S+S++FLQ   K   GV+LII GNF L+
Sbjct: 1   MP--VSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLL 58

Query: 58  HYFIGGWLVVRMLFGRLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFHVL 117
           +  +   L+ R+LFG L L+EYEH+FERL  T             ++    ++     + 
Sbjct: 59  NGVLLWKLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIF 118

Query: 118 CQVLHWVVRDRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQ 177
            +V HW+++DR+EFVF         +K +LFSRF  +++ L  VD++++ Y      +  
Sbjct: 119 LKVFHWILKDRLEFVFQNA-NENTNLKKMLFSRFNFNLLFLASVDYQMVRYCLSNSIS-- 175

Query: 178 GYLYYLLFSDNGQNTSEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKAGRRVQEHQ 237
                     N Q TS   + L  G+DF               + FVE++    R+Q H 
Sbjct: 176 ----------NDQWTSSS-VYLMFGIDFAMLLVDTLSIGLHGVVNFVEVY----RLQSHN 220

Query: 238 XXXXXXXXXXXXXXGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFI 297
                             LE KF+YEK+++    +LK+LL+I L+       ++  +I  
Sbjct: 221 SHYDEEFLG---------LEGKFMYEKLIDMGARLLKMLLHIALLIPFRMPIMIIKDIIW 271

Query: 298 KSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNKK 357
            +I   +    L+  WKN ++L EKL DVT   L+  +  C +CMDDMLP+ + +  N K
Sbjct: 272 DAISLYQTATSLWKTWKNAKKLDEKLPDVTEEELNQGNNMCIVCMDDMLPNSETRNANLK 331

Query: 358 AKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
            K LPCGH+LH  CLKSWM+R+QTCPICR PVF
Sbjct: 332 PKKLPCGHILHLSCLKSWMERSQTCPICRLPVF 364

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 28/36 (77%)

Query: 635 IPTSRLEQTEELERLKRRISELENTVGDLLKRIKTD 670
           IP S +EQ EE+E LKR+ISE+EN +  L KR++T+
Sbjct: 489 IPQSCIEQKEEIESLKRKISEMENKLDALTKRVRTE 524

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score =  212 bits (540), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 153/542 (28%), Positives = 233/542 (42%), Gaps = 87/542 (16%)

Query: 10  RLQFIA---VTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLV 66
           R QF+     TY  AAWS+ +C   SLSFL A  K   G++L++  NF +V+  +    +
Sbjct: 7   RRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKGL 66

Query: 67  VRMLFGRLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFHVLCQVLHWVVR 126
            R+LFG L LLEYEHIFERL  T                   +I        +V HWV++
Sbjct: 67  TRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVLK 126

Query: 127 DRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYR-----QHQAEQGYLY 181
           DR+E+VF      R  +  LL SRF L++++  VVD++++ +  R     +H        
Sbjct: 127 DRLEYVFQH-TDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185

Query: 182 YLLFSDNGQNTSEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKAGRRVQEHQXXXX 241
           Y+LF                 VDF             + +  +EL +  R  +       
Sbjct: 186 YILFC----------------VDFSMLLVDVAEVAMKSVINLIELIQCKRAFERD----- 224

Query: 242 XXXXXXXXXXGAFI-LEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSI 300
                       F+ L+ KF+YEK+V+ V ++LK+ L +  +       ++  +I    I
Sbjct: 225 ---------GDDFVGLDGKFMYEKLVQLVCQVLKLGLRVASLAPFSMPLMIAKDIIWDGI 275

Query: 301 ETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGV-DITCTICMDDMLPSKDVKVNNKKAK 359
                   ++  WK+NR++ EKL DVT   L+   D  C +CM+DMLP  +      K K
Sbjct: 276 ALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPK 335

Query: 360 MLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANSNGIVPTQSEXXXXXXX 419
            LPC H LH GCLKSWM+R+QTCPICR  VF S    A  N N+                
Sbjct: 336 KLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNA---------------- 379

Query: 420 XXXXXXXXXXXXXXXXXXXRRSSWHSENEIPHDPAHPVRNSEQSGFSATNNNDGDDPNNQ 479
                               +     +  +   P      S  +  ++T+          
Sbjct: 380 -------------------AQQPISEDASVAQQPLSAANESNSTSLASTH-------TGS 413

Query: 480 LRPVNNSNQQKNEPSWISFPTQYQAN-GKLYFKLQEFQS-DKEWEAVFTSRPNPIINKQQ 537
           L  V++SN   N P+W +FP     N G + FK+++    +   + +   RP   + K+Q
Sbjct: 414 LGAVSSSN--PNFPTWYTFPVTLSDNDGAVDFKVRDINGVEINAKLIIKKRPGFDVPKEQ 471

Query: 538 VQ 539
            Q
Sbjct: 472 DQ 473

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 24/29 (82%)

Query: 642 QTEELERLKRRISELENTVGDLLKRIKTD 670
           Q +++ERLKRRISELEN V +L K+ +T+
Sbjct: 487 QYQDIERLKRRISELENKVDELTKKARTE 515

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score =  207 bits (526), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 127/388 (32%), Positives = 200/388 (51%), Gaps = 16/388 (4%)

Query: 12  QFIA---VTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVR 68
           +FIA   ++Y  AAWSL+ C +TS S+L AM K T G+H +IWGN  L++  +    V+ 
Sbjct: 25  KFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVIH 84

Query: 69  MLFGRLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFHVLCQVLHWVVRDR 128
           MLFG+L L+EYEHI ER+  T         +M+   S + +  + F V C+ LHW+++DR
Sbjct: 85  MLFGQLRLIEYEHILERISYTVITLLLSCSSMNGLISVMQIHCVLF-VCCRTLHWILKDR 143

Query: 129 MEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQ--HQAEQGYLYYLLFS 186
           ME  F      R+ +KD+L SRFM +++VL  VD  ++ Y+  +  +++     Y L   
Sbjct: 144 MEVTFQAN-DMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKILYKSNIDVTYTLFII 202

Query: 187 DNGQNTSEDRLSLSL--GVD-FGXXXXXXXXXXXXNCLKFVELFKAGRRVQEHQXXXXXX 243
                   D L + L  G++ F             N    V+        + +       
Sbjct: 203 SQYAILGTDLLQVILRTGLNLFELSTIQNRARIRRNADHHVDEPVINHEERPNAVAIEED 262

Query: 244 XXXXXXXXGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETC 303
                   G   LE KFIYEK+++  +  +K+++     +S     V+   +  ++I T 
Sbjct: 263 EDEDEENAG---LEGKFIYEKLIDVFISTVKVIIK--FASSFSTGRVMMVTVLWEAITTF 317

Query: 304 ERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDI-TCTICMDDMLPSKDVKVNNKKAKMLP 362
           +    L+  WK+++ L   L+D T   ++  +I  C +CM+D LPS   K + KK K+LP
Sbjct: 318 KSARGLWKNWKSSKSLDASLMDATDIQIESGEIDICIVCMEDFLPSHQRKSDGKKVKILP 377

Query: 363 CGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           C H LH  CLK+W+ R+ TCPICR P+F
Sbjct: 378 CTHALHLSCLKNWIARSPTCPICRLPIF 405

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score =  186 bits (472), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 125/419 (29%), Positives = 200/419 (47%), Gaps = 42/419 (10%)

Query: 5   VSWSIRLQFIAVT---YALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFI 61
           +S + + QFI  +   YAL  +S+YN T TS+SFLQ + + T G +++I   F  ++  +
Sbjct: 3   ISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVL 62

Query: 62  GGWLVVRMLFGRLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFHVLCQVL 121
              L   +LFG L L+EYEHIFERL  T              +     I     +  +V 
Sbjct: 63  LWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVF 122

Query: 122 HWVVRDRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLY 181
           HW++RDR+E +    I     + DL+F+RF  ++V+L + D++++      H        
Sbjct: 123 HWILRDRLEALLQ-TIQESTTLSDLIFTRFTFNLVLLAIADYQII-----SHCVSNSL-- 174

Query: 182 YLLFSDNGQNTSEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKA---GRR--VQEH 236
                DN    S   + L +G++F               L F E +++   GRR  V + 
Sbjct: 175 -----DNSFGASAS-VHLMMGMEFALLLIDLLNTTLHAALCFYEFYQSQTHGRRNAVNDD 228

Query: 237 QXXXXXXXXXXXXXXGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIF 296
           +                  LE KFIYE++++     LK +L+  L+       ++  ++ 
Sbjct: 229 EDDTQFSG-----------LEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVL 277

Query: 297 IKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPSKD---VKV 353
              +   +    L+  W+NN++L +KL  ++   L  +D  C ICMD+++P +D    + 
Sbjct: 278 WDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELIPEQDEGHTRN 337

Query: 354 NNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANSNGIVPTQSE 412
              K K LPCGH+LH  CLK+WM+R+QTCPICR  VF       G    S   VPT +E
Sbjct: 338 TKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFD----EMGNVVQST--VPTTAE 390

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 26/37 (70%)

Query: 634 VIPTSRLEQTEELERLKRRISELENTVGDLLKRIKTD 670
           +IP   ++Q + +E LKRR+SELE+ V  L KR++ D
Sbjct: 481 IIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVRKD 517

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score =  182 bits (461), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 118/410 (28%), Positives = 195/410 (47%), Gaps = 32/410 (7%)

Query: 13  FIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFG 72
           F    YAL  +++YN   TS+SFLQA  K T G +++I   F +++  +   L   +LFG
Sbjct: 14  FALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWKLSTAILFG 73

Query: 73  RLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRMEFV 132
            L+LLEYEHIFERL  T             ++     +     +  +V HW+++DR+E +
Sbjct: 74  NLSLLEYEHIFERLPFTIINTVFMSSMFHEQDFFTVTLFGLLLLYMKVFHWILKDRLEAL 133

Query: 133 FAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNGQNT 192
               I     +K L+ +RF  ++V+L ++D+K++           G +   L +  G +T
Sbjct: 134 LQS-IHESTTLKSLICTRFSFNLVLLAILDYKIV----------SGCITNSLSNSFGAST 182

Query: 193 SEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKAG-----RRVQEHQXXXXXXXXXX 247
           S   + L +G++F               L F E ++         V              
Sbjct: 183 S---VHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLSSVDTDTDGGDEENEDE 239

Query: 248 XXXXGAFI-LEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCERC 306
                +F  LE KF+YE++++     LK L++  ++     S ++  ++F   +  C+  
Sbjct: 240 DVNGSSFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIV 299

Query: 307 VLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPS-----------KDVKVNN 355
             L+  W+NN++L +KL  ++   L   D  C +CMD++              K  K   
Sbjct: 300 SSLWRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDELCADLEEVVQGPDREKVAKTGK 359

Query: 356 KKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFG-SSNPRAGQNANSN 404
            K K LPCGH+LH  CLK+WM+R+QTCPICR PVF  + N    Q++ +N
Sbjct: 360 YKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVVQSQSSTTN 409

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 123/390 (31%), Positives = 183/390 (46%), Gaps = 33/390 (8%)

Query: 32  SLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFGRLTLLEYEHIFERLHLTXX 91
           SLSFL+   +   G++LI+  NF  V+  +    +  +LFG L LLEYEHIFERL  T  
Sbjct: 32  SLSFLELSARLCEGLNLILLCNFAAVNGVLLWKALTHLLFGELRLLEYEHIFERLSFTIV 91

Query: 92  XXXXXXITMDRKNSKIGVIAIPFH-VLCQVLHWVVRDRMEFVFAPPIGTRMAMKDLLFSR 150
                      ++  + V+A     +  +V HWV+RDR+E VF            LL SR
Sbjct: 92  NCFFMSSAFS-ESEFMSVMAFSAALIFVKVFHWVLRDRLEHVFQHT-DEHTNFARLLLSR 149

Query: 151 FMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNGQNTSEDRLSLSLGVDFGXXXX 210
           F  +I +LG +DF++  +        QG  +   FS +G  +S   + L   V+F     
Sbjct: 150 FFFNIFLLGFLDFQMTKFCI------QGTRF---FSRSGFYSSSLSVHLMFAVEFAMLLV 200

Query: 211 XXXXXXXXNCLKFVELFKAGRRVQEHQXXXXXXXXXXXXXXGAFILEEKFIYEKIVETVL 270
                   + +  VE+++  R                        LE KF+YEK+V+ + 
Sbjct: 201 DVTEVAMKSIINLVEVYQCKRSFARDGEDYTG-------------LEGKFMYEKVVQLIC 247

Query: 271 EILKILLNIFLITSGIHSFVVFYNIFIKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGH 330
           ++ ++ L+I L+       ++  +I   +         L   WK+NR++ EKL DV+   
Sbjct: 248 QLTRMGLHIMLMMPFSMPLMIAKDILWDAFAVFHTAKSLLLTWKSNRQIDEKLPDVSEAQ 307

Query: 331 LDGVD-ITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           L   D   C +CMDDML   +     +K K LPC H LH GCLKSWM+R+QTCPICR PV
Sbjct: 308 LAASDDKMCIVCMDDMLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMERSQTCPICRVPV 367

