Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Ecym_30336.29ON1474147462740.0
ACL004W6.29ON1377109141550.0
SAKL0E01540g6.29ON1415107635590.0
KNAG0F029206.29ON1492128133570.0
Kwal_56.224626.29ON154193930980.0
ZYRO0C07524g6.29ON167099330870.0
KLLA0C06182g6.29ON151994330680.0
TDEL0G044006.29ON149095730670.0
KLTH0C10956g6.29ON143394230660.0
Kpol_1037.226.29ON149697129440.0
Skud_15.1586.29ON155594429080.0
Suva_15.1716.29ON156194428870.0
YOL004W (SIN3)6.29ON153695128810.0
Smik_15.1666.29ON156694628680.0
KAFR0A051206.29ON147997128300.0
TPHA0J004006.29ON151293328220.0
TBLA0E031606.29ON173986928160.0
NCAS0D021306.29ON143496427870.0
CAGL0E02475g6.29ON149398527120.0
NDAI0C026606.29ON165785926890.0
CAGL0J11594g6.29ON9373846093e-64
CAGL0L04928g2.610ON1024136763.6
KAFR0A04880na 1ON344107753.8
Suva_2.3288.351ON72468745.9
Suva_7.4775.190ON1950107747.0
Kpol_1025.354.128ON1184144747.5
Kpol_1064.538.403ON48969738.9
YDR014W (RAD61)3.235ON647355739.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Ecym_3033
         (1474 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  2421   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1605   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1375   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1297   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1197   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1193   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1186   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1186   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1185   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1138   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1124   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1116   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1114   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1109   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1094   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1091   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1089   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1078   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1049   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1040   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   239   3e-64
CAGL0L04928g Chr12 complement(560846..563920) [3075 bp, 1024 aa]...    34   3.6  
KAFR0A04880 Chr1 complement(964742..965776) [1035 bp, 344 aa] {O...    33   3.8  
Suva_2.328 Chr2 complement(576063..578237) [2175 bp, 724 aa] {ON...    33   5.9  
Suva_7.477 Chr7 complement(817323..823175) [5853 bp, 1950 aa] {O...    33   7.0  
Kpol_1025.35 s1025 complement(81457..85011) [3555 bp, 1184 aa] {...    33   7.5  
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    33   8.9  
YDR014W Chr4 (474046..475989) [1944 bp, 647 aa] {ON}  RAD61Subun...    33   9.2  

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 2421 bits (6274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1208/1474 (81%), Positives = 1208/1474 (81%)

Query: 1    MSQSWNXXXXXXXXXXXXXXXXXXXXXXXXKQHSDXXXXXXXXXXXXXXXXKRRSDGMKG 60
            MSQSWN                        KQHSD                KRRSDGMKG
Sbjct: 1    MSQSWNQHHQVDHVGGSGSVSGAGGQQPQGKQHSDQGQQGQLAVGGGGLLGKRRSDGMKG 60

Query: 61   HYTLPSISAGLPGSGEHQHQQHDGSRLPPMQNTLXXXXXXXXXXXXXXXXXVSNGFSMSS 120
            HYTLPSISAGLPGSGEHQHQQHDGSRLPPMQNTL                 VSNGFSMSS
Sbjct: 61   HYTLPSISAGLPGSGEHQHQQHDGSRLPPMQNTLAAAASAPPGGGGGGGGGVSNGFSMSS 120

Query: 121  LDNPLPXXXXXXXXXXXXXXXXXXXXXXXXXPAHQDGSSYRPLNVKDALSYLEQVKFQFN 180
            LDNPLP                         PAHQDGSSYRPLNVKDALSYLEQVKFQFN
Sbjct: 121  LDNPLPQQEFQEQSQHQQQQHHHHQLDQLQSPAHQDGSSYRPLNVKDALSYLEQVKFQFN 180

Query: 181  SRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQGYNIECSSDP 240
            SRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQGYNIECSSDP
Sbjct: 181  SRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQGYNIECSSDP 240

Query: 241  NDPIKVTTPFXXXXXXXXXXXXXXXXXXXXXPRAEPXXXXXXXXXXPATVXXXXXXXXXX 300
            NDPIKVTTPF                     PRAEP          PATV          
Sbjct: 241  NDPIKVTTPFGTTGEVAIGGGGGSGVCGHVVPRAEPLQQQLRQHQQPATVAEAAAAAAAA 300

Query: 301  XXXXXXXXXXXXXPPPQAQTLVVYQSTDGSPTMPQRQPQDQFGTGGKKTGDVEFSHAISY 360
                         PPPQAQTLVVYQSTDGSPTMPQRQPQDQFGTGGKKTGDVEFSHAISY
Sbjct: 301  AGGGGGGAIAGGGPPPQAQTLVVYQSTDGSPTMPQRQPQDQFGTGGKKTGDVEFSHAISY 360

Query: 361  VNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNXXXXXXXXXXXXXXX 420
            VNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN               
Sbjct: 361  VNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDA 420

Query: 421  SAPQAQQQHLAQSHPQLNGALTPSSFYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 480
            SAPQAQQQHLAQSHPQLNGALTPSSFY                                 
Sbjct: 421  SAPQAQQQHLAQSHPQLNGALTPSSFYHSQQQQGPQPQQDQSQSQHPVQQQQQQQQQQQQ 480

Query: 481  XXXXXXXNLPPLGSFSTPGDHHPMNLPLVQAPNMNLNQGHPAHIITQGMSNQKIPISDLR 540
                   NLPPLGSFSTPGDHHPMNLPLVQAPNMNLNQGHPAHIITQGMSNQKIPISDLR
Sbjct: 481  QTVIHQQNLPPLGSFSTPGDHHPMNLPLVQAPNMNLNQGHPAHIITQGMSNQKIPISDLR 540

Query: 541  TTADTSYRPAEYSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFD 600
            TTADTSYRPAEYSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFD
Sbjct: 541  TTADTSYRPAEYSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFD 600

Query: 601  KAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKP 660
            KAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKP
Sbjct: 601  KAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKP 660

Query: 661  KHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWAS 720
            KHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWAS
Sbjct: 661  KHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWAS 720

Query: 721  EDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFK 780
            EDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFK
Sbjct: 721  EDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFK 780

Query: 781  LPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQR 840
            LPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQR
Sbjct: 781  LPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQR 840

Query: 841  EWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPK 900
            EWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPK
Sbjct: 841  EWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPK 900

Query: 901  AKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIE 960
            AKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIE
Sbjct: 901  AKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIE 960

Query: 961  KALAKRDAAXXXXXXXXXXXXXXXKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGG 1020
            KALAKRDAA               KQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGG
Sbjct: 961  KALAKRDAASSSQSSNSNTETYSEKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGG 1020

Query: 1021 RNSPRGDSSISAXXXXXXXXXXXXXXXAKNPWLLGSIVDEADNHGHVENRKTFNLFANTN 1080
            RNSPRGDSSISA               AKNPWLLGSIVDEADNHGHVENRKTFNLFANTN
Sbjct: 1021 RNSPRGDSSISAEKESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRKTFNLFANTN 1080

Query: 1081 IYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDA 1140
            IYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDA
Sbjct: 1081 IYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDA 1140

Query: 1141 YEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTV 1200
            YEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTV
Sbjct: 1141 YEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTV 1200

Query: 1201 EIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLT 1260
            EIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLT
Sbjct: 1201 EIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLT 1260

Query: 1261 LEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXXXXXXXXXXXXXXXXXYSPEGV 1320
            LEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFL                 YSPEGV
Sbjct: 1261 LEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLEKIIESEEDIIEDKDEKYSPEGV 1320

Query: 1321 ATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVDIRXXXXXXXXXXXXRFLNSNS 1380
            ATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVDIR            RFLNSNS
Sbjct: 1321 ATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVDIRKKKSSELKLELERFLNSNS 1380

Query: 1381 GWKKDLSAKQIAEVEKRLEFVKLNGNLEEYXXXXXXXXXXXXXXXXLAKEDIARSQSEST 1440
            GWKKDLSAKQIAEVEKRLEFVKLNGNLEEY                LAKEDIARSQSEST
Sbjct: 1381 GWKKDLSAKQIAEVEKRLEFVKLNGNLEEYSDDSAVASTSAVSGSDLAKEDIARSQSEST 1440

Query: 1441 VVSASMATCAQSTLKTEKDKPDSTFTATNNAESN 1474
            VVSASMATCAQSTLKTEKDKPDSTFTATNNAESN
Sbjct: 1441 VVSASMATCAQSTLKTEKDKPDSTFTATNNAESN 1474

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1605 bits (4155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 789/1091 (72%), Positives = 868/1091 (79%), Gaps = 30/1091 (2%)

Query: 322  VVYQSTDGSPTM--PQRQPQDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFL 379
             VY+S +GSP         Q+Q+GTG KK GDVEFSHAISYVNKIKTRFA+QPDIYKHFL
Sbjct: 252  TVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFL 311

Query: 380  EILQTYQREQKPINEVYAQVTVLFQNXXXXXXXXXXXXXXXSAPQAQQQHLAQSHPQLNG 439
            EILQTYQREQKPINEVYAQVTVLFQN               SAPQ Q      SH Q+NG
Sbjct: 312  EILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSAPQLQ------SHQQING 365

Query: 440  ALTPSSFYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLPPLGSFSTPG 499
            A+    F                                         NLPPLG+FSTPG
Sbjct: 366  AMVAPGF--------------------GHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPG 405

Query: 500  DHHPMNLPLVQAPNMNLNQGHPAHIITQGMSNQKIPISDLRTTADTSYRPAEYSQGQDTQ 559
            DHHPM+LP VQ PN+ L+QG   HI+TQG+SNQ IP+SDLR   D S+R +EY+Q QD Q
Sbjct: 406  DHHPMSLPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEYNQVQDVQ 465

Query: 560  YMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKIL 619
            YME   RPEIDLDPSLVPVIPEPIKPLEDELNLVEEA+FFDKAKK+IGNKQIYTEFLKIL
Sbjct: 466  YMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKIL 525

Query: 620  NLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCE 679
            NLYSQDLL+KE+LVE V HYLSG PELFDWFKSFVGYQE+PKHIEN++HEKHRLDLDLCE
Sbjct: 526  NLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCE 585

Query: 680  ACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFK 739
            ACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFK
Sbjct: 586  ACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFK 645

Query: 740  IEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRK 799
            IEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKA FKLPPGLGHTSVTIYKKVIRK
Sbjct: 646  IEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRK 705

Query: 800  VYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 859
            VYDKDRG+EIIDALHE+PAITVP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVF+KSLD
Sbjct: 706  VYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLD 765

Query: 860  HLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDIL 919
            HLGLTFKQADKKLLTAKQLISEISSIKVDQ+NKRIHPLTPKAKSQL +DF +PEVF DIL
Sbjct: 766  HLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDIL 825

Query: 920  NLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRDAAXXXXXXXXXX 979
            +L +VFL NNNTYS  D ERLKDFFKGFISLF SYP+ +IE+ L KR  +          
Sbjct: 826  SLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKR--SSQNGTISHGD 883

Query: 980  XXXXXKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGGRNSPRGDSSISAXXXXXXX 1039
                 K+    +    +KR R+D++ LLRD+L+RNKQQK  +      SS          
Sbjct: 884  DTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVNKGPQNDQSSEEFEKESDIE 943

Query: 1040 XXXXXXXXAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVK 1099
                    AK PWLLGSIVDEADNHGHV +R TFN+FANTNIYVFFRHL T+YERLVEVK
Sbjct: 944  EKEIVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVK 1003

Query: 1100 KMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQ 1159
            K+N EVTKEI+NRKVVQFAKDLNLISTQLTDMGLDFKG DAYE+LL+LSRSLI+G+LEHQ
Sbjct: 1004 KINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQ 1063

Query: 1160 WFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKD 1219
            WFEESLRQAYKNKAFK+YT+DKVIQALVKHAH I+ D+KTVEIM+LF+ DRTS STSTKD
Sbjct: 1064 WFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKD 1123

Query: 1220 QILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYS 1279
            QILYRLQVRSNMSNIENMFRIEYN  T+H  IQFVAV+DLTL+EPKSL+DKWQYYLTSYS
Sbjct: 1124 QILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYS 1183

Query: 1280 LSHPTEGISHDNLRSPFLXXXXXXXXXXXXXXXXXYSPEGVATSNLKVKIDPITYSMEVE 1339
            LSHPTEGISHDNLR+PFL                 YSPEGVA+SN+KVKIDP+TYSMEVE
Sbjct: 1184 LSHPTEGISHDNLRTPFLEKIIERDEGYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVE 1243

Query: 1340 FGSHDIFSRKAVNKFPVRVDIRXXXXXXXXXXXXRFLNSNSGWKKDLSAKQIAEVEKRLE 1399
             G HDIFSRK+VNKFP RVD++             FLN   GWK+ L+ K+ AE E+RLE
Sbjct: 1244 PGCHDIFSRKSVNKFPTRVDVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLE 1303

Query: 1400 FVKLNGNLEEY 1410
            +VK NG L++Y
Sbjct: 1304 YVKNNGTLDDY 1314

 Score =  243 bits (619), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 127/200 (63%), Positives = 139/200 (69%), Gaps = 25/200 (12%)

Query: 52  KRRSDGMKGHYTLPSISA-GLPGSGEHQHQQHDGSRLPPMQNTLXXXXXXXXXXXXXXXX 110
           +R S+G+K HYTLPSISA GLPG+GE     H GSRLPPMQN L                
Sbjct: 44  RRGSEGLKTHYTLPSISAAGLPGAGE----PHGGSRLPPMQNALGVGGGGPGS------- 92

Query: 111 XVSNGFSMSSLDNPLPXXXXXXXXXXXXXXXXXXXXXXXXXPAHQDGSSYRPLNVKDALS 170
            ++NGF++  L+  +P                         PA QDGS+YRPLNVKDALS
Sbjct: 93  -IANGFAVGRLEGAVPVSGTGGPGSPGPQV-----------PA-QDGSAYRPLNVKDALS 139

Query: 171 YLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQ 230
           YLEQVKFQF+SRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF GYP LIQGFNTFLP 
Sbjct: 140 YLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTFLPH 199

Query: 231 GYNIECSSDPNDPIKVTTPF 250
           GYNIEC SDPNDPIKVTTPF
Sbjct: 200 GYNIECPSDPNDPIKVTTPF 219

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ  P L+  F  F
Sbjct: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 348

Query: 228 LP 229
           LP
Sbjct: 349 LP 350

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 32/49 (65%)

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LF  
Sbjct: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHG 185

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648
           LN+ +  S+ ++ K ++     +Y  FL I+  +    +D   ++E+V     G P L  
Sbjct: 132 LNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQ 191

Query: 649 WFKSFV--GY 656
            F +F+  GY
Sbjct: 192 GFNTFLPHGY 201

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1375 bits (3559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/1076 (65%), Positives = 810/1076 (75%), Gaps = 70/1076 (6%)

Query: 346  GKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405
             KK GDVEFSHAISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN
Sbjct: 333  AKKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 392

Query: 406  XXXXXXXXXXXXXXXSAPQAQQQHLAQSHPQLNGALTPSSFYXXXXXXXXXXXXXXXXXX 465
                           SAPQ+       +   +NG     +FY                  
Sbjct: 393  APDLLDDFKKFLPDASAPQS-----TTTPAPVNGG----TFYPQAAPQQ----------- 432

Query: 466  XXXXXXXXXXXXXXXXXXXXXXNLPPLGSF-------STPGDHHPMNLPLVQAPNMNLNQ 518
                                  NLPPLGSF       +  G+H  + LP VQ P+M+++ 
Sbjct: 433  ----------------------NLPPLGSFSPPSSGSAREGEH--VGLPAVQPPSMDISG 468

Query: 519  GHPAHIITQGMSNQKIPISDLRTTADTSYRPAEYSQGQDTQYMETNARPEIDLDPSLVPV 578
                HIITQGMSN  IPIS++R TAD +YR    + G+  QYME  ARPEIDLDPSLVPV
Sbjct: 469  QPQQHIITQGMSNDDIPISEVRNTADGAYRSDLRNSGE-VQYMEPVARPEIDLDPSLVPV 527

Query: 579  IPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGH 638
            IPEPI+P+E+E++LVEE SFFDKAKK+IGNKQIYTEFLKILNLYSQDLLD++ LVEKV +
Sbjct: 528  IPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVEY 587

Query: 639  YLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCS 698
            YL G  ELFDWFK+FVGY++KPKHIENIVHEKHRLDLDLCEACGPSYK+LPKADTFMPCS
Sbjct: 588  YLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPCS 647

Query: 699  GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTI 758
            GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIEANLRTI
Sbjct: 648  GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRTI 707

Query: 759  QTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPA 818
            QTLETIANKIANMTPEEKATFKL PGLGHTSVTIYKKVIRKVYDKDRG+EIIDALHE P+
Sbjct: 708  QTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETPS 767

Query: 819  ITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQL 878
            I VPIVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQL
Sbjct: 768  IAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQL 827

Query: 879  ISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKE 938
            +SEIS+IKVDQ NKRIHPLTPK KSQLD+ F D EV YDILNLA VF++ N TYS PDKE
Sbjct: 828  VSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDKE 887

Query: 939  RLKDFFKGFISLFCSYPVPQIEKALAKRDAAXXXXXXXXXXXXXXXKQQEDGDMKLPKKR 998
            ++ DF K F+ LF SYP+ ++E A A+R                    QE+ D  L +KR
Sbjct: 888  KMFDFLKSFLVLFFSYPMYEVETAFARRRG------DIGVQDGEENSGQENSD--LSRKR 939

Query: 999  NREDSDRLLRDVLFRNKQQKGGRN-----SPRGDSSISAXXXXXXXXXXXXXXXAKNPWL 1053
             RE+ + LL+DVL RNK QK GRN         +S  +                AK PWL
Sbjct: 940  TREE-ENLLKDVLRRNKYQK-GRNFAEEEPIPEESEFAEKTVEEKEEEEIIRQEAKKPWL 997

Query: 1054 LGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRK 1113
            LGSIVDEA+ HG VENRKTFN+FANTNIYVFFRHLAT+Y RL EVK +N+ VT+EI NRK
Sbjct: 998  LGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKNRK 1057

Query: 1114 VVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKA 1173
            VVQFAKDLNLISTQL+DMGLDF+G DAY ++L LS+ LI GD+EHQWFEESLRQAYKNKA
Sbjct: 1058 VVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKNKA 1117

Query: 1174 FKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSN 1233
            FKIYT+DKV+Q+LVKHAH IITD KTVEIM+LFEKDRT L+TS K+QILYRLQVRS+M+ 
Sbjct: 1118 FKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHMTT 1177

Query: 1234 IENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLR 1293
             ENMFRIEYNR + H  IQFVAVDDLTLEEPKSL+D+W+YY+TSYSLSHPTEGISH+ L+
Sbjct: 1178 AENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEELQ 1237

Query: 1294 SPFLXXXXXXXXXXXXXXXXXYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNK 1353
             PF                  YSPEGV++SNLKVKI+P TYS++V+ GS+D FSRK++NK
Sbjct: 1238 PPF-LEKILEKEEEFQCENGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSINK 1296

Query: 1354 FPVRV--DIRXXXXXXXXXXXXRFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGNL 1407
            FP+ +  D               +LN   GWK+ L A ++ + +  +E+VK  G L
Sbjct: 1297 FPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTKGTL 1352

 Score =  191 bits (485), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 102/138 (73%), Gaps = 8/138 (5%)

Query: 115 GFSMSSLDNPLPXXXXXXXXXXXXXXXXXXXXXXXXXPAHQDGSSYRPLNVKDALSYLEQ 174
           GFS++SL+NPLP                         P      SYRPLNVKDALSYLEQ
Sbjct: 119 GFSVASLNNPLPEQQQQQQQQQQQQQQQQQQQQQPQDP------SYRPLNVKDALSYLEQ 172

Query: 175 VKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQGYNI 234
           VKFQFN+RPDVYNHFLDIMKDFKSQAIDTPGVIERVS LFQGYP LIQGFNTFLPQGY I
Sbjct: 173 VKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYPNLIQGFNTFLPQGYKI 232

Query: 235 ECSSDPND--PIKVTTPF 250
           ECSS+PND  PIKVTTPF
Sbjct: 233 ECSSNPNDPHPIKVTTPF 250

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 9/82 (10%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ  P L+  F  F
Sbjct: 344 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 403

Query: 228 LPQGYNIECSSDPNDPIKVTTP 249
           LP         D + P   TTP
Sbjct: 404 LP---------DASAPQSTTTP 416

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 33/48 (68%)

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 404
           A+SY+ ++K +F ++PD+Y HFL+I++ ++ +      V  +V+ LFQ
Sbjct: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

 Score = 36.6 bits (83), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 582 PIKPLEDELNLVEEASFFDKAKKYIGNK-QIYTEFLKILNLYSQDLLDKERLVEKVGHYL 640
           P  P    LN+ +  S+ ++ K    N+  +Y  FL I+  +    +D   ++E+V +  
Sbjct: 153 PQDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLF 212

Query: 641 SGCPELFDWFKSFV--GYQ 657
            G P L   F +F+  GY+
Sbjct: 213 QGYPNLIQGFNTFLPQGYK 231

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1297 bits (3357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/1281 (54%), Positives = 829/1281 (64%), Gaps = 109/1281 (8%)

Query: 158  SSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGY 217
            S YRPLNVKDALSYLEQVK QFNSRP +YN FLDIMKDFKSQ IDTPGVIERVSTLF+G+
Sbjct: 216  SPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGF 275

Query: 218  PTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPFXXXXXXXXXXXXXXXXXXXXXPRAEPX 277
            P LIQGFNTFLPQGY IECSS+PN+PIKVTTP                         +P 
Sbjct: 276  PALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDITADQ---------QPA 326

Query: 278  XXXXXXXXXPATVXXXXXXXXXXXXXXXXXXXXXXXPPPQAQTLVVYQSTDGSPTMPQRQ 337
                     P                          PPPQ+  L +  ST  + T  Q+ 
Sbjct: 327  IGQLPTTQSPIQASL---------------------PPPQSAHLHL-PSTVAAATTVQQS 364

Query: 338  PQDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYA 397
                     KK  DVEFS AISYVNKIK RF+DQPDIYK+FLEILQTYQREQKPINEVYA
Sbjct: 365  ANVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQKPINEVYA 424

Query: 398  QVTVLFQNXXXXXXXXXXXXXXXSAPQAQQQHLAQSHPQLNGALTPSSFYXXXXXXXXXX 457
            QVTVLF N               SA   QQ   +   PQ+      +  Y          
Sbjct: 425  QVTVLFHNAPDLLDDFKKFLPDSSASNEQQPKQSPYSPQVYSGADMARGYMYNNTGVYYP 484

Query: 458  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLPPLGSFSTP--GDHHPMNLPLVQAPNMN 515
                                          NLPP+GSFS P  G        +  A   +
Sbjct: 485  PQVNQPQS----------------------NLPPIGSFSPPANGVAPTTGTAIPHADEQH 522

Query: 516  LNQGHPAHI------ITQGMSNQKIPISDLRTTADTS-------YRPAEYSQGQDTQYM- 561
            +  G PA            ++N  I IS++R               P +Y+Q Q  Q   
Sbjct: 523  VVAGVPAMAPHEQQHAPSMINNDGIQISNMRGGGTVPALNQYGMISPHDYTQQQAKQVQQ 582

Query: 562  ----------------------ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFF 599
                                  +   RPEIDLDPS+VPV+PEP +P+E+ L+L EE SFF
Sbjct: 583  FQEDQQQQQQQSMMMDEQYGSGDMQVRPEIDLDPSIVPVVPEPTEPIENNLSLSEETSFF 642

Query: 600  DKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEK 659
            +K KK IGN+QIY EFLK+LNL+SQDL+  + LV KV +YL+G PELF+WFK+FVGYQ+K
Sbjct: 643  EKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPELFEWFKNFVGYQDK 702

Query: 660  PKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWA 719
            PK IEN++HEKHRLDLDLCEA GPSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWA
Sbjct: 703  PKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWA 762

Query: 720  SEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATF 779
            SEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQTLETIA+KIANMT EEK  F
Sbjct: 763  SEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKNMF 822

Query: 780  KLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQ 839
            KLPPGLGHTS+TIYKK+IRKVYDK+RG+EIID LHE+PAITVPIVLKRLKQKDEEWRRAQ
Sbjct: 823  KLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLKRLKQKDEEWRRAQ 882

Query: 840  REWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTP 899
            REWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQNNKR+H LTP
Sbjct: 883  REWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQNNKRMHWLTP 942

Query: 900  KAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQI 959
            K K QLD+ F D ++ +DI+ L  VF+++ +TYS PDKERLKD F+ FISLF   P   I
Sbjct: 943  KPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRVFISLFFFIPRDLI 1002

Query: 960  EKAL-AKRDAAXXXXXXXXXXXXXXXKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQK 1018
              AL  K D                 ++ +D      KKR R D +  L D+L R K QK
Sbjct: 1003 SAALDTKSDEG--------KSTDTKFEKADDS-----KKRPRPDVELSLSDILHRAKYQK 1049

Query: 1019 GGRNSPRGDSSISAXXXXXXXXXXXXXXXAKNPWLLGSIVDEADNHGHVENRKTFNLFAN 1078
                   G S                   A  PWL+G IV+ A++HG V +R  +NLF N
Sbjct: 1050 LKNGEGLGMSEDDDEEKLAKEAEEMSEKNASKPWLVGDIVERANSHGLVTDRAVYNLFGN 1109

Query: 1079 TNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGE 1138
            TN+Y+F RH +T+Y RL+E+K+M++ VTKEI NRKVVQFA+DLNL+STQL DMGLDF G+
Sbjct: 1110 TNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGK 1169

Query: 1139 DAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNK 1198
            +AY++ L+LS+ LI  +LEHQWFEESLRQAY NKAFK+YTVDKV+ +LVKHAH ++TDNK
Sbjct: 1170 NAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNK 1229

Query: 1199 TVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDD 1258
            + E+M LFEKDR   ST  KDQILYRL  RS+MS+ ENMFR++YN+ T HV IQ++ +DD
Sbjct: 1230 SSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDD 1289

Query: 1259 LTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXXXX--XXXXXXXXXXXXXYS 1316
            +TLE+ K   ++W YY+TSY+L HPTEGI  D L  PFL                   Y+
Sbjct: 1290 VTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYN 1349

Query: 1317 PEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVDIR--XXXXXXXXXXXXR 1374
            P G + S LK+ IDP TY + ++ GS+DIFSR ++N++P+R D +              +
Sbjct: 1350 PVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQK 1409

Query: 1375 FLNSNSGWKKDLSAKQIAEVE 1395
            FL+   GWKKDLS   I  VE
Sbjct: 1410 FLDGRFGWKKDLSDDVINTVE 1430

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 9/83 (10%)

Query: 579 IPEPIKPL--EDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKV 636
           I  P +PL  +D L+ +E+      ++ YI     Y +FL I+  +    +D   ++E+V
Sbjct: 214 IDSPYRPLNVKDALSYLEQVKLQFNSRPYI-----YNQFLDIMKDFKSQNIDTPGVIERV 268

Query: 637 GHYLSGCPELFDWFKSFV--GYQ 657
                G P L   F +F+  GY+
Sbjct: 269 STLFKGFPALIQGFNTFLPQGYR 291

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1197 bits (3098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/939 (63%), Positives = 706/939 (75%), Gaps = 43/939 (4%)

Query: 488  NLPPLGSFSTP----GDHHPMNLPLVQAPNMNL-----NQGHPAHIITQGMSNQKIPISD 538
            NLPPLG+FS P     +   +NLP VQ P ++      +Q H  H++ QGM+N  +P+SD
Sbjct: 579  NLPPLGNFSPPINGRDNEAQVNLPAVQPPALDFPPQQQSQSH-RHVVAQGMTNNSLPVSD 637

Query: 539  LRTTADTSYRPAE-YSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEAS 597
            +R   D  + P   YSQ  D QYME  +RPEIDLDPSLVPVIPEPI+PLE++  L+EE S
Sbjct: 638  MRGPVDGGFAPQPLYSQ--DVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETS 695

Query: 598  FFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQ 657
            FFDKAKKY+GNKQ+YTEFLKILNL+SQDL+D + LV+KV HYL G  ELFDWFKSFV Y 
Sbjct: 696  FFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYV 755

Query: 658  EKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPV 717
            E+PKHIEN+VHEKHRLDLDLCEAC PSYK+LPKADTFMPC GRDEMCWEVLNDEWVGHPV
Sbjct: 756  ERPKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPV 815

Query: 718  WASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKA 777
            WASEDSGFIAHRKNQYE+TLFKIEEERHEYD+YIEANLRTIQ LETIANKI+NMT EEK 
Sbjct: 816  WASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKK 875