Query: 390 FG-------SSNPRAGQNANSNGIVPTQSE 412
           F        +S+    Q   S+ +  T  E
Sbjct: 368 FDKKGNVVVTSDQTNNQPGTSSAVESTADE 397

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 27/37 (72%)

Query: 634 VIPTSRLEQTEELERLKRRISELENTVGDLLKRIKTD 670
           V+    + Q +++ERLKRRISELEN V +L K+ +T+
Sbjct: 477 VVKNDCVYQNQDIERLKRRISELENKVDELSKKARTE 513

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  174 bits (441), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 121/407 (29%), Positives = 194/407 (47%), Gaps = 45/407 (11%)

Query: 13  FIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFG 72
           FI +TY L  + +Y+ T TS+SFLQ   K   G +L++   F+L++  +   L+ R+LFG
Sbjct: 13  FIVITYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFVLLNSTLLWHLLTRLLFG 72

Query: 73  RLTLLEYEHIFERLHLTXXXXX-XXXITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRMEF 131
            L L+E+EHIFERL  T         +  +R    +    +    L +V HW+++DR+E 
Sbjct: 73  ELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYL-KVFHWILKDRLE- 130

Query: 132 VFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNGQN 191
                I     MK L+FSRF L++V+L  +D++++++               ++++   +
Sbjct: 131 ALLQSINDSTTMKTLIFSRFSLNLVLLAALDYQIIVHCISS-----------IYTNQKID 179

Query: 192 TSEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKA------------------GRRV 233
                L L   ++F              CL F E +++                  G RV
Sbjct: 180 IVSTSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSDDGNHIVHDDLSDGNRV 239

Query: 234 Q----EHQXXXXXXXXXXXXXXGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSF 289
                +H               G   LE KF+YEK ++     LK  L++ ++       
Sbjct: 240 DFDGSQHALNDDGDDDDDRQFTG---LEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPM 296

Query: 290 VVFYNIFIKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGV---DITCTICMDDML 346
           ++  ++    +   +    L+  W+NN++L + LL VT   L      D  C ICMD+++
Sbjct: 297 MLLKDVIWDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQNSANEDNICIICMDELI 356

Query: 347 PSKDV---KVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
            S +    K  NKK K LPCGH+LH  CLK+WM+R+QTCPICR PVF
Sbjct: 357 HSTNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVF 403

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score =  171 bits (432), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 119/403 (29%), Positives = 191/403 (47%), Gaps = 41/403 (10%)

Query: 13  FIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFG 72
           FI VTY L  + +Y+ T TS+SFLQ   K   G +L++   F+L++  +   L+ ++LFG
Sbjct: 13  FIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLWQLLTKLLFG 72

Query: 73  RLTLLEYEHIFERLHLTXXXXX-XXXITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRMEF 131
            L L+E+EHIFERL  T         +  +R    +    +    L +V HW+++DR+E 
Sbjct: 73  ELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYL-KVFHWILKDRLE- 130

Query: 132 VFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNGQN 191
                I     MK+L+ SRF  ++V+L VVDF++++                ++++   +
Sbjct: 131 ALLQSINDSTTMKNLILSRFSFNLVLLAVVDFQILIRCISS-----------IYTNQNID 179

Query: 192 TSEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKA------------------GRRV 233
                L L   ++F              CL F E +++                  G   
Sbjct: 180 IISTSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSNESNHIVHDDTPNGVGF 239

Query: 234 QEHQXXXXXXXXXXXXXXGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFY 293
           +E                G   LE KF+YEK ++     LK  L++ ++       ++  
Sbjct: 240 EEAHAVLNDDDDDDRQFTG---LEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPLMLLK 296

Query: 294 NIFIKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGV---DITCTICMDDMLPSK- 349
           ++    +   +    L+  W+NN++L + L+ VTA  L      D  C ICMD+++ S+ 
Sbjct: 297 DVVWDVLALYQSGTSLWKIWRNNKQLDDALITVTAEQLQNSANEDNICIICMDELMHSQA 356

Query: 350 --DVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
               K  NKK K LPCGH+LH  CLK+WM+R+QTCPICR  VF
Sbjct: 357 DQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLSVF 399

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score =  171 bits (432), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 121/411 (29%), Positives = 196/411 (47%), Gaps = 42/411 (10%)

Query: 31  TSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFGRLTLLEYEHIFERLHLTX 90
           +S +FLQ   K T G++++I   F  ++ F+    +  +LFG L L+E+EHIFERL  T 
Sbjct: 31  SSKTFLQCTIKLTQGINVLILAIFTALNLFLLWEFLRWILFGELRLIEHEHIFERLPFTI 90

Query: 91  XXXX-XXXITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRMEFVFAPPIGTRMAMKDLLFS 149
                   I  + +     V A+   VL +V HW+++DR+E +    I     +K+L+FS
Sbjct: 91  INVLFMISIFNEYQFFNALVFALILSVL-KVFHWILKDRLESLLQS-INDATDLKNLIFS 148

Query: 150 RFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYY-------------LLFSDNGQNTSEDR 196
           R+ML++ +  V+DF +    YR   A +GY                L+  +N   T++  
Sbjct: 149 RYMLNLAIFSVLDFWICSNTYR---AFRGYDNNNSTNNNQNADSSNLMNKNNLTPTNKKA 205

Query: 197 LSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKAGRRVQEHQXXXXXXXXXXXXXXGAFI- 255
           L L  G++F               L F E + + R    H               G    
Sbjct: 206 LFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRATAHHNVNAGTDEESEEEADGDDDD 265

Query: 256 -----LEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCERCVLLF 310
                LE KF+YEK+++   +  K +++IF++       +V  ++    +   +  + L+
Sbjct: 266 ANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTKLQIMVLKDVVWDCLTLYQDSISLW 325

Query: 311 NYWKNNRRLHEKLLDVTAGHLDGV-DITCTICMDDMLPSK-------------DVKVNNK 356
             +KNN++L +KL  ++   ++   D  C +CMDD++PS              D    +K
Sbjct: 326 KIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDLVPSLHGKEAVEMTQADIDSISKSK 385

Query: 357 KAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF---GSSNPRAGQNANSN 404
           + K LPCGHMLH  CLK+WM+R+QTCPICR PVF   G+  P      N+N
Sbjct: 386 RPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFDENGNVKPFLHTTTNNN 436

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score =  169 bits (429), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 118/420 (28%), Positives = 193/420 (45%), Gaps = 40/420 (9%)

Query: 13  FIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFG 72
           F+ VTY L  + +Y+ T TS+SFLQ   K   G +L++   F+L++  +   L+ ++LFG
Sbjct: 13  FVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLWQLLTKLLFG 72

Query: 73  RLTLLEYEHIFERLHLTXXXXX-XXXITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRMEF 131
            L L+E+EHIFERL  T         +  +R    +    +    L +V HW+++DR+E 
Sbjct: 73  ELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYL-KVFHWILKDRLEA 131

Query: 132 VFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNGQN 191
           +    I     MK L+FSRF  ++V+L VVD++++                 ++++   +
Sbjct: 132 LLQS-INDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISS-----------IYTNQKSD 179

Query: 192 TSEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKAGRRVQ----------------- 234
                L L   ++F              CL F E +++ + +                  
Sbjct: 180 IESTSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTV 239

Query: 235 ---EHQXXXXXXXXXXXXXXGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVV 291
              + Q                  LE KF+YEK ++     LK  L++ ++       ++
Sbjct: 240 ESDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMML 299

Query: 292 FYNIFIKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGV---DITCTICMDDMLPS 348
             ++    +   +    L+  W+NN++L + L+ VT   L      D  C ICMD+++ S
Sbjct: 300 LKDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHS 359

Query: 349 KDV---KVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANSNG 405
            +    K  NKK K LPCGH+LH  CLK+WM+R+QTCPICR PVF            SN 
Sbjct: 360 PNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTTFTSNS 419

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score =  159 bits (401), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 185/386 (47%), Gaps = 21/386 (5%)

Query: 12  QFIAVT---YALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVR 68
           QF+  T   Y L   S+Y   S+S+SFLQ   K T G ++II   F +++  I       
Sbjct: 10  QFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGFNIIIISIFSIINSIILWKFSNY 69

Query: 69  MLFGRLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFHVLCQVLHWVVRDR 128
           +LFG L L+EYEH+ ERL  T           +  +    +I     +  +V +W++RDR
Sbjct: 70  LLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIILSLLLLYMKVSNWILRDR 129

Query: 129 MEFVFAPPIGTRMAMKDLLFS-RFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSD 187
           +E +    +     + +L+FS +F  ++++  ++D+ LMM F   +              
Sbjct: 130 LESLLQT-VNDSTTIFNLIFSTQFFFNLILFSLIDY-LMMNFCISNS----------LLS 177

Query: 188 NGQNTSEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKAGRRVQEHQXXXXXXXXXX 247
           N    S   + L +G++F             + L   E +K+     +            
Sbjct: 178 NSNIGSSASVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDE 237

Query: 248 XXXXGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCERCV 307
               G   LE KFIYEKI++T    LK +++I L+       ++  ++ I  +   +   
Sbjct: 238 SGFNG---LEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNIN 294

Query: 308 LLFNYWKNNRRLHEKLLDVTAGHLDGV-DITCTICMDDM-LPSKDVKVNNKKAKMLPCGH 365
            ++  W NNR+L ++L  VT   LD + D  C ICMDD+ + S       +K KMLPCGH
Sbjct: 295 TIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGH 354

Query: 366 MLHFGCLKSWMQRAQTCPICRFPVFG 391
           +LH  CLK+WM+R+QTCP+CR PVF 
Sbjct: 355 ILHMNCLKNWMERSQTCPMCRLPVFN 380

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score =  159 bits (402), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 113/405 (27%), Positives = 182/405 (44%), Gaps = 31/405 (7%)

Query: 11  LQFIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRML 70
           + F A+ Y L    + N    S SFL    K   G +++I   F+L++  +    +  +L
Sbjct: 10  IAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLLWKFLNFLL 69

Query: 71  FGRLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFH----VLCQVLHWVVR 126
           F  L L+E EHI ERL  T           + K      I + F+    +  ++ +W+++
Sbjct: 70  FKELRLIEQEHIMERLPFTIINFIFISTMFNEK----FFITMAFYGFILLYMKIFYWILK 125

Query: 127 DRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMM--------YFYRQHQAEQG 178
           DR+EF+      T  ++   +FS+F L++++L  ++ +L+         +  + +     
Sbjct: 126 DRLEFLIQS--NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNSTS 183

Query: 179 YLYYLLFSDNGQNTSEDRLSLS-------LGVDFGXXXXXXXXXXXXNCLKFVELFKAGR 231
            L  L+   +  +T     +L        L ++F             + L   E++K+ +
Sbjct: 184 ILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYKSNQ 243

Query: 232 RVQEHQXXXXXXXXXXXXXXGAFI---LEEKFIYEKIVETVLEILKILLNIFLITSGIHS 288
             Q +                      LE KFIYEKI++     L  +++I L       
Sbjct: 244 YDQLNAIIEDIEDENDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPLNLP 303

Query: 289 FVVFYNIFIKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPS 348
            +V  +I    I   + C +LF   KNN+ L  KL D+    L   D  C +CMDD+L  
Sbjct: 304 MIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSE 363

Query: 349 KDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSS 393
           +  K   KKAK LPCGH LH  CLK+WM+R+QTCPICR PVF  S
Sbjct: 364 EHKK---KKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDES 405

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score =  156 bits (394), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 131/523 (25%), Positives = 217/523 (41%), Gaps = 53/523 (10%)

Query: 24  SLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVR----MLFGRLTLLEY 79
           S+Y    +S S+LQ   K + G + I+    L++   + G  V R    + FG L L+EY
Sbjct: 27  SIYFAVLSSTSYLQVTIKLSQGFNAIV----LVLFAILNGTYVWRFFIWLAFGNLRLIEY 82

Query: 80  EHIFERLHLTXXXXXXX-XITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRMEFVFAPPIG 138
           EH+ ERL  T         +  D+  +  G I   F +  +VLHW++RDR++ +      
Sbjct: 83  EHVMERLPFTILNMVITYSMFNDKSIAFTGSIFGFFLIFMKVLHWILRDRLDAIVQSFND 142

Query: 139 TRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNGQNTSEDRLS 198
           +      +L + F L++++  +VD+K++ Y               L +  G +T+   + 
Sbjct: 143 SSTLTSIILSNNFFLNLIIFTIVDYKMVSYCVSNS----------LSNSMGASTT---VH 189

Query: 199 LSLGVDFGXXXXXXXXXXXXNCLKFVELFKAGRRVQEHQXXXXXXXXXXXXXXGAFILEE 258
           L LG++F              CL   E          +                   LE 
Sbjct: 190 LLLGMEFTMLLIDLLNLFLHTCLNLYEFHLTTLERSSNIIQEDGEDDEEDDELQFNSLEG 249