Query: 778  TFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRR 837
            TFKLPPGLGHTS TIYKKVIRKVYDKDRG+EIIDALHE PA++VPIVL+RLKQKDEEWRR
Sbjct: 876  TFKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRR 935

Query: 838  AQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPL 897
            AQREWNKVWRELEQKVF+KSLDHLGLTFKQADKKLLTAKQLISEISSIK+DQ NKRI+P 
Sbjct: 936  AQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPF 995

Query: 898  TPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVP 957
            T K KSQLD D +D  V +DILNL   F++++ TYS PDKE+L  FF+GF+S+F S P+ 
Sbjct: 996  TSKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLT 1055

Query: 958  QIEKALAKRDAAXXXXXXXXXXXXXXXKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQ 1017
             ++    +                      E+GD    +KR+R+D D+  RD+L    +Q
Sbjct: 1056 DLDNPSEEHKV-------------------ENGDST--RKRSRDD-DQFFRDLLKSKHKQ 1093

Query: 1018 KGGRNSPRGDSSIS------AXXXXXXXXXXXXXXXAKNPWLLGSIVDEADNHGHVENRK 1071
               + S + D S S      A               AK PWLLG+I+DEA+NHG V NRK
Sbjct: 1094 AKKKTSQQEDESTSDDQDTAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRK 1153

Query: 1072 TFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDM 1131
            T+N+FANTNIYVFFRHL T+Y+RL E K +N+EVTKEI +RKVVQFAKDLNL STQL+DM
Sbjct: 1154 TYNMFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDM 1213

Query: 1132 GLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAH 1191
            GLDFKG DAYE+LL L + LI  D+EHQWFEESLRQAYKNKAFKIYTVDKVIQ+LVKHAH
Sbjct: 1214 GLDFKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAH 1273

Query: 1192 AIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCI 1251
            +IITD KT EIM+LFEKDR + +TST++QILYRLQVRS M   ENMFRIE N  +AHV I
Sbjct: 1274 SIITDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSI 1333

Query: 1252 QFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXXXXXXXXXXXXXX 1311
            QFVAVDDLTL +P SLKD+WQYYLTSYSLSHPTEG+ H+ +++PFL              
Sbjct: 1334 QFVAVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFL-EKTLRDDGDSDED 1392

Query: 1312 XXXYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRV-DIRXXXXXXXXX 1370
               YSP G + S L+++I+P +Y++++E  S D+F+R  VNK P ++ +           
Sbjct: 1393 SEWYSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQK 1452

Query: 1371 XXXRFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGNLEE 1409
                 +NS  GWKK L  + I + E  + FVK  G LE+
Sbjct: 1453 SLADMVNSEHGWKKGLQNESIGKAESIINFVKARGFLEK 1491

 Score =  186 bits (471), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/192 (54%), Positives = 119/192 (61%), Gaps = 15/192 (7%)

Query: 61  HYTLPSISAGLPGSGEHQHQQHDGSRLPPMQNTLXXXXXXXXXXXXXXXXXVSNGFSMSS 120
           H  LPS+S GL   G  ++      RLP MQ                     S GFS++S
Sbjct: 163 HVVLPSLS-GLETGGRAEYGA-SAQRLPFMQGAAPQSASSGG----------SKGFSVAS 210

Query: 121 LDNPLPXXXXXXXXXXXXXXXXXXXXXXXXXPAHQDGSSYRPLNVKDALSYLEQVKFQFN 180
           L+NPLP                            QD +SYRPLN KDALSYLEQVKFQFN
Sbjct: 211 LNNPLPMQQQQQQQQQQQQQQQLLQQGVLPLEHVQD-ASYRPLNFKDALSYLEQVKFQFN 269

Query: 181 SRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQGYNIECSSDP 240
           +RPDVYNHFLDIMKD+KSQAIDT GVIER+STLF+GYP LIQG NTFLPQGY IEC+S+P
Sbjct: 270 NRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPVLIQGLNTFLPQGYKIECTSNP 329

Query: 241 NDP--IKVTTPF 250
           +DP  IKVTTPF
Sbjct: 330 HDPHSIKVTTPF 341

 Score =  113 bits (283), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 53/59 (89%), Positives = 55/59 (93%)

Query: 347 KKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405
           +  GDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI+EVY QVT LFQN
Sbjct: 435 RPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQN 493

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V++LFQ  P L+  F  F
Sbjct: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKF 504

Query: 228 LP 229
           LP
Sbjct: 505 LP 506

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 35/54 (64%)

Query: 352 VEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+ 
Sbjct: 252 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 305

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1193 bits (3087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/993 (61%), Positives = 717/993 (72%), Gaps = 79/993 (7%)

Query: 488  NLPPLGSFSTPGD-----------HHPMNLPLVQAPNMNLNQGHPAH-IITQGMSNQKIP 535
            NLPPLGSFS P +              M LP +        +  P+H ++TQGMSN  IP
Sbjct: 628  NLPPLGSFSPPPNGTAPRDYYQEPSQGMALPPMTHLETQAAKVTPSHYVMTQGMSNDAIP 687

Query: 536  ISDLR----------TTADTS--------------------------------------Y 547
            +S++R          T  +T+                                       
Sbjct: 688  LSNMRSPTVGAPGAQTPVETAPQHPQQYSPQQAPQPQLPQQQLPPQQQEQSLPPQTIPLT 747

Query: 548  RPAEYSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIG 607
            +P++    Q+ QY++   RPEIDLDPS+VPV+PEP +P+ED L+LVEE SFFDKAKK+IG
Sbjct: 748  QPSQLGPQQEVQYVDIAVRPEIDLDPSIVPVVPEPTEPIEDSLSLVEETSFFDKAKKFIG 807

Query: 608  NKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIV 667
            NKQ+YTEFLKILNLYSQDLLD + LVEKV HYL G  ELF WFK+FVGYQ++PK+IEN++
Sbjct: 808  NKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVI 867

Query: 668  HEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIA 727
            HEKHRLDLD+CEA GPSYK+LPK+DTFMPCSGRDEMCWEVLNDEW+GHPVWASEDSGFIA
Sbjct: 868  HEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIA 927

Query: 728  HRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGH 787
            HRKNQYE+TLFK+EEERHEYDFYIE+NLRTIQTLETIA+KIANMT EEKA FKLPPGLGH
Sbjct: 928  HRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMTEEEKANFKLPPGLGH 987

Query: 788  TSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWR 847
            TS+TIYKKVIRKVYDK+RG+EIIDALHE+PA+ VP+VLKRLKQKDEEWRRAQREWNKVWR
Sbjct: 988  TSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWR 1047

Query: 848  ELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDH 907
            ELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ NKRIH LTPK KSQLD+
Sbjct: 1048 ELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDY 1107

Query: 908  DFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRD 967
            DF D E+F DIL+L  VFL +   YS  DKERLKDF K F+SLF S PV ++   L +R 
Sbjct: 1108 DFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFFSIPVSEVNDGLRRRS 1167

Query: 968  AAXXXXXXXXXXXXXXXKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGGRNSPRGD 1027
             +                ++E+G      KR RE  +  LRD+L RNK QK    S   +
Sbjct: 1168 PS--------NKEEHEANKKENGTALAHGKRPRE-IELPLRDILHRNKYQKLKLRSDGEE 1218

Query: 1028 SSISAXXXXXXXXXXXX------XXXAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNI 1081
             SI                       AK PWLLG+IV+EA+  G + NRK+FNLFANT+I
Sbjct: 1219 GSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANAQGIISNRKSFNLFANTSI 1278

Query: 1082 YVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAY 1141
            YVFFRHL T+YERL+EVK ++ EVT+EI +RKV QFAKDLNLIS QL +MGLDF G DAY
Sbjct: 1279 YVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMGLDFAGLDAY 1338

Query: 1142 EKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVE 1201
            E+LL LS+ LI GD+EHQWFEESLRQAY N+AFK YTVDKV+QALVKHAH I+TD K  E
Sbjct: 1339 EQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHTILTDIKCSE 1398

Query: 1202 IMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTL 1261
            IM+LFEKDRT  +TS KDQILYR+Q RS+MSN ENMFRIE+NR++ HVCIQ++A+DDLTL
Sbjct: 1399 IMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQYIAIDDLTL 1458

Query: 1262 EEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXXXXXXXXXXXXXXXX--XYSPEG 1319
             E KSL+DKW+YY+TSYSLSHPTEGISH++L+ PFL                   +SPEG
Sbjct: 1459 AEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNGGDPKFSPEG 1518

Query: 1320 VATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVR--VDIRXXXXXXXXXXXXRFLN 1377
            V+ S+L++KIDP TY +EVE GS D+FSRKAVNKFP+    +               +L+
Sbjct: 1519 VSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKKNELIRGYLD 1578

Query: 1378 SNSGWKKDLSAKQIAEVEKRLEFVKLNGNLEEY 1410
            S  GWKK+L AK I  VE++L FVK  G L+ Y
Sbjct: 1579 SEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGY 1611

 Score =  181 bits (460), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 82/91 (90%), Positives = 87/91 (95%)

Query: 160 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPT 219
           YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF+GYP 
Sbjct: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336

Query: 220 LIQGFNTFLPQGYNIECSSDPNDPIKVTTPF 250
           LIQGFNTFLPQGY I+CS +P++PIKVTTP 
Sbjct: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPM 367

 Score =  118 bits (295), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 67/92 (72%), Gaps = 5/92 (5%)

Query: 316 PQAQTLVVYQSTDGSPTMPQRQP--QDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPD 373
           PQ  + V   S+   PT P+     Q Q     KK  DVEFS AISYVNKIK RF+DQPD
Sbjct: 485 PQPTSAV---SSGTGPTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPD 541

Query: 374 IYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405
           IYKHFLEILQTYQREQKPINEVYAQVTVLFQN
Sbjct: 542 IYKHFLEILQTYQREQKPINEVYAQVTVLFQN 573

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LFQ  P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 228 LP 229
           LP
Sbjct: 585 LP 586

 Score = 40.8 bits (94), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 32/49 (65%)

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+ 
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 7/80 (8%)

Query: 585 PLEDE----LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHY 639
           PL D+    LN+ +  S+ ++ K ++     +Y  FL I+  +    +D   ++E+V   
Sbjct: 271 PLHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTL 330

Query: 640 LSGCPELFDWFKSFV--GYQ 657
             G P L   F +F+  GY+
Sbjct: 331 FRGYPNLIQGFNTFLPQGYR 350

 Score = 33.1 bits (74), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 8/86 (9%)

Query: 577 PVIPEPIKP-LEDE------LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLD 628
           P +P P++P L D+      +   +  S+ +K K ++     IY  FL+IL  Y ++   
Sbjct: 500 PEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKP 559

Query: 629 KERLVEKVGHYLSGCPELFDWFKSFV 654
              +  +V       P+L D FK F+
Sbjct: 560 INEVYAQVTVLFQNAPDLLDDFKKFL 585

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1186 bits (3068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/943 (62%), Positives = 698/943 (74%), Gaps = 45/943 (4%)

Query: 488  NLPPLGSFSTPGDHHPM-NLPLVQAPNMNLNQGH--PAHIITQGMSNQKIPISDLRTTAD 544
            NLPPLG+FS  G   P  N  ++ + + ++  GH  P H++TQGMSNQ IP+S++R+T +
Sbjct: 572  NLPPLGNFSASGQASPAENSHMLPSMHQHIAGGHVIPQHVVTQGMSNQDIPVSEMRSTMN 631

Query: 545  TSYRPAEYSQG--------QDTQYMET-NARPEIDLDPSLVPVIPEPIKPLEDELNLVEE 595
             +Y   EY QG        +  QYME   ARPEIDLDPSLVPV+PEPI+P ED + L +E
Sbjct: 632  GTYNQVEYIQGAPGYPQPLEGVQYMEAPMARPEIDLDPSLVPVVPEPIQPPEDAIALGDE 691

Query: 596  ASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVG 655
             +FF++ K++IGNKQ+Y EFLKILNLYSQDLL    LV KV  YL    ELFDWFKSFVG
Sbjct: 692  VTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVG 751

Query: 656  YQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGH 715
            YQEKPKHIENIVHEKHRLDLDLCEACGPSYK+LPK DTFMPCSGRDEMCWEVLNDEWVGH
Sbjct: 752  YQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGH 811

Query: 716  PVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEE 775
            PVWASEDSGFIAHRKNQYEDTLFK+EEERHEYDFYIE+NLRTIQTLETIANKIANMT EE
Sbjct: 812  PVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEE 871

Query: 776  KATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEW 835
            K  FKLPPGLGHTS+TIYKKV+RKVYDKDRG+EIIDALHE+PA+TVPIVLKRLKQKDEEW
Sbjct: 872  KNNFKLPPGLGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEW 931

Query: 836  RRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIH 895
            RRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQL+SEISSIKVDQ NKRIH
Sbjct: 932  RRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIH 991

Query: 896  PLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYP 955
            PLTPK KSQLD +  D EV YDIL+L   F++ N +YS  DK +L  FFK FISLF SYP
Sbjct: 992  PLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYP 1051

Query: 956  VPQIEKALAKRDAAXXXXXXXXXXXXXXXKQQEDG-------DMKLPKKRNREDSDR-LL 1007
            +  + +A+++R +                  QE+G       D +   KR   D D  L+
Sbjct: 1052 IKDVNEAVSERSSIT---------------DQENGEEDSNKSDSEKSNKRTLSDEDSYLM 1096

Query: 1008 RDVLFRNKQQKGGRNSPRGDSSISAXXXXXXXXXXXXXXXAKNPWLLGSIVDEADNHGHV 1067
            +D+L R K  K   NS    +S S                AK PWLLGS++DEA+N G V
Sbjct: 1097 KDILRRTKNAKTS-NSEENQNSSSVKSNEEDETELLAKEAAK-PWLLGSLIDEANNSGIV 1154

Query: 1068 ENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQ 1127
             +R  FNLF NT IYVFFRHL T+YERL+EVKK++ EVT EI NRK+VQFA DLNLISTQ
Sbjct: 1155 SDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQ 1214

Query: 1128 LTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALV 1187
            L DMGL FK   AY +LL+LS+ LI GDL+HQWFEESLRQAYKNKAFKIYT+DKV+Q+LV
Sbjct: 1215 LADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLV 1274

Query: 1188 KHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTA 1247
            KHAH+IITD K   +M+LFE+DR    T+ KDQILYRL+VR+ M   ENMFRIEYN  ++
Sbjct: 1275 KHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSS 1334

Query: 1248 HVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXXXXXXXXX- 1306
            HV IQ+VAVDDLTL+EP+++K+KW YY+TSYSLSHPTEGI+ +++  PFL          
Sbjct: 1335 HVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEY 1394

Query: 1307 -XXXXXXXXYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVDIRXXXX 1365
                     +SPEGV+ S LKV I P TY +  E GS D+F+RK+VNKFP          
Sbjct: 1395 LDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFP------SSQS 1448

Query: 1366 XXXXXXXXRFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGNLE 1408
                    +FLNS+ GWKK+LS + I   E +++ +K  G LE
Sbjct: 1449 TQPASKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGKLE 1491

 Score =  186 bits (473), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (96%)

Query: 158 SSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGY 217
           SSYRPLNVKDALSYLEQVKFQF+SRPDVYNHFLDIMKDFKSQAIDTPGVI+RV+TLFQG+
Sbjct: 199 SSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGF 258

Query: 218 PTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPF 250
           P LIQGFNTFLP GY IECS++PNDPIKVTTPF
Sbjct: 259 PNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPF 291

 Score =  118 bits (295), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 59/61 (96%)

Query: 345 GGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 404
           G +KTG+VEFSHAISYVNKIKTRFADQPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQ
Sbjct: 418 GQQKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477

Query: 405 N 405
           N
Sbjct: 478 N 478

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 38/62 (61%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A+SY+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LFQ  P L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 228 LP 229
           LP
Sbjct: 490 LP 491

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 33/48 (68%)

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 404
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQ 256

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1186 bits (3067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/957 (62%), Positives = 713/957 (74%), Gaps = 44/957 (4%)

Query: 488  NLPPLGSFSTP----------GDHHPMNL---PLVQAPNMNLNQGHPAHIITQGMSNQKI 534
            NLPPLGSFS P           D  P  L   P+ Q  N +++Q  P HI TQG++ + +
Sbjct: 486  NLPPLGSFSPPPNGAVPHNYYRDQQPQTLGLPPVAQVEN-HIDQRSPPHIATQGIAGEPM 544

Query: 535  PISDLRT--TADTSYRPAEYSQGQ-----------DTQYMETNARPEIDLDPSLVPVIPE 581
            P+S+LR+  TA +    A+  Q Q           D QY++   RPEIDLDPS+VPV+PE
Sbjct: 545  PVSNLRSQITAQSPSELAQLHQQQQIPSQPTANIPDGQYLDIAVRPEIDLDPSIVPVVPE 604

Query: 582  PIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLS 641
            P  P+ED L LVEE SFFD+AKK+IGNKQIYTEFLKILNL+SQDLLD + LV +V HYL 
Sbjct: 605  PTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLG 664

Query: 642  GCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRD 701
            G  ELF WFK+FVG+Q+KPKHIENIVHEKHRLDLDLCEACGPSYK+LPK+DTFMPCSGRD
Sbjct: 665  GNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRD 724

Query: 702  EMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTL 761
            EMCW VLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQTL
Sbjct: 725  EMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTL 784

Query: 762  ETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITV 821
            ETIA+KIANM+ EEKATFKLPPGLGHTS+TIYKKVIRKVYDK+RG+EIIDALHEYPAI V
Sbjct: 785  ETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAV 844

Query: 822  PIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISE 881
            P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQLISE
Sbjct: 845  PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISE 904

Query: 882  ISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLK 941
            I SIK DQ NKR+H LTPK K QLD+   D  VF+DIL+L   F+ +N++YS PDK RLK
Sbjct: 905  IGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLK 964

Query: 942  DFFKGFISLFCSYPVPQIEKALAKRDAAXXXXXXXXXXXXXXXKQQEDGDMKLPKKRNRE 1001
            D FK F+SLF S P+ ++ +A+++R                   Q+ + D     KR RE
Sbjct: 965  DLFKIFVSLFFSIPMYEVNEAVSRRG--------NLDDDKEDSTQKMESDNLNNSKRPRE 1016

Query: 1002 DSDRLLRDVLFRNKQQ--KGGRNSPRGDSSISAXXXXXXXXXXXXXXXAKNPWLLGSIVD 1059
            D +  L +VL R K Q  K        + S +                AK PWLLG++V+
Sbjct: 1017 D-EISLSEVLHRAKNQRFKSRAADETSEESAAEPEPELNEEEETIRQEAKKPWLLGNLVE 1075

Query: 1060 EADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAK 1119
            E +  G + NRKTFN+FANTNIYVFFRHL T+YERL EVKKMND VTKEI +RKVVQFAK
Sbjct: 1076 EVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAK 1135

Query: 1120 DLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTV 1179
            DLNLIS QL +MGLDF+G DAYE+L  L + LI GD+EHQWFEESLRQAY NKAFK+YTV
Sbjct: 1136 DLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTV 1195

Query: 1180 DKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFR 1239
            DKVIQ+LVKHAH I+TD+KT EIM  FEKDRT ++TS KDQILYRLQVRS MS+ ENMFR
Sbjct: 1196 DKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFR 1255

Query: 1240 IEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXX 1299
            IEYN+ + +V IQF+AVDDLTL EP+SL++KW+YY+TSYSLSHPTEGIS + L+ PFL  
Sbjct: 1256 IEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEK 1315

Query: 1300 XXXXXXXXXXX----XXXXYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFP 1355
                               +SPEGV+ S LK+KIDP TY +++E GS+D+FSRK+VN+FP
Sbjct: 1316 VLETEEDYGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRFP 1375

Query: 1356 VRVDIR--XXXXXXXXXXXXRFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGNLEEY 1410
            V VD                +FL S  GWKK+L   Q+  ++++L  VK NG+L+++
Sbjct: 1376 VIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDDDQVKAIQEKLARVKENGSLDDF 1432

 Score =  185 bits (470), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 109/215 (50%), Positives = 121/215 (56%), Gaps = 26/215 (12%)

Query: 59  KGHYTLPSISAGLPGSGEHQHQQHDGS-------RLPPMQNTLXXXXXXXXXXXXXXXXX 111
           K H TLPSIS     SGE  H   DG        RLP +Q+T                  
Sbjct: 70  KPHVTLPSISDL---SGESAHNGKDGLTSSNTPLRLPSVQSTYGSKAPGAGQEVNGTIME 126

Query: 112 V------------SNGFSMSSLDNPLPXXXXXXXXXXXXXX----XXXXXXXXXXXPAHQ 155
                        S G S +S DNPLP                                Q
Sbjct: 127 STVNPAPAQGRQNSVGLSFASFDNPLPPQQQTILSSSHFQVLPPHQQQQEQQQQMQQQMQ 186

Query: 156 DGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQ 215
             + YRPLNVKDALSYLEQVK+QFNSRPDVYNHFLDIMKDFKSQAIDTPGVI+RVSTLF+
Sbjct: 187 HDAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246

Query: 216 GYPTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPF 250
           GYP LIQGFNTFLPQGY IECS++P++PI+VTTP 
Sbjct: 247 GYPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPM 281

 Score =  118 bits (295), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/77 (76%), Positives = 62/77 (80%), Gaps = 2/77 (2%)

Query: 331 PTMPQRQPQDQFGTG--GKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQRE 388
           P  P    Q Q  +   GKKT DVEFS AI+YVNKIK RFA+QPDIYKHFLEILQTYQRE
Sbjct: 357 PLQPAAGQQSQLPSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQRE 416

Query: 389 QKPINEVYAQVTVLFQN 405
           QKPINEVYAQVTVLFQN
Sbjct: 417 QKPINEVYAQVTVLFQN 433

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 44/78 (56%)

Query: 152 PAHQDGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVS 211
           P++  G     +    A++Y+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+
Sbjct: 369 PSNDQGKKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVT 428

Query: 212 TLFQGYPTLIQGFNTFLP 229
            LFQ  P L+  F  FLP
Sbjct: 429 VLFQNAPDLLDDFKKFLP 446

 Score = 40.0 bits (92), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 404
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1185 bits (3066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/942 (62%), Positives = 708/942 (75%), Gaps = 49/942 (5%)

Query: 488  NLPPLGSFSTP---GDHHP-MNLPLVQAPNMNLNQG----HPAHIITQGMSNQKIPISDL 539
            NLPPLGSFS P    ++ P +NLP VQ P M         HP+H++ Q +    +P+SDL
Sbjct: 469  NLPPLGSFSPPINGRENDPQLNLPAVQPPAMEFASQQVPHHPSHVVPQVIPGGTLPLSDL 528

Query: 540  RTTADTSYRPAEYSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFF 599
            R   D ++ P    Q QD Q++E  +RPEIDLDPSLVPVIPEPIKPLE++L L+EE SFF
Sbjct: 529  RGAMDGNFAPQPL-QSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFF 587

Query: 600  DKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEK 659
            D+AKKY+GNKQ+YTEFLKILNL+SQDL+  E LV+KV HYL G PELFDWFKSFV Y EK
Sbjct: 588  DRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEK 647

Query: 660  PKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWA 719
            PKHIEN++HEKHRLDLDLCEAC PSYK+LPKADTFMPCSGRDEMCWEVLNDEWVGHPVWA
Sbjct: 648  PKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWA 707

Query: 720  SEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATF 779
            SEDSGFIAHRKNQYE+TLFKIEEERHEYD+YIEANLRTIQ LETIANKI+NMTPEEK  F
Sbjct: 708  SEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAF 767

Query: 780  KLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQ 839
            KLPPGLGHTS+TIYKKVIRKVYDKDRG+EIIDALHE PA++VPI+LKRLKQKDEEWRRAQ
Sbjct: 768  KLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQ 827

Query: 840  REWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTP 899
            REWNKVWRELEQKVF+KSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQ NKRI+P TP
Sbjct: 828  REWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTP 887

Query: 900  KAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQI 959
            K KSQLD+D  D  V +DIL L   F+++++TYS PDKE+L  FFKGF+S+F S    +I
Sbjct: 888  KPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEI 947

Query: 960  EKAL-AKRDAAXXXXXXXXXXXXXXXKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQK 1018
            E +  A  DA                          P+KR  E S++ L+++L    +  
Sbjct: 948  ENSTPADSDAVSNSN---------------------PRKRLWE-SEQPLKELLRSKHKHH 985

Query: 1019 GGRNSPRGDSSIS------AXXXXXXXXXXXXXXXAKNPWLLGSIVDEADNHGHVENRKT 1072
              R++   D SIS                      AK PWLLG+I+DEA++HG+V NRK 
Sbjct: 986  KKRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKI 1045

Query: 1073 FNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMG 1132
            FNLFANTN+YVFFRHL T+Y+RL EVK MN+EVT+EI +R VVQFAKDLNL+STQL+DMG
Sbjct: 1046 FNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMG 1105

Query: 1133 LDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHA 1192
            LDFKG+DAY++LL L + LI  D++HQWFEESLRQAYKNKAFKIYTVDKVIQ+LVKHAH+
Sbjct: 1106 LDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHS 1165

Query: 1193 IITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQ 1252
            IITD K+ EIM+LFEKDR   +TSTK+QILYRLQVRS M   ENMFR+E N+ + HVCIQ
Sbjct: 1166 IITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQ 1225

Query: 1253 FVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXXXXXXXXXXXXXXX 1312
            +VA+DDLTL+EP+SLKD+W YYLTSY+LSHPTEGI H+ ++ PFL               
Sbjct: 1226 YVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEEADEGSE 1285

Query: 1313 XXYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKF------PVRVDIRXXXXX 1366
               SP G + SNL+++++P +Y +++E GS DIF+R AVN+F          D++     
Sbjct: 1286 ER-SPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRK 1344

Query: 1367 XXXXXXXRFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGNLE 1408
                     L+ + GWKK +S + + +    L +V+L+G  E
Sbjct: 1345 TLMSQ----LDGSRGWKKGMSQELVDKTLTALNYVRLHGKHE 1382

 Score =  273 bits (699), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 173/349 (49%), Positives = 192/349 (55%), Gaps = 26/349 (7%)

Query: 62  YTLPSISAGLPGSGEHQHQQHDGSRLPPMQNTLXXXXXXXXXXXXXXXXXVSNGFSMSSL 121
           + LPS+S GL  +G       +  RLP +Q                     S GFS++SL
Sbjct: 60  FVLPSLS-GL-DAGTRAEYGSEPQRLPSLQGA----------QPQSISSGGSKGFSVASL 107

Query: 122 DNPLPXXXXXXXXXXXXXXXXXXXXXXXXXPAHQDGSSYRPLNVKDALSYLEQVKFQFNS 181
           +NPLP                           H    SYRPLN KDALSYLEQVKFQFN+
Sbjct: 108 NNPLPAQQQMLHSQQQQQLLQQGVLPLE----HVQDPSYRPLNFKDALSYLEQVKFQFNN 163

Query: 182 RPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQGYNIECSSDPN 241
           RPDVYNHFLDIMKD+KSQAIDT GVIER+STLF+GYP LIQG NTFLPQGY IEC+ +PN
Sbjct: 164 RPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIECTLNPN 223

Query: 242 DP--IKVTTPFXXXXXXXXXXXXXXXXXXXXXPRAEPXXXXX---XXXXXPATVXXXXXX 296
           DP  IKVTTPF                     P   P             PA V      
Sbjct: 224 DPHSIKVTTPFDNARELNLATMATGNGIVEGHPSLMPSDDVSPPKLVGHEPAAVQPKLEN 283

Query: 297 XXXXXXXXXXXXXXXXXPPPQAQTLVVYQSTDGSPTMPQRQPQDQFGTGGKKTGDVEFSH 356
                               Q Q     Q    SP MPQ+Q QDQ   G + +GDVEFSH
Sbjct: 284 APTNLPVPTTFNQNLPQHEQQNQ-----QHGSQSPAMPQQQRQDQQFMGNRPSGDVEFSH 338

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405
           AISYVNKIKTRFADQP+IYKHFLEILQTYQREQKPI+EVYAQVT LFQN
Sbjct: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQN 387

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A+SY+ ++K +F  +P++Y HFL+I++ ++ +      V  +V++LFQ  P L+  F  F
Sbjct: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKF 398

Query: 228 LP 229
           LP
Sbjct: 399 LP 400

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1138 bits (2944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/971 (59%), Positives = 706/971 (72%), Gaps = 63/971 (6%)

Query: 488  NLPPLGSFSTPGD---------------HHPMNLP-LVQAPNMNLNQGHPAHIITQGMSN 531
            NLPPLG+FS P +               HH M LP ++QAP  +       HI    M+N
Sbjct: 472  NLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMALPSMLQAPTEHAQLHAQQHIAP--MTN 529