Query: 259 KFIYEKIVETVLEILKILLNIF-LITSGIHSFVVFYNIFIKSIETCERCVLLFNYWKNNR 317
           KF+YEK ++     LK  ++I  LI   +  F++  ++    I   +    L+  WKNN+
Sbjct: 250 KFMYEKTIDVFTRFLKTFIHILMLIPLRMKFFLLLKDVIWNVISLYKHTGSLWKTWKNNK 309

Query: 318 RLHEKLLDVTAGHLDGVDIT-CTICMDDMLPSKD---------------VKVNNKKAKML 361
           +L +KL   +   L   D   C +CMDD+LP  +               +  + +K K L
Sbjct: 310 QLDDKLPTASIEELKNTDNNICIVCMDDLLPRINSEKYDSQREKELYDHIMKSKQKPKKL 369

Query: 362 PCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANSNGIVPTQSEXXXXXXXXX 421
           PCGH+LH  CLK+WM+R+QTCPICR PVF       G    S                  
Sbjct: 370 PCGHILHLNCLKNWMERSQTCPICRLPVFDD----KGNVMPSTHSQNQTETQQQQPQTQT 425

Query: 422 XXXXXXXXXXXXXXXXXRRSSWHSENEIPHDPAHPVRNSEQ--SGFSATNNNDGDDPNNQ 479
                            +R   + ++ + +    P R+S Q  S     +N+D +  N Q
Sbjct: 426 QSTTELQPQTEVQPDLNQRQETNIQHNVQNVIETPGRDSAQDASRGGTGSNSDHNLTNTQ 485

Query: 480 LRPVNNSNQQK--------NEPSWISFPTQYQANGKLYFKLQE 514
           +    +SN+Q+        N  SW SFP +  ++  + F + +
Sbjct: 486 VSSEGSSNEQQGNVTNSILNTSSWYSFPIKTSSDSSITFDISD 528

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score =  152 bits (384), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 116/445 (26%), Positives = 189/445 (42%), Gaps = 62/445 (13%)

Query: 8   SIRLQFIAVT---YALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGW 64
           S + QF+  +   Y +  +++ N  ++S SFL    K   G +++I   F+L++  +   
Sbjct: 10  SKKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNEGFNIMIITIFILLNSLLSWK 69

Query: 65  LVVRMLFGRLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFHVLCQVLHWV 124
           L+   LF  L L+E EHI ERL  T           + +      I     +  +V HW+
Sbjct: 70  LITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERFFFTLTIYGLLLISLRVYHWI 129

Query: 125 VRDRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLM--------MYFYRQHQ-- 174
           ++DR+EF+    I    +M  ++FS+F  +++ L +++ KL+        + F++ +Q  
Sbjct: 130 LKDRLEFIIQT-INDSTSMTKIIFSKFSFNLISLSLINLKLIQNCLTWDDINFWKNNQNL 188

Query: 175 --AEQGYLYYLLFS---DNGQNTSEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKA 229
             +   YL   + S    NG N   + + L LG++F             + L   E +K+
Sbjct: 189 FNSIMNYLINPISSTTISNGINNHSNPVYLMLGMEFSILLLEYFNVLFHSLLSLFEFYKS 248

Query: 230 G---------------RRVQEHQXXXXXXXXXXXXXXGAFI---------LEEKFIYEKI 265
                            R Q  Q                           LE KFIYEKI
Sbjct: 249 KQFSIQQQQIRQNNLINRAQTTQNDENEINIGLDIDIDDDEEDDDETFNGLEGKFIYEKI 308

Query: 266 VETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCERCVLLFNYWKNNRRLHEKLLD 325
           ++     L  ++++ L+       ++  +I           + L+  WKNN++L   L +
Sbjct: 309 IDLFTRFLMTIIHVSLLLPLNIPMILVKDILWDFFSLYRNAMSLYKIWKNNQKLESALPN 368

Query: 326 VTAGHLDGVDITCTICMDDMLPS-------KDVKVNNKKAK------------MLPCGHM 366
           +T   L   D  C ICMDD+LPS        +V      +              LPCGH 
Sbjct: 369 MTPDDLQHSDNVCIICMDDLLPSLETLEHATNVSSTTPSSNHYLNIKKKKKPKKLPCGHF 428

Query: 367 LHFGCLKSWMQRAQTCPICRFPVFG 391
           LHF CLK+WM+R+QTCPICR  VF 
Sbjct: 429 LHFSCLKNWMERSQTCPICRLDVFD 453

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score =  142 bits (359), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 116/408 (28%), Positives = 184/408 (45%), Gaps = 54/408 (13%)

Query: 16  VTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFGRLT 75
           V Y    +  Y    +S S+LQ   K T G+++II   F L++       ++ +LF  L 
Sbjct: 18  VIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWKGLMYLLFSSLR 77

Query: 76  LLEYEHIFERLHLTXXXXXXXXITMDRKN-----SKIGVIAIPFHVLCQVLHWVVRDRME 130
           L+EYEHI ERL  T           + ++     S  G+I I      +V HWV++DR+E
Sbjct: 78  LIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILI----FMKVAHWVLKDRLE 133

Query: 131 FVFAPPIGTRMAMKDLLFS-RFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNG 189
            +    +    +++ L+FS RF L++ +  V+D+++MM                + +  G
Sbjct: 134 SLLQS-MNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNS----------IKNSMG 182

Query: 190 QNTSEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKAGRR-----VQEHQXXXXXXX 244
            +TS   + L LGV+F              CL   E  K+        V E +       
Sbjct: 183 ASTS---IHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIVGEDEDGLVDDE 239

Query: 245 XXXXXXXGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCE 304
                      LE KF+YEK ++     LK LL++ +        V+  ++    I   +
Sbjct: 240 EEFNE------LEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQ 293

Query: 305 RCVLLFNYWKNNRRLHEKLLDVTAGHLDGVD-ITCTICMDDMLPSK-------------- 349
             V L+  W+N+++L EKL  V+   L   D   C +CMD ++                 
Sbjct: 294 STVSLWKTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSTEETENKEKEE 353

Query: 350 ---DVKVNNK-KAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSS 393
              +  +++K K K LPC H+LH GCLK+WM+R+QTCPICR  VF S+
Sbjct: 354 QIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSN 401

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score =  139 bits (350), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 117/433 (27%), Positives = 187/433 (43%), Gaps = 76/433 (17%)

Query: 13  FIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFG 72
            + V Y L A+++ N    S +FL+     T GV+ +I   F L++  +       M+FG
Sbjct: 16  LVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLWKGFTYMVFG 75

Query: 73  RLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRMEFV 132
            L L+E EHIFER+ LT          +  K     V+     ++ +V HW++RDR+E  
Sbjct: 76  DLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIVLLGGLLLVLKVSHWILRDRLE-G 134

Query: 133 FAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSDNGQNT 192
           F   I     +  LLFS+F  ++++ G++D+ +    +  H     + ++  FS+  Q  
Sbjct: 135 FLQRINDTTTLTSLLFSKFSRNLLIFGILDYFVTKICFFNHFG--NFYHHGDFSNITQ-- 190

Query: 193 SEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVEL----FKAGRRVQEHQXXXXXXXXXXX 248
                 +  G+++               L F        ++ R   E             
Sbjct: 191 ------IMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDENDS 244

Query: 249 XXXGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCERCVL 308
                  LE KFIYEK+++ V  +L+         +G+H F +   +  +S+   +    
Sbjct: 245 GVNADGGLEGKFIYEKLIDFVAGVLR---------TGLH-FTMLIPLRFQSMLVKDFVWD 294

Query: 309 LFNY----------WKNNRRLHEKLLDVTAGHLDGVDITCTICMDDML----PSK----- 349
           LFN           +KNNR+L++KL ++    L   D  C +CMDD++    P+K     
Sbjct: 295 LFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDDLVLVHHPTKRRQSV 354

Query: 350 --------------------------------DVKVNNKKAKMLPCGHMLHFGCLKSWMQ 377
                                           D   ++KK K LPCGHMLHF CLK+WM+
Sbjct: 355 QEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWME 414

Query: 378 RAQTCPICRFPVF 390
           R+QTCPICR PVF
Sbjct: 415 RSQTCPICRVPVF 427

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score =  138 bits (348), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 105/396 (26%), Positives = 182/396 (45%), Gaps = 18/396 (4%)

Query: 11  LQFIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRML 70
           L F A+TY L  + + +   +S+SFLQ   K + G +++I   F L++  +    +  ML
Sbjct: 11  LIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQFLTSML 70

Query: 71  FGRLTLLEYEHIFERLHLTXXXXXXXXITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRME 130
           FG L ++E+EHIFERL            T + K            +  +V HW++RDR++
Sbjct: 71  FGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWILRDRLD 130

Query: 131 FVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYY-----LLF 185
            +    I      KDLL +R++ ++++L V+D  ++ +           ++      ++ 
Sbjct: 131 LL-LQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTNSIVL 189

Query: 186 SDNGQNTSEDRLSLSLGVDFGXXXXXXXXXXXXNCLKFVELFKAGRRVQEHQXXXXXXXX 245
                 T    + +   ++F               L+F E F   R+  ++         
Sbjct: 190 GGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYE-FHLSRKFSQNNPTFNSISA 248

Query: 246 XXXXXXGA------FILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKS 299
                           LE KF+YEK+++ V   L+ L+++ +        ++  +IF+  
Sbjct: 249 EDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLMLVKDIFVDV 308

Query: 300 IETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDG---VDITCTICMDDMLPSK--DVKVN 354
                    L   WKN+++L  KL  +T+  L+     D  C +CMD+++       + +
Sbjct: 309 WVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVSENPHHHQSD 368

Query: 355 NKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
            KK K LPCGH+LH  CLK+WM+R+QTCPICR PVF
Sbjct: 369 GKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVF 404

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  108 bits (269), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 81/141 (57%), Gaps = 6/141 (4%)

Query: 256 LEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCERCVLLFNYWKN 315
           LE KF+YEK ++     LK  L++ ++       ++  ++    +   +    L+  W+N
Sbjct: 262 LEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVWDVLALYQSATTLWKIWRN 321

Query: 316 NRRLHEKLLDVTAGHLDGV---DITCTICMDDMLPSKDV---KVNNKKAKMLPCGHMLHF 369
           N++L + L+ VT   +      D  C ICMD+++ S +    K  NKK K LPCGH+LH 
Sbjct: 322 NKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQAWKNKNKKPKRLPCGHILHL 381

Query: 370 GCLKSWMQRAQTCPICRFPVF 390
            CLK+WM+R+QTCPICR PVF
Sbjct: 382 SCLKNWMERSQTCPICRLPVF 402

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 87/155 (56%), Gaps = 3/155 (1%)

Query: 13  FIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRMLFG 72
           FI VTY L  + +Y+ T TS+SFLQ   K   G +L++   F+L++  +   L+ ++LFG
Sbjct: 13  FIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLWQLLTKLLFG 72

Query: 73  RLTLLEYEHIFERLHLTXXXXX-XXXITMDRKNSKIGVIAIPFHVLCQVLHWVVRDRMEF 131
            L L+E+EHIFERL  T         +  +R    +    +    L +V HW+++DR+E 
Sbjct: 73  ELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYL-KVFHWIIKDRLEA 131

Query: 132 VFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLM 166
           +    I     +K L+FSRF  ++ +L + D++++
Sbjct: 132 LLQ-SINDSTTLKTLIFSRFSFNLALLALTDYQII 165

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 7/67 (10%)

Query: 329 GHLDGVDITCTICMDDM------LPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTC 382
           G      I C ICM+D+      +P K  KV+ +   + PC H+ H  CL+SWM     C
Sbjct: 679 GSSPNYSIDCAICMNDVPVYVDDIP-KTHKVDKESYMITPCSHIFHTQCLESWMSYKLQC 737

Query: 383 PICRFPV 389
           P+CR P+
Sbjct: 738 PVCRAPL 744

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 336 ITCTICMDDM-LPSKDV----KVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           I C ICM D+ +   D+    KV+     + PCGH+ H  CL+SWM     CP+CR P+
Sbjct: 690 IDCAICMTDVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCRAPL 748

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 329 GHLDGVDITCTICMDDM-LPSKDV----KVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCP 383
           G  D   ++C ICM ++ +  +D+    K N     + PC H+ H GCL++WM     CP
Sbjct: 685 GANDNYCVSCAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKLQCP 744

Query: 384 ICRFPV 389
           +CR P+
Sbjct: 745 VCRAPL 750

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 7/60 (11%)

Query: 336 ITCTICMDDM------LPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           + CTICM D+      +P    KV+     + PC H+ H  CL++WM     CP+CR P+
Sbjct: 697 VDCTICMSDVPIYIEEIPETH-KVDQHSYMVTPCDHVFHTSCLENWMSYKLQCPVCRSPL 755

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 329 GHLDGVDITCTICMDDM------LPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTC 382
           G   G  I C ICM ++      +P    KV+ +   + PC H+ H  CL++WM     C
Sbjct: 697 GSTAGYTIDCAICMSEVPIRVEEVPETH-KVDEQTYMVTPCAHIFHTQCLENWMSYKLQC 755

Query: 383 PICRFPV 389
           P+CR P+
Sbjct: 756 PVCRSPL 762

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (53%), Gaps = 7/76 (9%)

Query: 319 LHEKLLDVTAGHLDGVDITCTICMDDM-LPSKDV----KVNNKKAKMLPCGHMLHFGCLK 373
           L ++LL+  A     VD  C ICM ++ +  KD+     V+ +   + PC H+ H  CL+
Sbjct: 681 LSQELLEHGASENHTVD--CAICMSEVPVYVKDIPETHAVDQQSYMVTPCNHIFHTACLE 738

Query: 374 SWMQRAQTCPICRFPV 389
           +WM     CP+CR P+
Sbjct: 739 NWMGYKLQCPVCRAPL 754

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 5/66 (7%)

Query: 329 GHLDGVDITCTICMDDMLPSKDV-----KVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCP 383
           G      + C ICM ++    D      KV+     + PC H+ H  CL+SWM     CP
Sbjct: 682 GSSSSYSVDCAICMSEVAVYVDDIPETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQCP 741

Query: 384 ICRFPV 389
           +CR P+
Sbjct: 742 VCRAPL 747

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 7/60 (11%)

Query: 336 ITCTICMDDM------LPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           + C+ICM ++      LP    KV+     + PC H+ H  CL++WM     CP+CR P+
Sbjct: 700 VDCSICMSEIPVYVEELPETH-KVDQHSYMVTPCNHIFHTSCLENWMSYKLQCPVCRAPL 758

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 7/67 (10%)

Query: 330 HLDGVD--ITCTICMDDM-LPSKDV----KVNNKKAKMLPCGHMLHFGCLKSWMQRAQTC 382
           H   VD  + C ICM ++ +  +DV    KV+ +     PCGH+ H  CL++WM     C
Sbjct: 693 HGSSVDHTVDCAICMSEVPVYVEDVPETHKVDLQTYMTTPCGHVFHTQCLENWMSYKLQC 752

Query: 383 PICRFPV 389
           P+CR P+
Sbjct: 753 PVCRSPL 759

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 336 ITCTICMDDM------LPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           + C ICM D+      +P    KV+     + PC H+ H  CL++WM     CP+CR P+
Sbjct: 697 VDCAICMSDVPIYIEEIPETH-KVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 336 ITCTICMDDM------LPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           + C ICM D+      +P    KV+     + PC H+ H  CL++WM     CP+CR P+
Sbjct: 697 VDCAICMSDVPIYIEEIPETH-KVDQHSYMVTPCNHVFHTSCLENWMSYKLQCPVCRSPL 755

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 7/60 (11%)

Query: 336 ITCTICMDDM------LPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           + C ICM +       LP    +V+     + PC HM H  CL+SWM     CP+CR P+
Sbjct: 696 VDCAICMAEFPVYVEELPETH-QVDKDSYMITPCDHMFHTSCLESWMSYKLQCPVCRSPL 754

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 7/60 (11%)

Query: 336 ITCTICMDDM------LPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           + C ICM D+      +P    KV+     + PC H+ H  CL++WM     CP+CR P+
Sbjct: 698 VDCAICMSDVPIYIEEVPETH-KVDQHSYMVTPCNHVFHTPCLENWMSYKLQCPVCRSPL 756

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 336 ITCTICMDDM-LPSKDV----KVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           I C ICM ++ +  +D+    K N  +  + PC H+ H  CL++WM     CP+CR P+
Sbjct: 697 IDCAICMSEVAIYVEDIPETHKTNPNEYMVTPCAHVFHTECLENWMSYKLQCPVCRAPL 755

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 5/59 (8%)

Query: 336 ITCTICMDDM-LPSKDVK----VNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           + CTICM ++ +  +D++    ++     + PC H+ H  CL++WM     CP+CR P+
Sbjct: 689 VDCTICMSEVPVYIQDIEETHNIDKDTYMITPCNHIFHTTCLENWMSYKLQCPVCRAPL 747

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 321 EKLLDVTAGHLDGVDITCTICMD------DMLPSKDVKVNNKKAKMLPCGHMLHFGCLKS 374
           + LL+  A     VD  C ICM       D +P+   KV+     + PC H+ H  CL++
Sbjct: 680 QNLLEHGASSDHTVD--CAICMSEVPVYVDDVPTTH-KVDLDSFMITPCNHVFHTQCLEN 736

Query: 375 WMQRAQTCPICRFPV 389
           WM     CP+CR P+
Sbjct: 737 WMGYKLQCPVCRAPL 751

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query: 336 ITCTICMDDMLPSKDVKVNNKKAK-----MLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           + C+ICM  +    D K    K       + PC H+ H  CL++WM     CP+CR P+
Sbjct: 701 VDCSICMSGIPLYVDDKPETHKVDQYSYMVTPCNHIFHTECLENWMSYKLQCPVCRTPL 759

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 337 TCTICMDDML-----PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
            C ICM D+        +  K++ +   + PC H+ H  CL++WM     CP+CR P+
Sbjct: 697 VCPICMVDVPVYVEETEETHKIDAQSYMITPCSHIFHTECLENWMSYKLQCPVCRAPL 754

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 349 KDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           +D       A +LPCGH+    CL  W     +CPICR P+ 
Sbjct: 205 EDTPTYGHSATVLPCGHVFGRECLYKWTTEHNSCPICRAPIL 246

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 12/59 (20%)

Query: 332 DGVDITCTIC----MDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           D ++ +C+IC     DD  P          +K+  CGH   + CL  W+ + +TCP+CR
Sbjct: 28  DPINDSCSICCCTYADDKYPLI--------SKLPHCGHNFDYECLSIWLSKNKTCPMCR 78

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 10/63 (15%)

Query: 330  HLDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
            H +G +++C +C +++     VK          CGH   + C+ +W++   TCP+C+  V
Sbjct: 1156 HKEGEELSCAVCFNEIFVGSVVK----------CGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

Query: 390  FGS 392
              S
Sbjct: 1206 TPS 1208

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 10/63 (15%)

Query: 330  HLDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
            H +G +++C +C +++     VK          CGH   + C+ +W++   TCP+C+  V
Sbjct: 1156 HKEGEELSCAVCFNEIFVGSVVK----------CGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

Query: 390  FGS 392
              S
Sbjct: 1206 TPS 1208

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 338 CTICMDDML-----PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
           C ICM ++        +   ++     + PC H+ H  CL++WM     CP+CR P+
Sbjct: 702 CAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLENWMGYKLQCPVCRTPL 758

>Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054W
           (REAL)
          Length = 406

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 20/81 (24%)

Query: 319 LHEKLLDVTAGHLDGV------DITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCL 372
           LH +LL  + G  D +       + C+IC D M              M PCGH   +GCL
Sbjct: 5   LHNRLLKQSDGTKDAILYKIIESLVCSICHDYMFV----------PMMTPCGHNYCYGCL 54

Query: 373 KSW----MQRAQTCPICRFPV 389
            +W     Q+   CP CR  +
Sbjct: 55  NTWFASNTQKELACPQCRSDI 75

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 8/82 (9%)

Query: 314 KNNRRLHEKLLD----VTAGHLDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHF 369
           KN +   ++ +D    + A  +   +  C IC    L  K   V    A++  CGH    
Sbjct: 76  KNRKSCSKEFIDSLPRIKANSIKDKNAECAICFCKFLEDKYPLV----AELPHCGHRFDL 131

Query: 370 GCLKSWMQRAQTCPICRFPVFG 391
            C+  W+ ++ TCP+CR  V  
Sbjct: 132 ECISVWLSKSDTCPLCRDSVLS 153

>YOL054W Chr15 (228614..229834) [1221 bp, 406 aa] {ON}  PSH1E3
           ubiquitin ligase that mediates poyubiquitination and
           degradation of centromere-binding protein Cse4p and
           prevents Cse4p from mislocalizing to euchromatin;
           ubiquitylation of Cse4p may be antagonized by Scm3p
          Length = 406

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 33/81 (40%), Gaps = 20/81 (24%)

Query: 319 LHEKLLDVTAGHLDGV------DITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCL 372
           LH +LL    G  D +       + C+IC D M              M PCGH   +GCL
Sbjct: 5   LHNRLLHQNDGTKDAILYKIIESLVCSICHDYMFV----------PMMTPCGHNYCYGCL 54

Query: 373 KSW----MQRAQTCPICRFPV 389
            +W     Q+   CP CR  +
Sbjct: 55  NTWFASNTQKELACPQCRSDI 75

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 10/49 (20%)

Query: 338  CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
            CTIC+D +           K  ML CGH     C+  W+Q    CPIC+
Sbjct: 1267 CTICLDAI----------TKGCMLKCGHFFCEDCIYDWLQTRTICPICK 1305

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 12/54 (22%)

Query: 338 CTICMDDML-PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           C +C++DM+ PS             PCGH+  + CL  W Q    CP+CR P  
Sbjct: 290 CILCLNDMVDPSCS-----------PCGHIFCWRCLMDWCQERAECPLCRQPCL 332

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICRFPVFGS 392
           LPCGH+    C++ W     TCPICR  + G+
Sbjct: 229 LPCGHIFGRECIRQWTNEHNTCPICRARIVGA 260

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 12/55 (21%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQ------RAQTCPICR 386
           C ICM+++ P + +       ++LPC H  H  C++ W        R   CP CR
Sbjct: 10  CPICMEEIGPHEPL------GELLPCHHKFHSDCIRKWHTTTTGEIRRPLCPFCR 58

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 5/56 (8%)

Query: 336 ITCTICMDDM-LPSKDV----KVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           + C ICM  + +  ++V    KV+     + PC H+ H  CL++WM     CP+CR
Sbjct: 701 VDCAICMSPVPVYIEEVEGTHKVDIHSYMVTPCNHIFHTECLENWMGYKLQCPVCR 756

>Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054W
           (REAL)
          Length = 406

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 33/81 (40%), Gaps = 20/81 (24%)

Query: 319 LHEKLLDVTAGHLDGV------DITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCL 372
           LH +LL    G  D +       + C+IC D M              M PCGH   +GCL
Sbjct: 5   LHNRLLHQGNGTKDAILYKIIESLVCSICHDYMFV----------PMMTPCGHNYCYGCL 54

Query: 373 KSW----MQRAQTCPICRFPV 389
            +W     Q+   CP CR  +
Sbjct: 55  NTWFASNTQKELACPQCRSDI 75

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 26/55 (47%), Gaps = 10/55 (18%)

Query: 332  DGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
            D     CTIC++ +              ++ CGH     C++SW++   +CP+C+
Sbjct: 1220 DNKSFNCTICLNQIYT----------GSIIKCGHFFCKKCIQSWLKNKNSCPLCK 1264

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 17/66 (25%)

Query: 325 DVTAGHLDGVDITCTIC----MDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ 380
           ++ A HL+     C+IC     DD  P          A++  CGH   F C+  W+ + +
Sbjct: 98  EIKAAHLN-----CSICYCKYTDDDYP--------LIAQLPHCGHHFDFECISIWLSKNE 144

Query: 381 TCPICR 386
           TCPICR
Sbjct: 145 TCPICR 150

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 10/54 (18%)

Query: 336  ITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPV 389
            + C+IC+  +              M+ CGH+    C+ SW++  +TCP+C+ P 
Sbjct: 1162 MECSICLQPI----------TNGAMVNCGHLFCTSCIFSWLKNRKTCPLCKHPT 1205

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 40.4 bits (93), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 335 DITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           D TC IC  + +  +   V     ++  CGH   F C+  W+ +  TCP+CR
Sbjct: 101 DDTCPICCSNFIADEYPLV----VELPHCGHKFDFECVSMWLTKNTTCPMCR 148

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 10/55 (18%)

Query: 338  CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGS 392
            C+IC+ D+              ML CGH     C+ SW++  + CP+C+     S
Sbjct: 1191 CSICLQDI----------SLGSMLKCGHFFCKRCITSWLKNKKNCPMCKMVTTAS 1235

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 39.7 bits (91), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 12/54 (22%)

Query: 337 TCTIC----MDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           TC IC    +DD  P          AK+  C H     CL  W+Q   TCP+CR
Sbjct: 70  TCAICQCNFLDDPYPLV--------AKVPRCNHKFDLECLSIWLQNNHTCPMCR 115

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 12/50 (24%)

Query: 338 CTICMDDML-PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           C +C+ DM  PS            LPCGHM  + C+  W      CP+CR
Sbjct: 266 CILCLADMTDPS-----------CLPCGHMFCWACVMQWCNERNECPLCR 304

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFG 391
           C+IC  + L  K   V     ++  C H     CL  W+ R+ TCP+CR  V G
Sbjct: 79  CSICYTNYLEDKYPLV----VELPHCHHKFDLECLSVWLSRSTTCPLCRDDVMG 128