Query: 532  QKIPISDLRTTADTS-----YRPAEYSQG---------------------QDTQYMETNA 565
            + IPISDLR+    +     Y P E +Q                      +     E   
Sbjct: 530  EAIPISDLRSQIIDNNHVHNYTPIELAQLQQQQQQQQQQQQQQQQQQMQLEAAYATEGIV 589

Query: 566  RPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQD 625
            RPEIDLDPS+VPVIPEP +P+E+ L+LVEEA+FFDKAKK+IGNKQ+Y EFLKILNLYSQD
Sbjct: 590  RPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQD 649

Query: 626  LLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSY 685
            +L  + L+EKV +YL    ELFDWFK+FVG+Q+KPKHIEN+VHEKH+LDLDLCEACGPSY
Sbjct: 650  ILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSY 709

Query: 686  KRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERH 745
            K+LPK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERH
Sbjct: 710  KKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH 769

Query: 746  EYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDR 805
            EYDFYIE+NLRTIQTLETIA+KIANMT EEK  FKLP GLGHTS TIY+KVIRKVYDK+R
Sbjct: 770  EYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKER 829

Query: 806  GYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTF 865
            G+EIIDALHEYP++ VP+VLKRLKQKD+EWRRAQREWNKVWRELEQKVFFKSLDHLGLTF
Sbjct: 830  GFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTF 889

Query: 866  KQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVF 925
            KQ+DKKLLT KQL++EISSIKVDQ NKRIH LTPK KSQLD++  D  V +DIL LA VF
Sbjct: 890  KQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVF 949

Query: 926  LENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRDAAXXXXXXXXXXXXXXXK 985
            + + ++YS PDKERL+DF + +I LF S P+ +I+ A+   +AA               +
Sbjct: 950  INHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAV---EAA-------IDNGKQLDE 999

Query: 986  QQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGGRNSPRGDSSISAXX---XXXXXXXX 1042
             +++   K   KR R D +  L D+L R++ Q+   +    ++S+ A             
Sbjct: 1000 NEQNSSKKNSNKRPR-DVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQDDMDE 1058

Query: 1043 XXXXXAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMN 1102
                 AK PWLLGS+V+EA++ G ++NRK +N+FAN N+YVF R+L TIY+RL EVK +N
Sbjct: 1059 MIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDIN 1118

Query: 1103 DEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFE 1162
            D VTKEI  RKVVQFAKDLNLIS QL +MGLDF G D+Y +LL LS+ LI GDLEHQWFE
Sbjct: 1119 DVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFE 1178

Query: 1163 ESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQIL 1222
            ESLRQAY+N+AFK+YT+DKVIQ+LVKHAHAI+TD+K+ ++M LFEKDR S ST++KDQIL
Sbjct: 1179 ESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQIL 1238

Query: 1223 YRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSH 1282
            YRLQ RS+MS  E+MFRIEYN   + + IQ++A+DDLTLEEPK+L+DKW+YY+TSYSLSH
Sbjct: 1239 YRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSH 1298

Query: 1283 PTEGISHDNLRSPFLXXXXXXXXXXXXXXXX--XYSPEGVATSNLKVKIDPITYSMEVEF 1340
            PTEGI  + ++ PFL                   YSPEGV+ SNL +KIDP TY +EVE 
Sbjct: 1299 PTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEP 1358

Query: 1341 GSHDIFSRKAVNKFPVRV--DIRXXXXXXXXXXXXRFLNSNSGWKKDLSAKQIAEVEKRL 1398
            GS DIFSRK+VNKFPV V  +               FLN   GWK+ LS+  I+++E++ 
Sbjct: 1359 GSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKF 1418

Query: 1399 EFVKLNGNLEE 1409
              +K NG  ++
Sbjct: 1419 NDLK-NGTFQQ 1428

 Score =  189 bits (480), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 100/139 (71%), Gaps = 9/139 (6%)

Query: 112 VSNGFSMSSLDNPLPXXXXXXXXXXXXXXXXXXXXXXXXXPAHQDGSSYRPLNVKDALSY 171
            S   S++S DNPLP                             DGS YRPLNVKDAL+Y
Sbjct: 82  TSTTLSVASFDNPLPPAPAAHLQQQQQQQQQQQQA---------DGSYYRPLNVKDALTY 132

Query: 172 LEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQG 231
           LEQVK QFNSRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLF+GYP LIQGFNTFLPQG
Sbjct: 133 LEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTFLPQG 192

Query: 232 YNIECSSDPNDPIKVTTPF 250
           Y IECSS+P+DPIKVTTP 
Sbjct: 193 YTIECSSNPDDPIKVTTPL 211

 Score =  112 bits (279), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 57/65 (87%)

Query: 341 QFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT 400
           Q  T  +K  DVEFS A+SYVNKIK RFADQPDIYKHFLEILQTYQREQKPI+EVYAQVT
Sbjct: 350 QGTTQIEKPADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVT 409

Query: 401 VLFQN 405
           VLFQN
Sbjct: 410 VLFQN 414

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ  P L+  F  F
Sbjct: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKF 425

Query: 228 LP 229
           LP
Sbjct: 426 LP 427

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 404
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

 Score = 33.1 bits (74), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648
           LN+ +  ++ ++ K ++     IY  FL I+  +    +D   ++E+V     G P L  
Sbjct: 124 LNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQ 183

Query: 649 WFKSFV--GY 656
            F +F+  GY
Sbjct: 184 GFNTFLPQGY 193

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1124 bits (2908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/944 (60%), Positives = 685/944 (72%), Gaps = 44/944 (4%)

Query: 488  NLPPLGSFSTPG----------DHHPMNLP-LVQAPNMNLNQGHPAHIITQGMSNQKIPI 536
            NLPP+GSFS P           D   M  P LV  P+M     H  +++ QG++N+ +PI
Sbjct: 558  NLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSM---VQHGPNMVHQGIANENLPI 614

Query: 537  SDLRTTADTSYRPAEYSQGQ----------DTQYMETNARPEIDLDPSLVPVIPEPIKPL 586
            SDLRT+    Y P+ + Q Q          D QY +   RPEIDLDPS+VPV+PEP +P+
Sbjct: 615  SDLRTSLTDQYAPSTFQQQQQNPPSISPITDLQYGDVPVRPEIDLDPSIVPVVPEPTEPI 674

Query: 587  EDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPEL 646
            ED ++L EE +FF+KAK+YIGNK +YTEFLKILNLYSQD+LD + LVEKV  YL    EL
Sbjct: 675  EDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKEL 734

Query: 647  FDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWE 706
            F WFK+FVGYQEK K IENIVHEKHRLDLDLCEA GPSYKRLPK+DTFMPCSGRD+MCWE
Sbjct: 735  FSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWE 794

Query: 707  VLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIAN 766
            +LNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ LETI N
Sbjct: 795  ILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVN 854

Query: 767  KIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLK 826
            KI NMT  EK+ FKLPPGLGHTS+TIYKKVIRKVYDK+RG+EIIDALHE+PA+T P+VLK
Sbjct: 855  KIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLK 914

Query: 827  RLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIK 886
            RLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLT KQLISEI+SIK
Sbjct: 915  RLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEINSIK 974

Query: 887  VDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKG 946
            VDQ NK+IH LTPK KSQLD DF D ++FYDIL LA  F+ +   YS PDKERLKD  K 
Sbjct: 975  VDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAYSNPDKERLKDLLKY 1034

Query: 947  FISLFCSYPVPQIEKALAKRDAAXXXXXXXXXXXXXXXKQQEDGDMKLPKKRNREDSDRL 1006
            FISLF S P+ +IEKAL                        +DG     +KR  +    L
Sbjct: 1035 FISLFFSIPLEKIEKAL-----------QFHKENVSESSGSDDGGSSTSRKRPYQQEMSL 1083

Query: 1007 LRDVLFRNKQQKGGR-NSPRGD----SSISAXXXXXXXXXXXXXXXAKNPWLLGSIVDEA 1061
            L D+L RN+ QK  R N   G     S                   A+NPWL G++V+EA
Sbjct: 1084 L-DILHRNRYQKLKRSNDEEGKIPQLSEPLDEESNTIEEEELISEEARNPWLTGNLVEEA 1142

Query: 1062 DNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDL 1121
            ++ G ++NR  FNLFANTNIY+FFRH  TIYERL+E+K+MN ++TKE+  R  V FAKDL
Sbjct: 1143 NSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNGKITKEVNTRSTVTFAKDL 1202

Query: 1122 NLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDK 1181
            +L+S QL +MGLDF GEDAY+++L+LSR LI GDLEHQWFEESLRQAY NKAFK+YT+DK
Sbjct: 1203 DLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDK 1262

Query: 1182 VIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIE 1241
            V Q+LVKHAH ++ D KT EIM LF KDR + +TS KDQI+YRLQVRS MSNIENMFRIE
Sbjct: 1263 VTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKDQIIYRLQVRSYMSNIENMFRIE 1322

Query: 1242 YNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXXXX 1301
             N+ + HV +Q++A+DDLTL+EPK+ +DKW+YY+TSY L HPTEGISH+ L+ PFL    
Sbjct: 1323 LNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYGLPHPTEGISHEKLKIPFLERLI 1382

Query: 1302 X-XXXXXXXXXXXXYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRV-- 1358
                          +SPEG++ S L++KI PITY + +E GS+D+F+RKAVNK+P     
Sbjct: 1383 EFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHIENGSYDVFTRKAVNKYPTIAND 1442

Query: 1359 DIRXXXXXXXXXXXXRFLNSNSGWKKDLSAKQIAEVEKRLEFVK 1402
            D+             RFL +    + DL+    + ++++L  +K
Sbjct: 1443 DVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQEKLALLK 1486

 Score =  261 bits (668), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 147/258 (56%), Positives = 162/258 (62%), Gaps = 26/258 (10%)

Query: 160 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPT 219
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF+GYP 
Sbjct: 224 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 283

Query: 220 LIQGFNTFLPQGYNIECSSDPNDPIKVTTPFXXXXXXXXXXXXXXXXXXXXXPR--AEPX 277
           LIQGFNTFLPQGY IECS++P+DPI+VTTP                      P   +EP 
Sbjct: 284 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPSGRGTVDGQEPSSLSEPD 343

Query: 278 XXXXXXXXXPATVXXXXXXXXXXXXXXXXXXXXXXXPPPQAQTLVVYQSTDGSPTM--PQ 335
                       V                          Q Q+L +  ++ G  ++  P+
Sbjct: 344 GNAIQPFHNLPMVPSNVYRSEQSQD--------------QKQSLPLSANSVGLSSIHPPE 389

Query: 336 RQPQDQFGTG--------GKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQR 387
             P  Q   G         KK  DVEFS AISYVNKIKTRFADQPDIYKHFLEILQTYQR
Sbjct: 390 IPPHHQILQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQR 449

Query: 388 EQKPINEVYAQVTVLFQN 405
           EQKPINEVYAQVT LFQN
Sbjct: 450 EQKPINEVYAQVTHLFQN 467

 Score = 56.2 bits (134), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 44/78 (56%)

Query: 152 PAHQDGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVS 211
           P  +D      +    A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+
Sbjct: 403 PVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT 462

Query: 212 TLFQGYPTLIQGFNTFLP 229
            LFQ  P L++ F  FLP
Sbjct: 463 HLFQNAPDLLEDFKKFLP 480

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 14/124 (11%)

Query: 536 ISDLRTTADTSYRPAEYSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEE 595
           I D R  A ++      S   DT Y   N     D DP   P+       ++D L+ +E+
Sbjct: 186 IQDQRPAAHSANASEPSSNYVDTSYSVNNENSN-DEDPDYRPL------NVKDALSYLEQ 238

Query: 596 ASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFV- 654
             F     ++     IY  FL I+  +    +D   ++E+V     G P L   F +F+ 
Sbjct: 239 VKF-----QFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLP 293

Query: 655 -GYQ 657
            GY+
Sbjct: 294 QGYR 297

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/944 (60%), Positives = 693/944 (73%), Gaps = 44/944 (4%)

Query: 488  NLPPLGSFSTPG----------DHHPMNLP-LVQAPNMNLNQGHPAHIITQGMSNQKIPI 536
            NLPP+GSFS P           D   M  P L+  P+M + QG   +++ QG+ N+ IP+
Sbjct: 564  NLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSM-VQQG--PNMVHQGIVNENIPL 620

Query: 537  SDLRTTADTSYRPAEYSQGQ----------DTQYMETNARPEIDLDPSLVPVIPEPIKPL 586
            SDLRT+    Y P+ + Q Q          D+QY +   RPEIDLDPS+VPV+PEP +P+
Sbjct: 621  SDLRTSLTDQYAPSNFQQQQQQQPSISPIIDSQYGDVPVRPEIDLDPSIVPVVPEPTEPI 680

Query: 587  EDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPEL 646
            ED ++L EE +FF+KAK+YIGNK +YTEFLKILNLYSQD+LD + LVEKV  YL    EL
Sbjct: 681  EDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKEL 740

Query: 647  FDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWE 706
            F WFK+FVGYQEK K IEN+VHEKHRLDLDLCEA GPSYKRLPK+DTFMPCSGRD+MCWE
Sbjct: 741  FSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWE 800

Query: 707  VLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIAN 766
            VLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ LETI N
Sbjct: 801  VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVN 860

Query: 767  KIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLK 826
            KI NMT  EKA FKLPPGLGHTS+TIYKKVIRKVYDK+RG+EIIDALHE+PA+T P+VLK
Sbjct: 861  KIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLK 920

Query: 827  RLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIK 886
            RLKQKDEEWRRAQREWNKVWRELEQKV+FKSLDHLGLTFKQADKKLLT KQLISEISSIK
Sbjct: 921  RLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIK 980

Query: 887  VDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKG 946
            VDQ NK+IH LTPK KSQLD DF D ++FYDIL LA  F+ +   YS PDKERLKD    
Sbjct: 981  VDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKERLKDLLNY 1040

Query: 947  FISLFCSYPVPQIEKALAKRDAAXXXXXXXXXXXXXXXKQQEDGDMKLPKKRNREDSDRL 1006
            FISLF S P+ +IE+AL                        +DGD   P+KR  +    L
Sbjct: 1041 FISLFFSIPLEKIEEAL-----------QSYKQNLSDSSGSDDGDSSTPRKRPYQQEMSL 1089