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 35/81 (43%), Gaps = 26/81 (32%)

Query: 335 DITCTICMD-------DMLPSKD-VKVNNKKAK-----------MLPCGHMLHFGCLKSW 375
           D TC IC++       D + ++D ++V  K              M+PC H  H GCLK W
Sbjct: 138 DETCCICLELLKTQEYDTITTQDGMRVKTKGGPPTKSIKDTDIVMIPCQHYFHAGCLKEW 197

Query: 376 M-------QRAQTCPICRFPV 389
                   +R   CP+CR  +
Sbjct: 198 FSPQRRGKRRPLVCPLCRMDI 218

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 6/67 (8%)

Query: 321 EKLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNKKAKMLP-CGHMLHFGCLKSWMQRA 379
           E+L       L      C IC   +  S D +    +   LP C H  HF C+K W+Q+ 
Sbjct: 193 EQLPRTNCAELSNSSDECPICR--IAYSDDFET---EITCLPNCSHHFHFECIKLWLQKN 247

Query: 380 QTCPICR 386
             CP+CR
Sbjct: 248 SLCPLCR 254

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 8/58 (13%)

Query: 331 LDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQT--CPICR 386
           L+G +I C IC DD+    D  +   + K+ PC H  H+ C++ W   +    CP+CR
Sbjct: 6   LEGDNI-CPICFDDL---NDTDI--LQGKLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFG 391
           C+IC  + L  +   V     ++  C H     CL  W+ R+ TCP+CR  V G
Sbjct: 107 CSICYTNYLEDEYPLV----VELPHCNHRFDLECLSVWLSRSTTCPLCRDDVMG 156

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 14/87 (16%)

Query: 325 DVTAGHLDGVDI---TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQT 381
           D   GH +  D+   TC +C++ +    D +V       +PC H  H  CL  W  +   
Sbjct: 231 DPFTGHKETGDVELPTCPVCLERL----DSEVTG--LATIPCQHTFHCQCLNKW--KDSR 282

Query: 382 CPICRFP---VFGSSNPRAGQNANSNG 405
           CP+CR+    V  SS  R G   ++ G
Sbjct: 283 CPVCRYSGLKVTKSSLLRQGVRCSTCG 309

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 4/58 (6%)

Query: 334 VDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFG 391
           V   C+IC  + L  +   V     ++  C H     CL  W+ R+ TCP+CR  V G
Sbjct: 110 VTDNCSICYTNYLEDEYPLV----VELPHCHHKFDLECLSVWLSRSTTCPLCRDDVMG 163

>TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.808
           YOL054W
          Length = 394

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 26/63 (41%), Gaps = 14/63 (22%)

Query: 336 ITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQT----CPICRFPVFG 391
           + C+IC D M              M  CGH   +GCLKSW    +T    CP CR  V  
Sbjct: 28  LMCSICQDYMFV----------PMMTACGHNYCYGCLKSWFTSNETTELSCPQCRSSVGS 77

Query: 392 SSN 394
             N
Sbjct: 78  EPN 80

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 16/77 (20%)

Query: 315  NNRRLHEKLLDVTAGHL-----DGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHF 369
            NN     + LD T G L     +G +I+C +C  D+              +L CGH    
Sbjct: 1181 NNLESRVRYLD-TLGQLKTAIANGENISCAVCYSDIYT----------GSILKCGHFFCK 1229

Query: 370  GCLKSWMQRAQTCPICR 386
             C+  W ++  +CP+C+
Sbjct: 1230 DCVTHWFKKNTSCPMCK 1246

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 38.5 bits (88), Expect = 0.014,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%)

Query: 361 LP-CGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           LP CGH     C+  W+ R+ TCP+CR  V 
Sbjct: 108 LPNCGHTFDLQCVSVWLSRSTTCPMCRSDVL 138

>Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054W
           (REAL)
          Length = 411

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 33/81 (40%), Gaps = 20/81 (24%)

Query: 319 LHEKLLDVTAGHLDGV------DITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCL 372
           LH +LL  +    D V       + C+IC D M              M PCGH   +GCL
Sbjct: 5   LHNRLLHQSNNTKDEVLYKIIESLICSICHDYMF----------VPMMTPCGHNYCYGCL 54

Query: 373 KSW----MQRAQTCPICRFPV 389
            +W     Q+   CP CR  +
Sbjct: 55  NTWFSSNTQKELACPQCRSDI 75

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 4/52 (7%)

Query: 360 MLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNA-NSNGIVPTQ 410
           +LPC H+    CL  W Q   +CP+CR  +  ++   AGQ+  +SNG V  Q
Sbjct: 215 VLPCNHVFGRECLFKWSQLENSCPLCRHKIVEAA---AGQSGEDSNGAVANQ 263

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 10/64 (15%)

Query: 326 VTAGHLDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ--TCP 383
           +    L  V   C IC+D         ++   AK+ PC H  H  C+++W   +    CP
Sbjct: 7   IKPTKLTMVSSICAICLD--------AIDKSIAKLEPCNHKYHIDCIRTWHNYSNDLNCP 58

Query: 384 ICRF 387
            CR 
Sbjct: 59  TCRI 62

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 12/51 (23%)

Query: 337 TCTICMDDML-PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           +C +C+ DM+ PS            LPCGH+  + C+  W      CP+CR
Sbjct: 269 SCILCLVDMVDPS-----------CLPCGHLFCWNCIMHWCTERSECPLCR 308

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 38.5 bits (88), Expect = 0.017,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 14/80 (17%)

Query: 321 EKLLDVTAGHLDGVDITCTIC----MDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWM 376
           + L  V    L G D  C+IC    +DD  P           K+  C H     C+  W+
Sbjct: 67  DSLPRVNKCDLKGAD-ACSICCCGYLDDTHPLV--------VKLPHCSHRFDLECVAVWL 117

Query: 377 QRAQTCPICRFPVFGSSNPR 396
            +++TCP+CR  V  S  P+
Sbjct: 118 SKSRTCPLCRDDVL-SHKPK 136

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 12/50 (24%)

Query: 338 CTICMDDML-PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           C +C+ DM  PS             PCGH+  + CL SW +    CP+CR
Sbjct: 286 CILCLMDMTDPS-----------CTPCGHLFCWNCLMSWCKERPECPLCR 324

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 11/55 (20%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQ---RAQTCPICRFPV 389
           C IC D M         +  AK++PC H  H  C++ W       +TCP CR  +
Sbjct: 9   CPICWDSMA--------DNVAKLIPCQHEFHLSCIRKWYHSRISDRTCPNCRVEI 55

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFG 391
           C+IC  + L  +   V     ++  C H     CL  W+ R+ TCP+CR  V G
Sbjct: 109 CSICYTNYLEDEYPLV----VELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMG 158

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 13/57 (22%)

Query: 336 ITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWM---QRAQTCPICRFPV 389
           + C+IC D M              M PCGH   +GCL +W+    +   CP CR  +
Sbjct: 28  LNCSICHDYMFV----------PMMTPCGHNFCYGCLNNWITGGSKDLNCPQCRSTI 74

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 8/54 (14%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           +C +C++ M  S    +       +PC H  H  CL  W  +   CPICRF   
Sbjct: 282 SCPVCLERMDSSITGLI------TIPCQHTFHCQCLNKW--KNSKCPICRFSTL 327

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 27/61 (44%), Gaps = 14/61 (22%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWM----QRAQTCPICRFPVFGSS 393
           CTIC + M              M  CGH   +GCLKSW+    ++   CP CR  +  + 
Sbjct: 30  CTICSEYMFV----------PMMTSCGHNYCYGCLKSWISTNSKKELACPQCRSDITDTP 79

Query: 394 N 394
           N
Sbjct: 80  N 80

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 12/50 (24%)

Query: 338 CTICMDDML-PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           C +C+ DM  PS             PCGH+  + CL SW +    CP+CR
Sbjct: 286 CILCLMDMTDPS-----------CTPCGHLFCWDCLMSWCKERPECPLCR 324

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 12/50 (24%)

Query: 338 CTICMDDML-PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           C +C++ ML PS             PCGH+  + C+  W    Q CP+CR
Sbjct: 255 CVLCLNYMLDPSAT-----------PCGHLFCWDCIMEWTLERQECPLCR 293

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQ---RAQTCPICR 386
           C+IC + M PS          +++PCGH  H  C++ W       ++CP+CR
Sbjct: 18  CSICWESM-PSG-------VGRLMPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 12/50 (24%)

Query: 338 CTICMDDML-PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           C +CM  M+ PS             PCGH+  + CL +W +  + CP+CR
Sbjct: 275 CILCMSFMINPS-----------CAPCGHIYCWNCLINWCKEKEECPLCR 313

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 10/50 (20%)

Query: 337  TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
            TCTIC  ++              ++ CGH     C+ SW++    CP+C+
Sbjct: 1163 TCTICFSEIY----------MGSIIKCGHFFCKSCIHSWLRNKNACPLCK 1202

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 321 EKLLDVTAGHLDGVDITCTIC----MDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWM 376
           + L  V   HL   D TC IC    ++D  P   VK+ N       C H     C+  W+
Sbjct: 74  DSLPRVATTHL-SPDDTCAICCCVYLEDSYPLV-VKLPN-------CNHKFDLQCITLWL 124

Query: 377 QRAQTCPICRFPVFGS 392
            ++ TCP+CR  V  S
Sbjct: 125 SKSSTCPMCRNDVMSS 140

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 18/33 (54%)

Query: 360 MLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGS 392
            LPC H+    C++ W     TCPICR  + G+
Sbjct: 224 QLPCSHVFGRECIRQWTNLHNTCPICRANIVGA 256

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 8/56 (14%)

Query: 334 VDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ--TCPICRF 387
           V   C IC++D+         +  + + PCGH  H  C++ W   A+   CP+CR 
Sbjct: 2   VSKVCAICLEDICGK------SSTSYLKPCGHEYHSDCIRKWHGHAEDLKCPMCRI 51

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 12/50 (24%)

Query: 338 CTICMDDML-PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           C +C+++M  PS             PCGH+  + C+ +W +  + CP+CR
Sbjct: 318 CILCLNEMTDPS-----------CPPCGHLFCWACIMNWCKEREECPLCR 356

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%)

Query: 355 NKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           N     LPCGH+    CL  W +   TCP+CR
Sbjct: 227 NHSPTKLPCGHIFGRECLYRWCKLENTCPLCR 258

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 10/49 (20%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           C +C+ +M          K     PCGH+  + C+ +W +    CP+CR
Sbjct: 271 CILCLTEM----------KDPSCAPCGHIFCWNCIINWCKERSECPLCR 309

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICR 386
           LPCGH+    C+  W +   +CPICR
Sbjct: 279 LPCGHIFGRDCIFKWTKEHNSCPICR 304

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 41/93 (44%), Gaps = 17/93 (18%)

Query: 294  NIFIKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPSKDVKV 353
            ++++K+I+          Y +N  +L + L D        +   CTIC+ D+        
Sbjct: 1182 SMYLKNIQKISTLQSRLKYLQNLTKLEQALKD-------NMRFNCTICLCDIC------- 1227

Query: 354  NNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
                  ++  GH     C+ SW++  Q+CP+C+
Sbjct: 1228 ---DGAIIGRGHFYCQECISSWLETKQSCPLCK 1257

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 7/52 (13%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ--TCPICR 386
           TC IC+DD     D         + PC H  H  CL+ W   A    CPICR
Sbjct: 4   TCPICLDD-----DRTNIESIGTLQPCNHKFHRDCLRRWHLYAHDLVCPICR 50

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 18/29 (62%)

Query: 358  AKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
              ++ CGH     C+ SW++  +TCPIC+
Sbjct: 1187 GSIMKCGHFFCRDCIHSWLKNQRTCPICK 1215

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 8/54 (14%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           TC +C++ M       +       +PC H  H  CL  W  +   CP+CR+  F
Sbjct: 240 TCPVCLERMDSETTGLI------TIPCQHTFHCQCLDKW--KNSQCPVCRYSSF 285

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICR 386
           LPCGH+    CL  W +   TCP+CR
Sbjct: 302 LPCGHIFGRECLFKWSKVENTCPLCR 327

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 10/49 (20%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           C +C+ +M               LPCGH+  + C+  W +    CP+CR
Sbjct: 277 CILCLMEM----------TDPSCLPCGHVFCWDCITDWTKENPECPLCR 315

>TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.808
           YOL054W
          Length = 478

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 24/56 (42%), Gaps = 14/56 (25%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ----TCPICRFPV 389
           C+IC D M              + PCGH   +GCL SW   +     +CP CR  +
Sbjct: 30  CSICQDYMFV----------PMVTPCGHSFCYGCLCSWFSSSNVDGLSCPHCRTSI 75

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 10/49 (20%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           C +C+ +M                PCGH+  + CL SW +    CP+CR
Sbjct: 286 CILCLTNM----------TDPSCAPCGHLFCWDCLMSWCKERPECPLCR 324