Query: 1007 LRDVLFRNKQQKGGR-NSPRGD----SSISAXXXXXXXXXXXXXXXAKNPWLLGSIVDEA 1061
            L D+L R+K QK  R N   G     S                   AKNPWL G++V+EA
Sbjct: 1090 L-DILHRSKYQKLKRSNDEDGKVPQLSEPLDEESNAIEEEELINEEAKNPWLTGNLVEEA 1148

Query: 1062 DNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDL 1121
            ++ G ++NR  FNLFAN+NIY+FFRH  TIYERL+E+K+MN++VTKEI+ R +V FAKDL
Sbjct: 1149 NSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVTFAKDL 1208

Query: 1122 NLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDK 1181
            +L+S+QL++MGLDF GEDAY+++L+LSR LI G+LEHQWFEE LRQAY NKAFK+YT+DK
Sbjct: 1209 DLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDK 1268

Query: 1182 VIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIE 1241
            VIQ LVKHAH ++TD KT EIM LF KDR + +TS KDQI+YRLQ RS MSN ENMFR+E
Sbjct: 1269 VIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMFRME 1328

Query: 1242 YNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXXXX 1301
            ++R   HV +Q++A+DDLTL+EP++ +DKW+YY+TSY+L HPTEGISH+ L+ PFL    
Sbjct: 1329 FDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLERLI 1388

Query: 1302 XX-XXXXXXXXXXXYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRV-- 1358
                          +SPEG++ S LK+KI P+TY + +E GS+D+F+RKA NK+P     
Sbjct: 1389 EYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYPTVAND 1448

Query: 1359 DIRXXXXXXXXXXXXRFLNSNSGWKKDLSAKQIAEVEKRLEFVK 1402
            DI             +FL++    + DL+  +   ++++L+ +K
Sbjct: 1449 DIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLK 1492

 Score =  265 bits (678), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 148/252 (58%), Positives = 162/252 (64%), Gaps = 17/252 (6%)

Query: 160 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPT 219
           YRPLNVKDALSYLEQVKFQFNSRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF+GYP 
Sbjct: 67  YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 126

Query: 220 LIQGFNTFLPQGYNIECSSDPNDPIKVTTPFXXXXXXXXXXXXXXXXXXXXXPRAEPXXX 279
           LIQGFNTFLPQGY IECS++P+DPI+VTTP                      P + P   
Sbjct: 127 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSSLPEAD 186

Query: 280 XXXXXXXPATVXXXXXXXXXXXXXXXXXXXXXXXPPPQAQTLVVYQSTDGSPTMPQRQ-- 337
                   +T+                         P    L +  +  G P++ Q +  
Sbjct: 187 G-------STIPQSHNVPMVPSNVYHSEQSQDQQQQP----LPLLANPSGLPSIHQPELP 235

Query: 338 -PQDQFGTGG---KKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN 393
            PQ Q  T     KK  DVEFS AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN
Sbjct: 236 IPQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIN 295

Query: 394 EVYAQVTVLFQN 405
           EVYAQVT LFQN
Sbjct: 296 EVYAQVTHLFQN 307

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ  P L++ F  F
Sbjct: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318

Query: 228 LP 229
           LP
Sbjct: 319 LP 320

 Score = 33.9 bits (76), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 13/98 (13%)

Query: 562 ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNL 621
           E NA    D DP   P+       ++D L+ +E+  F     ++     IY  FL I+  
Sbjct: 54  EINAENTNDEDPDYRPL------NVKDALSYLEQVKF-----QFNSRPDIYNLFLDIMKD 102

Query: 622 YSQDLLDKERLVEKVGHYLSGCPELFDWFKSFV--GYQ 657
           +    +D   ++E+V     G P L   F +F+  GY+
Sbjct: 103 FKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYR 140

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1114 bits (2881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/951 (59%), Positives = 678/951 (71%), Gaps = 58/951 (6%)

Query: 488  NLPPLGSFSTPGDH----------------HPMNLPLV--QAPNMNLNQGHPAHIITQGM 529
            NLPP+GSFS P +                 H M LP +    PNM          + QG+
Sbjct: 540  NLPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNM----------VHQGI 589

Query: 530  SNQKIPISDLRTTADTSYRPAEYSQGQ----------DTQYMETNARPEIDLDPSLVPVI 579
            +N+  P+SDLRT+    Y P+     Q          +TQY +   RPEIDLDPS+VPV+
Sbjct: 590  ANENPPLSDLRTSLTEQYAPSSIQHQQQHPQSISPIANTQYGDIPVRPEIDLDPSIVPVV 649

Query: 580  PEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHY 639
            PEP +P+E+ ++L EE +FF+KAK+YIGNK +YTEFLKILNLYSQD+LD + LVEKV  Y
Sbjct: 650  PEPTEPIENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFY 709

Query: 640  LSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSG 699
            L    ELF WFK+FVGYQEK K IENIVHEKHRLDLDLCEA GPSYKRLPK+DTFMPCSG
Sbjct: 710  LGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSG 769

Query: 700  RDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQ 759
            RD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ
Sbjct: 770  RDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ 829

Query: 760  TLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAI 819
             LETI NKI NMT  EKA FKLPPGLGHTS+TIYKKVIRKVYDK+RG+EIIDALHE+PA+
Sbjct: 830  CLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAV 889

Query: 820  TVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLI 879
            T P+VLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLT KQLI
Sbjct: 890  TAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLI 949

Query: 880  SEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKER 939
            SEISSIKVDQ NK+IH LTPK KSQLD DF D  +FYDIL LA  F+ +   YS PDKER
Sbjct: 950  SEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAYSNPDKER 1009

Query: 940  LKDFFKGFISLFCSYPVPQIEKALAKRDAAXXXXXXXXXXXXXXXKQQEDGDMKLPKKRN 999
            LKD  K FISLF S    +IE++L                                +KR 
Sbjct: 1010 LKDLLKYFISLFFSISFEKIEESLYSHKQNVSESSGSDDGSSIAS-----------RKRP 1058

Query: 1000 REDSDRLLRDVLFRNKQQKGGR-NSPRGD----SSISAXXXXXXXXXXXXXXXAKNPWLL 1054
             +    LL D+L R++ QK  R N   G     S                   AKNPWL 
Sbjct: 1059 YQQEMSLL-DILHRSRYQKLKRSNDEDGKVPQLSEPPEEEPNTIEEEELIDEEAKNPWLT 1117

Query: 1055 GSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKV 1114
            G++V+EA++ G ++NR  FNLFANTNIY+FFRH  TIYERL+E+K+MN+ VTKEI  R  
Sbjct: 1118 GNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIKQMNERVTKEINTRST 1177

Query: 1115 VQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAF 1174
            V FAKDL+L+S+QL++MGLDF GEDAY+++L+LSR LI GDLEHQWFEESLRQAY NKAF
Sbjct: 1178 VTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQWFEESLRQAYNNKAF 1237

Query: 1175 KIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNI 1234
            K+YT+DKV Q+LVKHAH ++TD KT EIM LF KDR + +TS KDQI+YRLQVRS+MSN 
Sbjct: 1238 KLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQVRSHMSNT 1297

Query: 1235 ENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRS 1294
            ENMFRIE+++ T HV IQ++A+DDLTL+EPK+ +DKW+YY+TSY+L HPTEGI H+ L+ 
Sbjct: 1298 ENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYALPHPTEGIPHEKLKI 1357

Query: 1295 PFLXXXXX-XXXXXXXXXXXXYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNK 1353
            PFL                  +SPEG++ S LK+KI PITY + +E GS+D+F+RKA NK
Sbjct: 1358 PFLERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHIENGSYDVFTRKATNK 1417

Query: 1354 FPVRV--DIRXXXXXXXXXXXXRFLNSNSGWKKDLSAKQIAEVEKRLEFVK 1402
            +P     + +            +FL+   G + +L   Q   ++K+ E +K
Sbjct: 1418 YPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQKKWENLK 1468

 Score =  178 bits (452), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 88/93 (94%)

Query: 158 SSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGY 217
           + YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF+GY
Sbjct: 214 ADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGY 273

Query: 218 PTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPF 250
           P LIQGFNTFLPQGY IECSS+P+DPI+VTTP 
Sbjct: 274 PILIQGFNTFLPQGYRIECSSNPDDPIRVTTPM 306

 Score =  113 bits (282), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/96 (66%), Positives = 70/96 (72%), Gaps = 10/96 (10%)

Query: 320 TLVVYQSTDGSPTMPQ------RQ-PQDQF---GTGGKKTGDVEFSHAISYVNKIKTRFA 369
           +L +  ++ G P++ Q      RQ PQ Q        KK  DVEFS AISYVNKIKTRFA
Sbjct: 364 SLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDAKKNVDVEFSQAISYVNKIKTRFA 423

Query: 370 DQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405
           DQPDIYKHFLEILQTYQREQKPINEVYAQVT LFQN
Sbjct: 424 DQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQN 459

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ  P L++ F  F
Sbjct: 411 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 470

Query: 228 LP 229
           LP
Sbjct: 471 LP 472

 Score = 38.1 bits (87), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 404
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 224 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 271

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648
           LN+ +  S+ ++ K ++     IY  FL I+  +    +D   ++E+V     G P L  
Sbjct: 219 LNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQ 278

Query: 649 WFKSFV--GYQ 657
            F +F+  GY+
Sbjct: 279 GFNTFLPQGYR 289

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1109 bits (2868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/946 (59%), Positives = 678/946 (71%), Gaps = 47/946 (4%)

Query: 488  NLPPLGSFSTPG----------DHHPMNLP-LVQAPNMNLNQGHPAHIITQGMSNQKIPI 536
            NLPP+GSFS P           D   M  P L+  P+M     H A+I+ QG++N+ +P+
Sbjct: 571  NLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSM---VQHGANIVHQGIANENLPL 627

Query: 537  SDLRTTADTSYRPA-----------EYSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKP 585
            SDLRT+    Y P+             S   ++QY +   RPEIDLDPS+VPV+PEP +P
Sbjct: 628  SDLRTSLTEQYAPSNIQQQQQQHPQSISPIANSQYGDVPVRPEIDLDPSIVPVVPEPTEP 687

Query: 586  LEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPE 645
            +ED ++L EE +FF+KAK+YIGNK +YTEFLKILNLYSQD+LD + LVEKV  YL    E
Sbjct: 688  IEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKE 747

Query: 646  LFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCW 705
            LF WFK+FVGYQE+ K IENIVHEKHRLDLDLCEA GPSYKRLPK+DTFMPCSGRD+MCW
Sbjct: 748  LFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCW 807

Query: 706  EVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIA 765
            EVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ LETI 
Sbjct: 808  EVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIV 867

Query: 766  NKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVL 825
            NKI NMT  EK  FKLPPGLGHTS+TIYKKVIRKVYDK+RG+EIIDALHE+PA+T P+VL
Sbjct: 868  NKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVL 927

Query: 826  KRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSI 885
            KRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLT KQLISEISSI
Sbjct: 928  KRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSI 987

Query: 886  KVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFK 945
            KVDQ NK+IH LTPK KSQLD DF D  +F DIL LA  F+ +   YS PDKERLKD  K
Sbjct: 988  KVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLK 1047

Query: 946  GFISLFCSYPVPQIEKAL-AKRDAAXXXXXXXXXXXXXXXKQQEDGDMKLPKKRNREDSD 1004
             FISLF S  + +IE++L A + +                K+    +M            
Sbjct: 1048 YFISLFFSISLEEIEESLQAYKQSVSESSGSDDGGSSVSRKRSYQQEMT----------- 1096

Query: 1005 RLLRDVLFRNKQQKGGRNSPRGD-----SSISAXXXXXXXXXXXXXXXAKNPWLLGSIVD 1059
              L D+L R++ QK  R+          S                   AKNPWL G++V+
Sbjct: 1097 --LLDILHRSRYQKLKRSKDEDGKVPQLSEAPDEESNIIEEEELINEEAKNPWLTGNLVE 1154

Query: 1060 EADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAK 1119
            EA++ G ++NR  FNLFANTNIY+FFRH  TIYERL+E+K+MN++VTKEI  R  V FAK
Sbjct: 1155 EANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAK 1214

Query: 1120 DLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTV 1179
            DL+L+S QL++MGLDF GEDAY+++L+LSR LI GDLEHQWFEESLRQAY N+AFK+YT+
Sbjct: 1215 DLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTI 1274

Query: 1180 DKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFR 1239
            DKV Q+LVKHAH ++TD KT EIM LF KDR   +TS K QI+YRLQVRS+MSN ENMFR
Sbjct: 1275 DKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFR 1334

Query: 1240 IEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXX 1299
            IE+++ T HV IQ++A+DDLTL+EPK  +DKW+YY+TSY+L HPTEG+ H+ L+ PFL  
Sbjct: 1335 IEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLER 1394

Query: 1300 XXX-XXXXXXXXXXXXYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRV 1358
                            +SPEG++ S LK+KI P TY +++E GS+D+F+RK+ NK+P   
Sbjct: 1395 LIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKYPTVA 1454

Query: 1359 --DIRXXXXXXXXXXXXRFLNSNSGWKKDLSAKQIAEVEKRLEFVK 1402
              D              RFL+     + DL+  Q   ++++ E +K
Sbjct: 1455 NDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLK 1500

 Score =  264 bits (674), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 163/262 (62%), Gaps = 34/262 (12%)

Query: 160 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPT 219
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF+GYP 
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 220 LIQGFNTFLPQGYNIECSSDPNDPIKVTTPFXXXXXXXXXXXXXXXXXXXXXPRAEPXXX 279
           LIQGFNTFLPQGY IECS++P+DPI+VTTP                      P + P   
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348

Query: 280 XXXXXXX------PATVXXXXXXXXXXXXXXXXXXXXXXXPPPQAQTLVVYQSTDGSPTM 333
                        P+ V                          Q Q L +  ++ G P++
Sbjct: 349 GNGTQRSHNVPMVPSNVYHSEQNQD------------------QQQVLPLSATSTGLPSI 390

Query: 334 PQRQ-------PQDQ---FGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQ 383
            Q +       PQ Q        KK  DVEFS AISYVNKIKTRFADQPDIYKHFLEILQ
Sbjct: 391 QQSEIPVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQ 450

Query: 384 TYQREQKPINEVYAQVTVLFQN 405
           TYQREQKPINEVYAQVT LFQN
Sbjct: 451 TYQREQKPINEVYAQVTHLFQN 472

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 12/90 (13%)

Query: 152 PAHQDGSSYRPLNVKD------------ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQ 199
           P H      +PL V++            A+SY+ ++K +F  +PD+Y HFL+I++ ++ +
Sbjct: 396 PVHHQIPQIQPLAVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQRE 455