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 27/66 (40%), Gaps = 8/66 (12%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPR 396
           TC +C++ M       +       +PC H  H  CL  W  +   CP+CR   F  S   
Sbjct: 246 TCPVCLERMDSETTGLI------TIPCQHTFHCQCLDKW--KNSKCPVCRLSSFRLSRDT 297

Query: 397 AGQNAN 402
             ++ N
Sbjct: 298 LRKHGN 303

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 11/73 (15%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFP---VFGSS 393
           TC +C++ +    D +V       +PC H  H  CL  W      CP+CR+    +  SS
Sbjct: 226 TCPVCLERL----DSEVTG--LATIPCQHTFHCVCLNKWGD--NRCPVCRYSGLKLTKSS 277

Query: 394 NPRAGQNANSNGI 406
             R G   ++ G+
Sbjct: 278 LARQGARCSTCGV 290

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 16/25 (64%)

Query: 362 PCGHMLHFGCLKSWMQRAQTCPICR 386
           PCGH+  + CL SW +    CP+CR
Sbjct: 300 PCGHLFCWSCLMSWCKERPECPLCR 324

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 54/135 (40%), Gaps = 34/135 (25%)

Query: 273 LKILLNIFLITSGIHSFVVFYNIFIKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLD 332
           LKIL  I LI S           F KS+    +CV  F   +  ++L+EK  +  +   D
Sbjct: 195 LKILGYILLIQS-----------FSKSLPILSQCVKTFLPQQQEQQLNEK--NTYSSEND 241

Query: 333 GVDITCTICMDDMLPSKDVKVNNKKA---------------------KMLPCGHMLHFGC 371
            +D        ++  SK ++++++                          PCGH+  + C
Sbjct: 242 QIDTMALTKNTNLKDSKHIELSDESVFKFIPEESRNCILCLNSMVDPSAAPCGHIFCWDC 301

Query: 372 LKSWMQRAQTCPICR 386
           + +W +    CP+CR
Sbjct: 302 IINWCKERPECPLCR 316

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 12/63 (19%)

Query: 325 DVTAGHLDGVDITCTICMDDML-PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCP 383
           D     + G   TC +C+  ++ PS             PCGH+  + C+ +W      CP
Sbjct: 264 DTLFTFIQGASRTCILCLSKIVDPS-----------CAPCGHLYCWDCILNWCNEKPECP 312

Query: 384 ICR 386
           +CR
Sbjct: 313 LCR 315

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 38.1 bits (87), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 17/75 (22%)

Query: 312  YWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGC 371
            Y KN  RL + L D          ++C+IC+ ++          +   ++ CGH     C
Sbjct: 1220 YLKNLSRLKDTLNDNQI-------LSCSICLGEV----------EIGAIIKCGHYFCKSC 1262

Query: 372  LKSWMQRAQTCPICR 386
            + +W++    CPIC+
Sbjct: 1263 ILTWLRAHSKCPICK 1277

>Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] {ON}
            YLR247C (REAL)
          Length = 1557

 Score = 38.1 bits (87), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 26/51 (50%), Gaps = 10/51 (19%)

Query: 336  ITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
            ++C+IC+ D+          +   ++ CGH     C+ +W++    CPIC+
Sbjct: 1238 LSCSICLGDV----------EIGAIIKCGHYFCKNCILTWLRAHNKCPICK 1278

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 38.1 bits (87), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 10/50 (20%)

Query: 337  TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
            +C IC+  +              ++ CGH     C+ SW++  Q+CP+C+
Sbjct: 1200 SCAICLGTI----------HTGSIIKCGHFFCRKCIHSWLKNNQSCPLCK 1239

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 12/51 (23%)

Query: 337 TCTICMDDML-PSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           +C +C++ M  PS             PCGH+  + C+ SW +    CP+CR
Sbjct: 275 SCILCLNAMTDPS-----------CAPCGHIFCWDCILSWCKERPECPLCR 314

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICR 386
           +PCGH+    CL  W +   +CP+CR
Sbjct: 293 IPCGHIFGRSCLYEWTRLENSCPLCR 318

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 38.1 bits (87), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 10/51 (19%)

Query: 337  TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRF 387
            +CTIC+ ++     +K          CGH     C+ SW++   +CP+C+ 
Sbjct: 1188 SCTICLGEIYMGSVIK----------CGHFFCQDCICSWLKNHSSCPLCKM 1228

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 29/73 (39%), Gaps = 8/73 (10%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPR 396
           TC +C++ M        +      +PC H  H  CL  W  +   CP+CR+     S   
Sbjct: 233 TCPVCLERM------DSDTTGLITIPCQHTFHCQCLDKW--KNSKCPVCRYSSLRLSRDS 284

Query: 397 AGQNANSNGIVPT 409
             ++A  +    T
Sbjct: 285 LLRDAGGSASCST 297

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQ 399
           LPC H+    CL  W +   +CP+CR  +  S + RA +
Sbjct: 244 LPCDHIFGRECLYKWSKLENSCPLCRHKIIESDSERASE 282

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 20/103 (19%)

Query: 295 IFIKSIETCERCVLLFNYWKNNRRLHEKL------LDVTAGHLDGVDI-TCTICMDDMLP 347
           +FIK +   ER   LF+   ++ RL   L      L+   G L  V++  C +C++ M  
Sbjct: 126 VFIKEVVFQER---LFDLTDDDERLPYLLTDPFTQLEKPGGRL--VELPACPVCLERMDS 180

Query: 348 SKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
                +       +PC H  H  CL  W  +   CP+CR+  F
Sbjct: 181 ETTGLIT------IPCQHTFHCQCLNRW--KNSKCPVCRYSSF 215

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 10/67 (14%)

Query: 321  EKLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ 380
            E L  +  G  +     CTIC+ ++     +K          CGH     C+ SW++   
Sbjct: 1206 ETLTKLKEGLKNENTFNCTICLGEIYMGSVIK----------CGHFFCQSCIFSWLKNHA 1255

Query: 381  TCPICRF 387
            +CP+C+ 
Sbjct: 1256 SCPLCKM 1262

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICR 386
           LPCGH+    CL  W +   +CP+CR
Sbjct: 273 LPCGHVFGRECLYKWSRLENSCPLCR 298

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 34.7 bits (78), Expect = 0.13,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 361 LP-CGHMLHFGCLKSWMQRAQTCPICR 386
           LP C H     C+  W+ +++TCP+CR
Sbjct: 53  LPHCNHRFDLECVAVWLSKSRTCPLCR 79

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 8/51 (15%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQR-AQTCPICR 386
           TC IC +D       K+NN    +L C H+ H  C+  W+ R +  CP+C+
Sbjct: 119 TCAICQEDF-----NKLNN--VCLLGCNHVFHTYCIDQWICRNSACCPLCK 162

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 12/59 (20%)

Query: 337 TCTICMDDMLPSKDVKVNNKK----AKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFG 391
           TC+IC +        +  N      A++  CGH+    C+  W+    TCP+CR  V G
Sbjct: 91  TCSICFE--------RFGNDNYPLLAQLPHCGHIFDLQCISMWLSNQVTCPMCRDVVNG 141

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICR 386
           LPCGH+    C+  W +   +CP+CR
Sbjct: 254 LPCGHIFGRECIYKWSKLENSCPLCR 279

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICR 386
           LPCGH+    C+  W +   +CP+CR
Sbjct: 265 LPCGHIFGRECIYKWSRLENSCPLCR 290

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 360 MLPCGHMLHFGCLKSWMQRAQTCPICR 386
            LPC H+    CL  W Q   +CP+CR
Sbjct: 300 QLPCAHIFGRECLDKWSQIENSCPLCR 326

>TDEL0E02870 Chr5 (548115..548981) [867 bp, 288 aa] {ON} Anc_5.339
           YDR313C
          Length = 288

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 332 DGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQR 378
           DG    C IC +DM+PS       +K   L C  + H+ C+KSW  +
Sbjct: 224 DGQYTECPICFEDMMPS-------EKVGRLECLCIFHYKCIKSWFNK 263

>Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] {ON}
            YLR247C (REAL)
          Length = 1560

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 10/51 (19%)

Query: 336  ITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
            ++C+IC+ ++          +   ++ CGH     C+ +W++    CPIC+
Sbjct: 1241 LSCSICLGEV----------EVGAIIKCGHYFCKSCILTWLRSHSKCPICK 1281

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 8/51 (15%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRF 387
           TC +C++ M        +      +PC H  H  CL  W  +   CP+CR+
Sbjct: 233 TCPVCLERM------DSDTTGLITIPCQHTFHCQCLDKW--KNSRCPVCRY 275

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 6/52 (11%)

Query: 341 CMDDMLPSKDVKVNNKKAK------MLPCGHMLHFGCLKSWMQRAQTCPICR 386
            MD  +P+      NKK +       L C H+    CL  W +   +CP+CR
Sbjct: 309 SMDSTIPTSSTPDENKKHEYHNSPVQLSCKHIFCRSCLYEWSKLKNSCPLCR 360

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 8/50 (16%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           TC +C++ M       V       +PC H  H  CL  W  +   CP+CR
Sbjct: 239 TCPVCLERMDSETSGLV------TIPCQHTFHCQCLNKW--KNSRCPVCR 280

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICR 386
           LPCGH+    C+  W +   +CP+CR
Sbjct: 255 LPCGHIFGRECIYKWSRLENSCPLCR 280

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 5/46 (10%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICRF-----PVFGSSNPRAGQNA 401
           LPC H+    CL  W +   TCP+CR      PV    N   G N 
Sbjct: 279 LPCKHIFGRECLYKWTRVQNTCPLCRHIIAESPVNAPPNAPDGNNG 324

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 8/51 (15%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRF 387
           TC +C++ M       +       +PC H  H  CL  W      CP+CR+
Sbjct: 267 TCPVCLERMDSETTGLIT------IPCQHTFHCSCLDKW--NDSRCPVCRY 309

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 34.7 bits (78), Expect = 0.24,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 361 LP-CGHMLHFGCLKSWMQRAQTCPICR 386
           LP CGH     CL  W  ++ +CP+CR
Sbjct: 93  LPHCGHDFDLECLSVWFSKSTSCPLCR 119

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 362 PCGHMLHFGCLKSWMQRAQTCPICR 386
           PCGH+  + CL +W +    CP+CR
Sbjct: 293 PCGHLFCWDCLLNWSKERPECPLCR 317

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 8/50 (16%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           TC +C++ M       V       +PC H  H  CL  W  +   CP+CR
Sbjct: 239 TCPVCLERMDSETTGLV------TIPCQHTFHCQCLNKW--KNSRCPVCR 280

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 8/50 (16%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           TC +C++ M       V       +PC H  H  CL  W  +   CP+CR
Sbjct: 239 TCPVCLERMDSETTGLV------TIPCQHTFHCQCLNKW--KNSRCPVCR 280

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 8/50 (16%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           TC +C++ M       V       +PC H  H  CL  W  +   CP+CR
Sbjct: 239 TCPVCLERMDSETTGLV------TIPCQHTFHCQCLNKW--KNSRCPVCR 280

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 10/50 (20%)

Query: 337  TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
            TC IC+  +              M+ CGH     C+ SW++    CP+C+
Sbjct: 1270 TCPICLGLI----------HTGSMISCGHFFCNNCIFSWLKLNSNCPLCK 1309

>Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON}
           (52842..54119) [1278 nt, 426 aa]
          Length = 425

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 35/87 (40%), Gaps = 25/87 (28%)

Query: 308 LLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDM-LPSKDVKVNNKKAKMLPCGHM 366
           +L    K   +L  K+LD T          C+IC D M +P            M+ CGH 
Sbjct: 15  VLSQSKKTKNKLLGKVLDSTL---------CSICHDYMYVP-----------MMVACGHN 54

Query: 367 LHFGCLKSWMQRAQT----CPICRFPV 389
             + CL SW    +T    CP CR  V
Sbjct: 55  YCYSCLSSWFTSNETQELSCPQCRANV 81

>Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] {ON}
            YLR247C (REAL)
          Length = 1553

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 10/51 (19%)

Query: 336  ITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
            ++C+IC+ ++          +   ++ CGH     C+ +W++    CPIC+
Sbjct: 1234 LSCSICLGEV----------EIGAIIKCGHYFCKNCILTWLRAHSKCPICK 1274

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICR 386
           LPC H+    CL  W +   TCP+CR
Sbjct: 262 LPCHHIFGRECLYKWTRHENTCPLCR 287

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 28/68 (41%), Gaps = 8/68 (11%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPR 396
           TC +C++ M    D  V       +PC H  H  CL  W  +   CP+CR      S   
Sbjct: 240 TCPVCLEKM----DSLVTG--LITIPCSHTFHCQCLDKW--KNSKCPVCRHTNLNISRKL 291

Query: 397 AGQNANSN 404
             + A S+
Sbjct: 292 LIEQATSD 299

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICR 386
           LPCGH+    C+  W     +CP+CR
Sbjct: 338 LPCGHIFGRDCIFKWSHLENSCPLCR 363

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 9/68 (13%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFG-SSNP 395
           TC +C++ +       +       +PC H  H  CL  W  +   CP+CR+     S   
Sbjct: 234 TCPVCLERLDDGTTGLI------TIPCQHTFHCQCLDKW--KNSKCPVCRYSNLKFSREA 285

Query: 396 RAGQNANS 403
              QNA+S
Sbjct: 286 LLRQNASS 293

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 360 MLPCGHMLHFGCLKSWMQRAQTCPICRFPVFG 391
            L CGH     C+  W +   +CPICR  + G
Sbjct: 244 QLKCGHRFGRMCIYQWTKEHNSCPICRAEIVG 275

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 361 LPCGHMLHFGCLKSWMQRAQTCPICRFPVFG 391
           L CGH+    C+  W +   +CPICR  + G
Sbjct: 229 LKCGHVFGRVCIYQWTKENNSCPICRANIVG 259

>Skud_4.576 Chr4 complement(1031529..1032410) [882 bp, 293 aa] {ON}
           YDR313C (REAL)
          Length = 293

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 316 NRRLHEKLLDVTAGHLDGVDIT-CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKS 374
           NR L  K+  +T+G  +G  I  C IC +DM P +       K   L C  + H+ C+K 
Sbjct: 209 NRMLVYKIPPITSGDENGSVIKECPICFEDMEPGE-------KVGRLECLCVFHYKCIKD 261

Query: 375 WMQR 378
           W  +
Sbjct: 262 WFHK 265

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 362 PCGHMLHFGCLKSWMQRAQTCPICR 386
           PCGH+  + CL SW      CP+CR
Sbjct: 116 PCGHVFCWKCLLSWCNERPECPLCR 140

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 5/54 (9%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           +C IC D M  S    V      M PCGH +H  C   + + +  CP C+  V 
Sbjct: 385 SCPICGDFMFTSVKPVV-----YMSPCGHAIHQHCFDEYTKHSYKCPSCQVSVL 433

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 10/49 (20%)

Query: 338  CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
            C IC++ +              ++ CGH     C+ SW++    CPIC+
Sbjct: 1151 CPICLNTIY----------MGSIIKCGHFFCKHCIFSWLKNKSVCPICK 1189

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 23/50 (46%), Gaps = 10/50 (20%)

Query: 337  TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
            +C IC+  +              ++ CGH     C+ SW++   +CP+C+
Sbjct: 1153 SCPICLGKI----------TMGAIIKCGHFFCRSCIHSWLKNHNSCPMCK 1192

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 22/51 (43%), Gaps = 8/51 (15%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRF 387
           TC +C++ +               +PC H  H  CL  W  +   CP+CR+
Sbjct: 237 TCPVCLEQL------DCETTGLITIPCQHTFHCQCLDKW--KNSRCPVCRY 279

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 10/53 (18%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQT--CPICRF 387
           +C IC + +        +    +++ CGH  HF C++ W   ++   CP CR 
Sbjct: 3   SCPICFESL--------SKGACRLVECGHKYHFNCIRRWHYHSKNLQCPTCRI 47

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1321

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 2/26 (7%)

Query: 360  MLPCGHMLHFGCLKSW--MQRAQTCP 383
            +L CGH  HF CL+ W   + A TCP
Sbjct: 1286 LLSCGHEGHFACLREWFITENADTCP 1311

>KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {ON}
           Anc_2.157 YHR115C
          Length = 408

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 10/53 (18%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ---TCPICRF 387
           C+IC++ M P + V V+       PC H+ H+ C++  + +      CP CR+
Sbjct: 346 CSICLEKMSPYQGVFVS-------PCCHLWHYNCIRRVITQHYPQFVCPNCRY 391

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%), Gaps = 5/54 (9%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           +C IC D M  S    V      M PCGH +H  C   + + +  CP C+  + 
Sbjct: 384 SCPICGDFMFTSVKPVV-----YMSPCGHAIHQHCFDEYTKHSYKCPSCQVSIL 432

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 6/49 (12%)

Query: 362 PCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSN----PRAGQNANSNGI 406
           PC H  H  CL  W  +   CP+CR+      N    PR  +   +N +
Sbjct: 233 PCQHTFHCKCLDQW--KNGNCPVCRYSQLKDVNNEPLPRCLECGETNNL 279

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 11/55 (20%)

Query: 331 LDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPIC 385
           LD + + C IC D +          K + + PCGH     C++ ++Q+   CP+C
Sbjct: 26  LDSL-LRCHICKDFL----------KASVLTPCGHSFCSICIRKYLQKESKCPLC 69

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%)

Query: 361 LP-CGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           LP C H     C+  W+Q+  +CPICR  V 
Sbjct: 133 LPNCKHYFDLECITLWLQKNSSCPICRNDVL 163

>Kwal_14.1868 s14 complement(501965..506038) [4074 bp, 1357 aa] {ON}
            YOR191W (RIS1) - contains motifs that are present in a
            family of DNA-dependent ATPases, the SWI2/SNF2-like
            proteins [contig 235] FULL
          Length = 1357

 Score = 35.4 bits (80), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 10/57 (17%)

Query: 332  DGVD-ITCTICMDDM-LPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
            DG++ +TC  CM+ M L S  V        + PCGHML  GC + + + A+  P  R
Sbjct: 1056 DGLESMTCPQCMEQMELESTMV--------ITPCGHMLCEGCSEMYFEDARAQPGAR 1104

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 33.9 bits (76), Expect = 0.61,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%)

Query: 361 LP-CGHMLHFGCLKSWMQRAQTCPICR 386
           LP C H     CL  W+ +  TCP+CR
Sbjct: 104 LPHCSHRFDLECLTPWLLKNSTCPLCR 130

>SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conserved
           hypothetical protein
          Length = 662

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 5/53 (9%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           C IC D M  S    V      M PCGH +H  C   + + +  CP C+  V 
Sbjct: 380 CPICGDYMFTSVRPVV-----YMSPCGHAIHQHCFDEYTKHSYKCPHCQVTVL 427

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 14/25 (56%)

Query: 362 PCGHMLHFGCLKSWMQRAQTCPICR 386
           PCGH+  + C+  W +    CP CR
Sbjct: 242 PCGHIFCWDCIVDWCRERPECPFCR 266

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
           [1008 nt, 336 aa]
          Length = 335

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 10/54 (18%)

Query: 335 DITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ--TCPICR 386
           D+ C IC ++            +  + PC H  H  C++ W   A    CP CR
Sbjct: 3   DLECAICFEEF--------KEDRCALNPCHHTFHLECIRIWHSYADDLKCPTCR 48

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 8/51 (15%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRF 387
           +C +C++ M    D  +       +PC H  H  CL  W  +   CP+CR+
Sbjct: 236 SCPVCLERM----DSDITG--LITIPCQHTFHCQCLDKW--KDSRCPVCRY 278

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {ON}
           Anc_3.405 YPR093C
          Length = 555

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 10/51 (19%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSW--MQRAQTCPICR 386
           C IC++D        + +    +  C H  HF C++ W    ++  CP+CR
Sbjct: 5   CPICLED--------ITDILGSLKVCQHNFHFNCIRQWHLTSKSLECPVCR 47

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 362 PCGHMLHFGCLKSWMQRAQTCPICR 386
           PCGH+  + C+  W +    CP+CR
Sbjct: 294 PCGHIFCWECILDWCKERPECPLCR 318

>KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {ON}
           similar to uniprot|P38164 Saccharomyces cerevisiae
           YBL104C Hypothetical ORF
          Length = 965

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 8/61 (13%)

Query: 331 LDGVDITCTICMDDMLPSKDVKVNNKKAKM-------LPCGHMLHFGCLKSWMQRAQTCP 383
           ++G   +C + +DD     +VK   K+ KM       L C H +H G  + W +R   CP
Sbjct: 897 INGTTNSCEVRIDDDAKINEVK-ERKRLKMNEWFSFCLKCNHGMHAGHAEEWFERHSICP 955

Query: 384 I 384
           +
Sbjct: 956 V 956

>Smik_12.407 Chr12 complement(716407..717186) [780 bp, 259 aa] {ON}
           YLR323C (REAL)
          Length = 259

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 10/63 (15%)

Query: 331 LDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           LD +   CT+C +D           K   +  CGH     C    M++   C IC     
Sbjct: 192 LDKIPFKCTLCKEDY----------KSPVVTSCGHYFCASCFAKEMKKGTRCSICHKETH 241

Query: 391 GSS 393
           GS+
Sbjct: 242 GSA 244

>TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 5/54 (9%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFG 391
           C IC D M  S    V      M PCGH +H  C   + + +  CP C+  V  
Sbjct: 331 CPICGDYMFTSVKPVV-----YMSPCGHAIHQHCFDEYTRHSYKCPHCQVTVLN 379

>KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.628
           YDR265W
          Length = 309

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 21/56 (37%), Gaps = 10/56 (17%)

Query: 331 LDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICR 386
           + G    CT+C+  M                PCGH   + CL  W      CP+CR
Sbjct: 251 ISGPSRDCTLCLLPM----------TNPSCAPCGHTYCWDCLFKWCNERPECPLCR 296

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 2/26 (7%)

Query: 360  MLPCGHMLHFGCLKSWM--QRAQTCP 383
            +LPCGH  HF C++ W   +  Q CP
Sbjct: 1307 ILPCGHEGHFQCIQEWFLDENEQECP 1332

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 18/34 (52%)

Query: 358 AKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFG 391
           A++  C H     C+  W+ ++ +CP+CR  V  
Sbjct: 119 AELPHCNHKFDLECISVWLSKSTSCPLCRDDVMS 152

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 32.0 bits (71), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 8/59 (13%)

Query: 338 CTICMDDML-------PSKDVKVNNK-KAKMLPCGHMLHFGCLKSWMQRAQTCPICRFP 388
           C IC + ++       P      +N+  A    CGH  H  C+  W++    CP+   P
Sbjct: 48  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGACGHAFHLHCINKWIKTRDACPLDNQP 106

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 11/57 (19%)

Query: 329 GHLDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPIC 385
             LD + + C IC D +          K   + PCGH     C++ ++ R   CP+C
Sbjct: 20  SQLDAL-LRCHICKDFL----------KVPVLTPCGHTFCSICIREYINRQSKCPLC 65

>KAFR0H00710 Chr8 (132097..132783) [687 bp, 228 aa] {ON} Anc_3.405
           YPR093C
          Length = 228

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 8/53 (15%)

Query: 336 ITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ--TCPICR 386
           ++C IC++D+        N+  +++ PC H  H  C++ W   +    CP C+
Sbjct: 1   MSCPICLEDLAA------NDIISELKPCNHKYHLVCIRKWQLDSNQLKCPYCQ 47

>TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.157
           YHR115C
          Length = 885

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 13/69 (18%)

Query: 321 EKLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKS--WMQR 378
           + L  +T G L+G D  C+IC+  + P + + ++       PC H  HF C++    +Q 
Sbjct: 755 KNLQKMTLG-LEGDD--CSICLSKIKPCQAIFIS-------PCSHSWHFHCIRRLVMLQY 804

Query: 379 AQ-TCPICR 386
            Q  CP CR
Sbjct: 805 PQFVCPNCR 813

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 10/50 (20%)

Query: 336 ITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPIC 385
           + C IC D +          K   + PCGH     C++ ++Q    CP+C
Sbjct: 26  LRCHICKDFL----------KTPVLTPCGHTFCSVCIREYLQSNSKCPLC 65

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 2/26 (7%)

Query: 360  MLPCGHMLHFGCLKSWM--QRAQTCP 383
            +LPCGH  HF C++ W   ++ + CP
Sbjct: 1302 LLPCGHEGHFQCIQEWFLNEKERECP 1327

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 9/51 (17%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ--TCPICR 386
           C IC++ M  +        + ++LPC H  H  C++ W   +    CP CR
Sbjct: 5   CGICLESMNETD-------QGELLPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 10/53 (18%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ--TCPICRF 387
           TC+IC++         +     +++ C H  H  C++ W   +Q   CP CR 
Sbjct: 5   TCSICLE--------ALGQNIGRLVTCQHEYHLECIREWHNHSQDFKCPTCRV 49

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 5/53 (9%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           C IC + M  S    V      M PCGH +H  C   +++ +  CP C   V 
Sbjct: 371 CPICREYMFTSTMAVV-----YMDPCGHAIHQHCFDEYIKHSYKCPNCNVSVI 418

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 31.6 bits (70), Expect = 2.1,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 8/59 (13%)

Query: 338 CTICMDDML-------PSKDVKVNNK-KAKMLPCGHMLHFGCLKSWMQRAQTCPICRFP 388
           C IC + ++       P+     +N+  A    C H  H  C+  W+Q    CP+   P
Sbjct: 45  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNACPLDNQP 103

>Suva_2.481 Chr2 complement(853097..853960) [864 bp, 287 aa] {ON}
           YDR313C (REAL)
          Length = 287

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 8/64 (12%)