Query: 200 AIDTPGVIERVSTLFQGYPTLIQGFNTFLP 229
                 V  +V+ LFQ  P L++ F  FLP
Sbjct: 456 QKPINEVYAQVTHLFQNAPDLLEDFKKFLP 485

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648
           LN+ +  S+ ++ K ++     IY  FL I+  +    +D   ++E+V     G P L  
Sbjct: 232 LNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQ 291

Query: 649 WFKSFV--GYQ 657
            F +F+  GY+
Sbjct: 292 GFNTFLPQGYR 302

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1094 bits (2830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/971 (58%), Positives = 675/971 (69%), Gaps = 84/971 (8%)

Query: 489  LPPLGSFSTPGDH-----------HPMNLPLV----QAPNMNLNQGHPAHIITQGMSNQK 533
            LPP+GSFS P +            H M LP +    Q  +MN N   PA + TQG+SN +
Sbjct: 479  LPPIGSFSPPANTGISMHDQSQRPHMMALPSMLQHEQIIDMN-NHPKPA-VSTQGISNDE 536

Query: 534  IPISDLRTTADTSYRPAEYSQ--------------------------------------- 554
            IP+SD+R     +    +Y Q                                       
Sbjct: 537  IPVSDVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHILQQQEIQQQQLMLQQQQEQELL 596

Query: 555  -GQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYT 613
              Q  QY+E   RPEIDLDPS+VPV+PEP +P+E    L+EE SFFDKAKK+I NKQIYT
Sbjct: 597  EQQQQQYVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIYT 656

Query: 614  EFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRL 673
            EFLK+LNL+SQDL+  + LV KV +Y+    ELF+WF++FVGYQ  PK IENIVHEKHRL
Sbjct: 657  EFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRL 716

Query: 674  DLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 733
            DLDLCEACGPSYKRLPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQY
Sbjct: 717  DLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 776

Query: 734  EDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIY 793
            E+TLFKIEEERHEYD+YIE+NLRTIQTLE I NKI+NM+ EEK  FKL PGLGHTS+TIY
Sbjct: 777  EETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIY 836

Query: 794  KKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKV 853
            KKVIRKVYDK+RG+EIIDALHE+PAI  PIVLKRLKQKDEEWRRAQREWNKVWRELEQKV
Sbjct: 837  KKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKV 896

Query: 854  FFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPE 913
            +FKSLDHLGLTFKQADKKLLT KQLISEISSIKVDQNNKRIH LTPK KSQL+ D  D E
Sbjct: 897  YFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFE 956

Query: 914  VFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRDAAXXXX 973
            + +DIL+L+  F+ +++TYS  DKERL DF K FISLF S P+ +I  AL KR+      
Sbjct: 957  ILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSE 1016

Query: 974  XXXXXXXXXXXKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGGRNSPRGDSSISAX 1033
                       + Q        KKR+  D +  + D+L R K QK  + S RG  S    
Sbjct: 1017 KVTDSALPDGTENQ--------KKRSIHDIELSMSDILHRTKYQK-MKLSNRGSDSQEEN 1067

Query: 1034 XXXX----------XXXXXXXXXXAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYV 1083
                                    AK PWLLG I+D+ +  G + +RK FNLFANTNIYV
Sbjct: 1068 NIDTIIDEESDERLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYV 1127

Query: 1084 FFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEK 1143
            F RH  T+YERL+E+K+MN EVTKEI NRK V+FA+DL L+STQL +MGLDF  +D+YE+
Sbjct: 1128 FLRHWTTLYERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEE 1187

Query: 1144 LLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIM 1203
            LL+LS+ LI  D+EHQWFEESLRQAY N+AFK+YTVDKV+QALVKH H ++TD KT E+M
Sbjct: 1188 LLRLSKRLIENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVM 1247

Query: 1204 MLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEE 1263
             LFEKDR S +TS KDQILYRLQ RS+MSN E MFRIEYN+   ++CIQ++A+DDLTL+E
Sbjct: 1248 KLFEKDRLSSATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKE 1307

Query: 1264 PKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLX------XXXXXXXXXXXXXXXXYSP 1317
              + ++KW+YY+TSYSL HPTEGI H++L+ PFL                       YSP
Sbjct: 1308 GNTEEEKWKYYVTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNGKYSP 1367

Query: 1318 EGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRV--DIRXXXXXXXXXXXXRF 1375
            EGV+ S  K+KI P  Y+++++ GS DIFSRK++NK+PV+V  D               F
Sbjct: 1368 EGVSNSMYKIKIHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTF 1427

Query: 1376 LNSNSGWKKDL 1386
            L SN+GWKK L
Sbjct: 1428 LESNNGWKKHL 1438

 Score =  257 bits (657), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 162/295 (54%), Gaps = 38/295 (12%)

Query: 115 GFSMSSLDNPLPXXXXXXXX----XXXXXXXXXXXXXXXXXPAHQDGSSYRPLNVKDALS 170
           G S++S DNPLP                              A +D +SYRPLNVKDALS
Sbjct: 161 GVSVASFDNPLPPLNQQQSQPSFPAMHMRDQQQQQQMAAAPAAAEDDASYRPLNVKDALS 220

Query: 171 YLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQ 230
           YLEQVK QFNSRPD+YN FLDIMKDFKSQ IDTPGVIERVSTLF+GYP+LIQGFNTFLP 
Sbjct: 221 YLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQGFNTFLPT 280

Query: 231 GYNIECSSDPNDPIKVTTPFXXXXXXXXXXXXXXXXXXXXXPRAEPXXXXXXXXXXPATV 290
           GY I+C S+PNDPIKVTTP                       +A            P   
Sbjct: 281 GYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQQQALSQNNMMQQAQIPIGS 340

Query: 291 XXXXXXXXXXXXXXXXXXXXXXXPPPQAQTLVVYQSTDGSPTMPQRQPQDQFGTGGKKTG 350
                                      A      QS D       ++P D          
Sbjct: 341 ISN-----------------------NANLNAAVQSVDDQAKQANKKPAD---------- 367

Query: 351 DVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405
            VEFS AI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPINEVYAQVT+LFQN
Sbjct: 368 -VEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQN 421

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A++Y+ ++K +F  +PD+Y +FL+I++ ++ +      V  +V+ LFQ  P L+  F  F
Sbjct: 373 AINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKF 432

Query: 228 LP 229
           LP
Sbjct: 433 LP 434

 Score = 37.4 bits (85), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 590 LNLVEEASFFDKAKKYIGNK-QIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648
           LN+ +  S+ ++ K+   ++  IY +FL I+  +    +D   ++E+V     G P L  
Sbjct: 213 LNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQ 272

Query: 649 WFKSFV--GYQ 657
            F +F+  GY+
Sbjct: 273 GFNTFLPTGYR 283

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1091 bits (2822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/933 (57%), Positives = 672/933 (72%), Gaps = 57/933 (6%)

Query: 526  TQGMSNQKIPISDLRTT-----------ADTSYRPAEYSQGQDTQYM------------- 561
            T  ++N+ + IS+LR +           A+ +Y PAE +Q Q  Q++             
Sbjct: 542  TTQLTNEAMQISELRGSPMMDGQTARNLANVNYSPAELNQLQAQQHISIQQQQQQQQQQQ 601

Query: 562  -----------------ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKK 604
                             + + RPEIDLDPS+VPVIPEP++P+ED L+LVEE +FFDKAKK
Sbjct: 602  QQLQMQMQMQMDGGYPQDISVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKK 661

Query: 605  YIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIE 664
            +I NKQIY EFLKILNLYSQ++L+   LVEKV +YL    ELFDWFK FVGYQ+KPKHIE
Sbjct: 662  FINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIE 721

Query: 665  NIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 724
            NIVHEKH+LDLDLCEA GPSYK+LPK DTFMPCSGRDEMCWEVLND+WVGHPVWASEDSG
Sbjct: 722  NIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSG 781

Query: 725  FIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPG 784
            FIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQTLETIA+KIANMT EE+A FKLP G
Sbjct: 782  FIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIG 841

Query: 785  LGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNK 844
            LGHTSVTIY+KVIRKVY K+RG+E+IDALHEYPA+ VPI+LKRLKQKDEEWRRAQREWNK
Sbjct: 842  LGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNK 901

Query: 845  VWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQ 904
            VWREL+QKV++KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ NK++H LTPK KSQ
Sbjct: 902  VWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQ 961

Query: 905  LDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALA 964
            LD+   D ++ YDIL L  VF+ + + YS PDKERL+DF + FISLF   P+  I+ A+ 
Sbjct: 962  LDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIK 1021

Query: 965  KRDAAXXXXXXXXXXXXXXXKQQEDGDM-KLPKKRNREDSDRLLRDVLFRNKQQKGGRNS 1023
             R                   ++  GD  K PKKR+ ED D    D+L + K QK  +  
Sbjct: 1022 IRSPL---------DDTKTDSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGL 1072

Query: 1024 PRGDS-SISAXXXXXXXXXXXXXXXAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIY 1082
             + ++ S                  A+ PWLLGSIVD+A++ G ++NR  +N+F NTNIY
Sbjct: 1073 DKNETFSNDISSATSVDDDELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIY 1132

Query: 1083 VFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYE 1142
            VF RHL T+YERL E K+MN EVT+EI NR +V FAKDLNL+STQL +MGLDF+G D+Y+
Sbjct: 1133 VFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYK 1192

Query: 1143 KLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEI 1202
            +LL LS  LI G+LEH WFEESLRQA++NKAFK+YT+DKV Q++VKHAH I++D KT EI
Sbjct: 1193 QLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEI 1252

Query: 1203 MMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLE 1262
            MML EKDR+  +TS+KDQILYRLQ RS+MS  +NMFRIE+N+ + ++ IQ++ +DDLTL 
Sbjct: 1253 MMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLG 1312

Query: 1263 EPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXX---XXXXXXXXXXXXXXXYSPEG 1319
            EPK+ ++KW+YY+TSY+LSHPTEG+  + ++ PFL                    YSP+G
Sbjct: 1313 EPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILETEEAYAEEEEVINDKYSPKG 1372

Query: 1320 VATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRV--DIRXXXXXXXXXXXXRFLN 1377
            V+ S+LK+KI P  Y++E+E GS D FSR ++NK+P+ V  D               FLN
Sbjct: 1373 VSQSDLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLN 1432

Query: 1378 SNSGWKKDLSAKQIAEVEKRLEFVKLNGNLEEY 1410
               GWK+ LS  +I  +  +   +K  G+L+ Y
Sbjct: 1433 GKFGWKQSLSEDEINNINLKYSHIKKYGSLKNY 1465

 Score =  180 bits (456), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 89/95 (93%)

Query: 156 DGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQ 215
           D   YRPLNVKDAL+YLEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLF+
Sbjct: 138 DEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197

Query: 216 GYPTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPF 250
           GYP+LIQGFNTFLPQGY IEC+++PNDPIKVTTP 
Sbjct: 198 GYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPI 232

 Score =  103 bits (256), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 62/85 (72%), Gaps = 3/85 (3%)

Query: 323 VYQSTDGSPTMP--QRQPQDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLE 380
           V QS+  +P  P      QD      +K  DVEFS A+SYVNKIK RF D+PDIYK FLE
Sbjct: 322 VIQSSANAPIQPNMHNMTQDTMKIT-EKPADVEFSQAVSYVNKIKNRFVDEPDIYKTFLE 380

Query: 381 ILQTYQREQKPINEVYAQVTVLFQN 405
           ILQTYQ+EQKPI+EVY+QVT+LFQN
Sbjct: 381 ILQTYQKEQKPIHEVYSQVTILFQN 405

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 38/66 (57%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A+SY+ ++K +F   PD+Y  FL+I++ ++ +      V  +V+ LFQ  P L+  F  F
Sbjct: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKF 416

Query: 228 LPQGYN 233
           LP   N
Sbjct: 417 LPDNNN 422

 Score = 41.6 bits (96), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 33/48 (68%)

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 404
           A++Y+ ++K +F+ +PDIY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648
           LN+ +  ++ ++ K ++     IY  FL I+  +    +D   ++E+V     G P L  
Sbjct: 145 LNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQ 204

Query: 649 WFKSFV--GY 656
            F +F+  GY
Sbjct: 205 GFNTFLPQGY 214

 Score = 33.1 bits (74), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 31/151 (20%), Positives = 64/151 (42%), Gaps = 29/151 (19%)

Query: 505 NLPLVQAPNMNLNQGHPAHIITQGMSNQKIPISDLRTTADTSYRPAEYSQGQDTQYMETN 564
           N+     P++  N G P+H  T+   ++ +    ++++A+   +P  ++  QDT  M+  
Sbjct: 295 NVATAAQPSLLPNLGTPSH--TEVTKSESV----IQSSANAPIQPNMHNMTQDT--MKIT 346

Query: 565 ARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYS 623
            +P                     ++   +  S+ +K K +++    IY  FL+IL  Y 
Sbjct: 347 EKPA--------------------DVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQ 386

Query: 624 QDLLDKERLVEKVGHYLSGCPELFDWFKSFV 654
           ++      +  +V       P+L D FK F+
Sbjct: 387 KEQKPIHEVYSQVTILFQNAPDLLDDFKKFL 417

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1089 bits (2816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/869 (60%), Positives = 648/869 (74%), Gaps = 22/869 (2%)

Query: 556  QDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEF 615
            Q   Y E   RPEIDLDPSLVP++PEP +P+ED L LVEE +FFDK KKYIGNK IY EF
Sbjct: 821  QQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEF 880

Query: 616  LKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDL 675
            LK+LNLYS DLL+ + LVEK+ +YL+   ELF WFK+FVGY EKPKHIENIVHEKH+LDL
Sbjct: 881  LKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDL 940

Query: 676  DLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYED 735
            DLCEACGPSYK+LPK DT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   + 
Sbjct: 941  DLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKK 1000

Query: 736  TLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKK 795
               +++++ HEYDFYIE+NLRTIQTLETIA+KIANMT  EK  FKLP GLGHT+ TIYKK
Sbjct: 1001 PYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKK 1060

Query: 796  VIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFF 855
            VIRKVYDK+RG+EIIDALHEYPAI VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVFF
Sbjct: 1061 VIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFF 1120

Query: 856  KSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVF 915
            KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ +KR+H LTPK KSQLD +  D ++ 
Sbjct: 1121 KSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDII 1180