Query: 316 NRRLHEKLLDVTAGHLDGVDIT-CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKS 374
           NR L  K+  ++    + V+I  C IC +DM P +       K   L C  + H+ C+K+
Sbjct: 203 NRMLVYKIPPISTNDENHVEIKECPICFEDMEPGE-------KVGRLECLCVFHYKCIKN 255

Query: 375 WMQR 378
           W  +
Sbjct: 256 WFHK 259

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 32.0 bits (71), Expect = 2.2,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 8/59 (13%)

Query: 338 CTICMDDML-------PSKDVKVNNK-KAKMLPCGHMLHFGCLKSWMQRAQTCPICRFP 388
           C IC + ++       P+     +N+  A    C H  H  C+  W+Q    CP+   P
Sbjct: 72  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNACPLDNQP 130

>TPHA0A02850 Chr1 complement(616183..618708) [2526 bp, 841 aa] {ON}
           Anc_1.190 YJL157C
          Length = 841

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKS---WMQRAQTCPICRF 387
           C+IC + M     +K+N +K   L CGH+ H+ C  S      ++   P C F
Sbjct: 198 CSICEECM----SLKLNGEKVIELDCGHVSHYECYNSVFTSTSKSTKTPQCSF 246

>CAGL0L06336g Chr12 (715056..716858) [1803 bp, 600 aa] {ON} some
           similarities with uniprot|P32917 Saccharomyces
           cerevisiae YDR103w STE5 pheromone signal transduction
           pathway protein
          Length = 600

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 5/50 (10%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRF 387
           CT+C + +      K   +K   L CGHM H  CL  ++  +   PIC++
Sbjct: 40  CTLCDEPIA----YKSGGEKVIELECGHMCHMDCLMLFVN-STALPICKY 84

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} similar
            to uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1321

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 15/92 (16%)

Query: 303  CERC-VLLFNYWKNNRRLHEKLLDVTAG-------HLDGVDITCTICMDDMLPSKDVKVN 354
            C++C   L N     + + E+L   ++        + D      T+C     P K + ++
Sbjct: 1228 CDKCNKPLVNESSKEKIIKERLEGNSSAMSRFGYWYCDSCSKRNTLCCFCNKPMKSLAIS 1287

Query: 355  NKKAKMLPCGHMLHFGCLKSWM--QRAQTCPI 384
                 ML CGH  HF CLK W   +    CP+
Sbjct: 1288 -----MLNCGHEGHFECLKKWFFDENMDVCPL 1314

>NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 23/60 (38%), Gaps = 24/60 (40%)

Query: 344 DMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQT----------------CPICRF 387
           DM+PSK VK        LPC H  H  C+K W    +                 CP+CR 
Sbjct: 177 DMIPSKVVK--------LPCEHYFHKCCIKDWFSTIRKGMKSSTHSFAIGPTYFCPLCRL 228

>Kpol_339.6 s339 complement(10896..11825) [930 bp, 309 aa] {ON}
           complement(10896..11825) [930 nt, 310 aa]
          Length = 309

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 7/38 (18%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSW 375
           C IC +DM+P         K   L C  + H+ C+KSW
Sbjct: 251 CPICFEDMVPGD-------KVGRLECLCVFHYNCIKSW 281

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 12/24 (50%)

Query: 363 CGHMLHFGCLKSWMQRAQTCPICR 386
           C H     C+  W+    TCP+CR
Sbjct: 108 CSHKFDLQCISVWLSSNSTCPVCR 131

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 363 CGHMLHFGCLKSWMQRAQTCPICR 386
           C H     C+  W+ ++ TCP+CR
Sbjct: 70  CNHRFDLECISVWLSKSVTCPLCR 93

>CAGL0I09988g Chr9 complement(951638..952801) [1164 bp, 387 aa] {ON}
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054w
          Length = 387

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 32/88 (36%), Gaps = 24/88 (27%)

Query: 307 VLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHM 366
           ++L    K   ++  KLLD T          C+IC D M                 CGH 
Sbjct: 8   LVLHRSEKTKNKILSKLLDTT---------ICSICHDYMFV----------PMTTECGHS 48

Query: 367 LHFGCLKSWMQRAQ-----TCPICRFPV 389
             + CLK+W          +CP CR  V
Sbjct: 49  YCYTCLKTWFSSDTNRGGLSCPECRAIV 76

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 337 TCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQR-AQTCPICR 386
           +C IC +      +++V       L C H+ H  C+  W+ R +  CP+C+
Sbjct: 109 SCVICQEQFNELNNIRV-------LGCSHIFHSHCIDRWICRNSACCPLCK 152

>KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {ON}
           Anc_2.157 YHR115C
          Length = 551

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 41/106 (38%), Gaps = 22/106 (20%)

Query: 296 FIKSIETCERCVL----LFNYWKNNRRLHEK--------LLDVTAGHLDGVDITCTICMD 343
           F    E   RCV     L   WK       K        L  ++ G ++  +  C+IC+ 
Sbjct: 397 FRGGTEEIYRCVKMRVELNKSWKRKANAFNKEALKRIKHLQKISNGGVEQEEEDCSICLS 456

Query: 344 DMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ---TCPICR 386
            + P + + ++       PC H  HF C++  +  +     CP CR
Sbjct: 457 KIKPCQAIFIS-------PCSHSWHFHCVRRLVMLSYPQFVCPNCR 495

>SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {ON}
           similar to gnl|GLV|CAGL0J03586g Candida glabrata
           CAGL0J03586g and weakly similar to YCR066W
           uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 468

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 22/50 (44%), Gaps = 10/50 (20%)

Query: 336 ITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPIC 385
           + C +C D +          K   + PCGH     C++ ++ R   CP+C
Sbjct: 42  LRCHVCKDFL----------KTPVLTPCGHTFCSLCIREYLNRELKCPLC 81

>ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conserved
           hypothetical protein
          Length = 445

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 5/53 (9%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVF 390
           C IC D M  S    V      M PCGH +H  C +   + +  CP C+  V 
Sbjct: 220 CPICGDYMFTSTRPVV-----YMSPCGHAIHQHCFEEHTRHSYKCPHCQVTVL 267

>Kwal_27.10591 s27 complement(407375..410320) [2946 bp, 981 aa] {ON}
           YBL104C - Hypothetical ORF [contig 34] FULL
          Length = 981

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 343 DDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPI 384
           D++L S+ +K+N   +  L C H +H G    W ++   CP+
Sbjct: 931 DNILESRRLKLNEWFSFCLSCNHGMHAGHADEWFEKHLVCPV 972

>CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116w
          Length = 603

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 13/68 (19%)

Query: 322 KLLDVTAGHLDGVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ- 380
           KL  +T G  D  D  C+IC+  + P + + ++       PC H  HF C++  +  A  
Sbjct: 502 KLQKMTTGS-DEED--CSICLSKIKPCQAIFIS-------PCAHTWHFRCVRRLVMLAYP 551

Query: 381 --TCPICR 386
              CP CR
Sbjct: 552 QFVCPNCR 559

>KAFR0D04640 Chr4 complement(911653..912561) [909 bp, 302 aa] {ON}
           Anc_5.339 YDR313C
          Length = 302

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 7/43 (16%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ 380
           C IC ++M+P         K   L C  + H+ C+KSW  + Q
Sbjct: 244 CPICFEEMIPGD-------KVGRLECLCVFHYKCIKSWFNKRQ 279

>NCAS0F02770 Chr6 (558470..559303) [834 bp, 277 aa] {ON} Anc_5.339
           YDR313C
          Length = 277

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%), Gaps = 7/43 (16%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ 380
           C IC +DM      +V +K A+ L C  + H+ C+KSW+Q+ +
Sbjct: 210 CPICFEDM------EVGDKVAR-LECLCVFHYKCIKSWIQKKK 245

>NDAI0E04600 Chr5 (1039124..1042228) [3105 bp, 1034 aa] {ON} Anc_7.440
            YBL104C
          Length = 1034

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%)

Query: 328  AGHLDGVDITCTICMD--DMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCP 383
            A   +G D T ++  D  D L  K +++N   +  L C H +H G    W ++  TCP
Sbjct: 964  ANSENGNDNTKSVEPDNIDQLRRKKLRLNEWFSFCLSCNHGMHAGHSDEWFEKHSTCP 1021

>SAKL0G09284g Chr7 (795241..796131) [891 bp, 296 aa] {ON} similar to
           uniprot|Q6Q5S5 Saccharomyces cerevisiae YDR313C PIB1
           RING-type ubiquitin ligase of the endosomal and vacuolar
           membranes binds phosphatidylinositol(3)- phosphate
           contains a FYVE finger domain
          Length = 296

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 7/41 (17%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQR 378
           C IC ++MLP         K   L C  + H+ C+KSW ++
Sbjct: 238 CPICFEEMLPGD-------KVGRLECLCVFHYDCIKSWFRK 271

>NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1393

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 16/92 (17%)

Query: 303  CERCVLLFNYWKNNRRL-------HEKLLDVTAGH--LDGVDITCTICMDDMLPSKDVKV 353
            CE+C  L     + R+L       H+K +    G+   D      ++C+    P K + +
Sbjct: 1299 CEKCGALLMNEVSKRKLTMEAQQTHDKTVLGKFGYWYCDSCRKPNSLCVICECPMKKLTL 1358

Query: 354  NNKKAKMLPCGHMLHFGCLKSWM--QRAQTCP 383
                   L CGH  HF C K+W   +   TCP
Sbjct: 1359 T-----ALRCGHEAHFQCFKNWFLDEGMNTCP 1385

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 8/51 (15%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRA--QTCPICR 386
           C IC+ D    +     N       CGH  H  C++ W + +    CPICR
Sbjct: 4   CPICLADDQEGEQFGCLN------VCGHKFHLNCIREWHKYSINLKCPICR 48

>NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.157
           YHR115C
          Length = 518

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 10/52 (19%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQ---TCPICR 386
           C+IC+  + P + + ++       PC H  HF C++  +  +     CP CR
Sbjct: 429 CSICLSKIRPCQAIFIS-------PCAHSWHFHCIRRLVMLSYPQFVCPNCR 473

>TPHA0E01180 Chr5 (240374..241345) [972 bp, 323 aa] {ON} Anc_5.339
           YDR313C
          Length = 323

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 7/41 (17%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQR 378
           C IC + M P +       K   L C  + H+ C+KSWM++
Sbjct: 264 CPICFETMEPGE-------KIARLECLCVFHYTCIKSWMKK 297

>CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa]
           {ON} similar to uniprot|P10862 Saccharomyces cerevisiae
           YCR066w RAD18 DNA repair protein
          Length = 411

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 21/44 (47%)

Query: 342 MDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPIC 385
           +DD+L     K   K   + PCGH     C++ ++     CP+C
Sbjct: 21  LDDLLRCHICKDFLKNPVLTPCGHTFCSLCIRGYLSNEPKCPLC 64

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 6/56 (10%)

Query: 337 TCTIC---MDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQT---CPICR 386
            C IC    D   PS D   +     +  C H  H  C+K W+    +   CP+CR
Sbjct: 58  VCGICRNRYDATCPSCDYPGSGCPIVLGLCNHNFHVHCIKQWLSTETSKGLCPLCR 113

>YLR323C Chr12 complement(778173..778952) [780 bp, 259 aa] {ON}
           CWC24Spliceosome assembly factor, essential for the
           first step of splicing; component of the pre-catalytic
           spliceosome complex containing Cef1p; has similarity to
           S. pombe Cwf24p
          Length = 259

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 31/83 (37%), Gaps = 12/83 (14%)

Query: 313 WKNNRRLHEKLLDVTAGHLD--GVDITCTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFG 370
           WK N+  +    D  A  LD   +   CT+C +D           K   +  CGH     
Sbjct: 172 WKLNQEWNADKEDSKAVTLDLEKIPFKCTLCKEDY----------KSPVVTNCGHYFCGS 221

Query: 371 CLKSWMQRAQTCPICRFPVFGSS 393
           C    M++   C IC     GS+
Sbjct: 222 CFAKDMKKGTKCFICHKETHGSA 244

>KLLA0C14542g Chr3 (1272215..1273195) [981 bp, 326 aa] {ON} similar
           to uniprot|Q6Q5S5 Saccharomyces cerevisiae YDR313C PIB1
           RING-type ubiquitin ligase of the endosomal and vacuolar
           membranes binds phosphatidylinositol(3)- phosphate
           contains a FYVE finger domain
          Length = 326

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 7/41 (17%)

Query: 338 CTICMDDMLPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQR 378
           C IC ++M P +       K   L C  + H+ C+KSW ++
Sbjct: 261 CPICFEEMAPGQ-------KVGRLECLCVFHYHCIKSWFKK 294

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,570,521
Number of extensions: 2479364
Number of successful extensions: 13701
Number of sequences better than 10.0: 238
Number of HSP's gapped: 13879
Number of HSP's successfully gapped: 255
Length of query: 670
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 554
Effective length of database: 40,180,143
Effective search space: 22259799222
Effective search space used: 22259799222
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)