Query: 916  YDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRDAAXXXXXX 975
            +DIL+   +F+E+ +TYS P+KERL DF K F SLF S P+ +I++A++KRD        
Sbjct: 1181 FDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDIT------ 1234

Query: 976  XXXXXXXXXKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQ--KGGRNSPRGDSSISA- 1032
                      +Q++G+    KKR   D    L D+L R K Q  K G +S   D   +  
Sbjct: 1235 -EKNDEKLEDKQKNGEEN-SKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRH 1292

Query: 1033 XXXXXXXXXXXXXXXAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIY 1092
                           AK PWLLG++V+EA+  G + +R  FN+F+NTN+Y+F RHL T+Y
Sbjct: 1293 DDQKLLEEEELLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMY 1352

Query: 1093 ERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLI 1152
            ERL E+K+MND+V++EI+ RK+ +FAKDLNLISTQLT+MGLDF   D Y++LL L + LI
Sbjct: 1353 ERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLI 1412

Query: 1153 AGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTS 1212
             GDLEHQWFEESLRQA+ NKAFK+YT+DKV QALVKHAH II+D KT EIM LFEKDRT 
Sbjct: 1413 LGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTK 1472

Query: 1213 LSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQ 1272
             STS+KDQILYRLQ R+ M++ ENMFRIEYN  T H+CIQ++A+DDLT+++ K+L++KW+
Sbjct: 1473 NSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWK 1532

Query: 1273 YYLTSYSLSHPTEGISHDNLRSPFLX---------XXXXXXXXXXXXXXXXYSPEGVATS 1323
            YY+TSY+LSHPTEGI  +N++ PFL                          YSPEG++ S
Sbjct: 1533 YYITSYALSHPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGS 1592

Query: 1324 NLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRV--DIRXXXXXXXXXXXXRFLNSNSG 1381
             LK+KIDP  Y + +E GS DIFSRK++N+FPV++  D +            +FLNS  G
Sbjct: 1593 TLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMG 1652

Query: 1382 WKKDLSAKQIAEVEKRLEFVKLNGNLEEY 1410
            WK+ +S  Q+  +E + + +  NGNLE Y
Sbjct: 1653 WKRAISKDQMESIESKWDHLSNNGNLEGY 1681

 Score =  175 bits (443), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 86/96 (89%)

Query: 155 QDGSSYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 214
           ++ + YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVI RVS+LF
Sbjct: 294 KEDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLF 353

Query: 215 QGYPTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPF 250
             YP+LIQGFNTFLPQGY IECSS+PN PI V TP 
Sbjct: 354 HDYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPM 389

 Score =  107 bits (266), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%)

Query: 347 KKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 404
           ++T DVEFS AISYVNKIK RFA+QP IYKHFLEILQTYQREQKPINEVY+QVTVLFQ
Sbjct: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQ 595

 Score = 51.2 bits (121), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A+SY+ ++K +F ++P +Y HFL+I++ ++ +      V  +V+ LFQ  P L++ F  F
Sbjct: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607

Query: 228 LP 229
           LP
Sbjct: 608 LP 609

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 33/49 (67%)

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V A+V+ LF +
Sbjct: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1078 bits (2787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/964 (57%), Positives = 672/964 (69%), Gaps = 51/964 (5%)

Query: 488  NLPPLGSFS----------TPGDHH--PMNLPLVQAPNMNLNQGHPAHIITQGMSNQKIP 535
            NLPP+GSF+           PG+    P  LP +  PN    Q      +  G +N+ IP
Sbjct: 473  NLPPIGSFAPPNGTASREYAPGNQFVGPGGLPSM-IPNDQALQQQQQPGLVHGYTNEAIP 531

Query: 536  ISDLRT-TADTSYRPAEYSQGQDT---------------QYM-ETNARPEIDLDPSLVPV 578
            +S+LR+   D  Y      Q Q T               QY  E   RPEIDLDPS+VPV
Sbjct: 532  VSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLDPSIVPV 591

Query: 579  IPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGH 638
            IPEP +PLE  ++LVEE +FF+KAKK+IG KQ+YTEFLKILNLYSQDLL  + L  KV +
Sbjct: 592  IPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEY 651

Query: 639  YLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCS 698
            YL    ELF WFK+FVG+QEKP  IENIVHEKH+LDLDLCEACGPSYK+LPK DTFMPCS
Sbjct: 652  YLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCS 711

Query: 699  GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTI 758
            GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE++LFK EEERHEYDF IE+NLRTI
Sbjct: 712  GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTI 771

Query: 759  QTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPA 818
            QTLETIANKI NMT EEK  FKLPPGLGHTS TIYKKVIRKVYDKDRG+EIID LHE PA
Sbjct: 772  QTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPA 831

Query: 819  ITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQL 878
            +TVP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQL
Sbjct: 832  LTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQL 891

Query: 879  ISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKE 938
            +SEISSIKVDQ NKRIH LTPK KSQL+  F D ++F DIL L  VF+ +++TYS P+KE
Sbjct: 892  LSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKE 951

Query: 939  RLKDFFKGFISLFCSYPVPQIEKALAKRDAAXXXXXXXXXXXXXXXKQQEDGDMKLPKKR 998
            R+KDF + F+SLF S P+ ++ +AL+ R                               +
Sbjct: 952  RMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKESSRNIDSTTSSSSSGSNSK 1011

Query: 999  NRE-DSDRLLRDVLFRNKQQKGGRNSPRG---------DSSI---SAXXXXXXXXXXXXX 1045
             R  + D  L D+L ++K QK  + +            D +I   S              
Sbjct: 1012 KRPLNIDIPLADILRKHKYQKIRKQAKESNEENAQEEDDENIVGDSNEELNEQDENEIIL 1071

Query: 1046 XXAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEV 1105
               K PWLLG+I++ A NHG + NRK FN+FANTNIYVFFR    IYERL E+K++N++V
Sbjct: 1072 EEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKV 1131

Query: 1106 TKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESL 1165
            TKE+ +R++ QFAKDLNLISTQL DMGLDF G ++Y++LL LS+ LI  D+EHQWFEESL
Sbjct: 1132 TKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESL 1191

Query: 1166 RQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRL 1225
            RQA+ NKAFK+YTVDKVIQ+LVKHAH I+ D KT EIM+LFEKDR   STS K+QILYRL
Sbjct: 1192 RQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRL 1251

Query: 1226 QVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTE 1285
            Q R++M+N ENMFRIE+N    HVCIQ++A++DLT+++PKS++  W+YY+TSYSL HPTE
Sbjct: 1252 QTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTE 1311

Query: 1286 GISHDNLRSPFLXXXXXXXXXXXXXXXXXYSPEGVATSNLKVKIDPITYSMEVEFGSHDI 1345
            G+  D L+ PFL                  SPEGV++S LK+KIDP +Y++E+E GS D+
Sbjct: 1312 GVPQDELKIPFLEKTLELEVDEEGDNKS--SPEGVSSSKLKIKIDPKSYALEIEPGSFDL 1369

Query: 1346 FSRKAVNKFPVRVDIRXXXXXXXXXXXXRFLNSNSGWKKDLSAKQIAEVE----KRLEFV 1401
            FSRK++N +P   D              +FL+  +GWKK+L+      +E    K  E  
Sbjct: 1370 FSRKSMNVYPTYSD--ETKKRKSIDQMTKFLDGKNGWKKNLTTADSTNIEDLVKKSRELS 1427

Query: 1402 KLNG 1405
            K  G
Sbjct: 1428 KATG 1431

 Score =  171 bits (432), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 85/92 (92%)

Query: 159 SYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYP 218
           +YRPLNVKDALSYLEQVK+QF+ RPD+YN FLDIMKDFKSQ+IDTPGVIERVS LF+GYP
Sbjct: 206 AYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYP 265

Query: 219 TLIQGFNTFLPQGYNIECSSDPNDPIKVTTPF 250
            L+QGFNTFLPQGY IEC++DP+ PI+VTTP 
Sbjct: 266 MLVQGFNTFLPQGYRIECTTDPDGPIRVTTPM 297

 Score =  107 bits (268), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/68 (77%), Positives = 57/68 (83%), Gaps = 4/68 (5%)

Query: 337 QPQDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY 396
           QP+DQ      K  +VEFS AI+YVNKIK RFADQPDIYK FLEILQTYQREQKPINEVY
Sbjct: 347 QPEDQ----SAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVY 402

Query: 397 AQVTVLFQ 404
           +QVTVLFQ
Sbjct: 403 SQVTVLFQ 410

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 42/72 (58%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LFQ  P L+  F  F
Sbjct: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422

Query: 228 LPQGYNIECSSD 239
           LP+      +S+
Sbjct: 423 LPESSGTTSTSE 434

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 404
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 215 ALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262

 Score = 33.9 bits (76), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 590 LNLVEEASFFDKAKKYIGNK-QIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648
           LN+ +  S+ ++ K     +  IY +FL I+  +    +D   ++E+V     G P L  
Sbjct: 210 LNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPMLVQ 269

Query: 649 WFKSFV--GYQ 657
            F +F+  GY+
Sbjct: 270 GFNTFLPQGYR 280

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1049 bits (2712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/985 (54%), Positives = 674/985 (68%), Gaps = 73/985 (7%)

Query: 489  LPPLGSFSTPGDH----------HP------MNLP-------------LVQAPNMNLNQG 519
            LPP+GSFS P +           +P      M+LP             + QA +  ++  
Sbjct: 470  LPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDS 529

Query: 520  H----PAHIITQGM-SNQKIPISDLRTTA-DTSYRPAEY--SQGQDTQYM---------- 561
            H       +++Q + SN  IP+S+LRTT  + +Y P      QG   Q+M          
Sbjct: 530  HDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPS 589

Query: 562  ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNL 621
            E   RPEIDLDPSLVPV+PEP +P+E+ LNL+EE +FF++ KK IGNKQIY EFLKILNL
Sbjct: 590  ELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKILNL 649

Query: 622  YSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEAC 681
            +S DLL  + LV+KV +Y+    ELFDWFK FVGYQ+KPK IENIVHEKH+LDLDLCEA 
Sbjct: 650  FSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAY 709

Query: 682  GPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIE 741
            GPSYK+LPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIE
Sbjct: 710  GPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 769

Query: 742  EERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVY 801
            EERHEYD+YIE+NLRTIQTLETIANKIANMT  EKA F+LPPGLGHTS+TIYKKVIRKVY
Sbjct: 770  EERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVY 829

Query: 802  DKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 861
            DK+RG+EIIDALH YPAI+VPI+L+RLKQKDEEWRRAQREWNK+WR+LEQKV+FKSLDHL
Sbjct: 830  DKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHL 889

Query: 862  GLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNL 921
            GLTFKQADKKLLT KQLISEI+ IKVDQN+KRIH LTPK K+QLD+DF D ++ +DI+ L
Sbjct: 890  GLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIAL 949

Query: 922  AIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRDAAXXXXXXXXXXXX 981
              VF  N N YS PDKER+KD  + F+S F S P+ ++  AL +R  +            
Sbjct: 950  GFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKGSG 1009

Query: 982  XXXKQQE-----DGDMKLPKKRNREDSDRLLRDVLFRNKQQK-------GGRNSPRGDSS 1029
               +  E     + D    KKR   D+D  + D+L + KQQK        G  SP  D  
Sbjct: 1010 KMDQIAEEIGETEQDTSSSKKRPF-DNDLNMSDILHKTKQQKTKMNKEMDGSKSPSED-- 1066

Query: 1030 ISAXXXXXXXXXXXXXXXAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLA 1089
            +                  +  WL+G +VD A+    ++NR  +NLFANTNIY+FFRHL 
Sbjct: 1067 LGTDRNVGTIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLV 1126

Query: 1090 TIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSR 1149
            T+YERL EVK++NDE+ KEI +R+V  FAKDL LISTQL+++GLDF   DAY++LL LS+
Sbjct: 1127 TLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSK 1186

Query: 1150 SLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKD 1209
             LI GD+EHQWFEES+RQAY N+AFK+YT+DKV+Q+ VKHAH +I+D+KT EIM+LFE  
Sbjct: 1187 RLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQ 1246

Query: 1210 RTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKD 1269
            R +  T+TKDQILYR+Q RS+MS+ ENMFRIEY R   H  IQ++A+DDLTL+  KS ++
Sbjct: 1247 RNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEE 1306

Query: 1270 KWQYYLTSYSLSHPTEGISHDNLRSPFLXXXXX--XXXXXXXXXXXXYSPEGVATSNLKV 1327
             W YY+TSYSLS+PTEG+ H+NL  PFL                   YS  G++ SNL +
Sbjct: 1307 AWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHI 1366

Query: 1328 KIDPITYSMEVEFGSHDIFSRKAVNKFPVRV--DIRXXXXXXXXXXXXRFLNSNSGWKKD 1385
             ID   Y++ ++ GS D++SR  + K+P+    + R            + L+   G   D
Sbjct: 1367 DIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHYDGNSND 1426

Query: 1386 LSAKQIAEVEKRLEFVKLNGNLEEY 1410
                   +V ++  ++  NG ++ Y
Sbjct: 1427 -------DVNEKFNYILANGTIDGY 1444

 Score =  263 bits (671), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 160/256 (62%), Gaps = 42/256 (16%)

Query: 152 PAHQDGS--SYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIER 209
           PA   G   SYRPLNVKDALSYLEQVKFQF++RPD+YN FLDIMKDFKSQ IDTPGVIER
Sbjct: 175 PAQTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIER 234

Query: 210 VSTLFQGYPTLIQGFNTFLPQGYNIECSSDPNDPIKVTTPFXXXXXXXXXXXXXXXXXXX 269
           VS+LF+GYP LIQGFNTFLPQGY IECS++PNDPIKVTTP                    
Sbjct: 235 VSSLFKGYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPM-----------GSSTTVLN 283

Query: 270 XXPRAEPXXXXXXXXXXPATVXXXXXXXXXXXXXXXXXXXXXXXPPPQAQTLVVYQSTDG 329
             P+  P          P+ +                          QA        +  
Sbjct: 284 TAPQKSP---------SPSDIQTNNQQT-------------------QAIAQEAQLQSQA 315

Query: 330 SPTMPQRQPQDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQ 389
           +P   Q      FG+  KK  DVEFS AI+YVNKIKTRFADQPDIYK FLEILQTYQREQ
Sbjct: 316 TPIPTQHDVGQNFGS-AKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQ 374

Query: 390 KPINEVYAQVTVLFQN 405
           KPI+EVYAQVT+LFQN
Sbjct: 375 KPIHEVYAQVTILFQN 390

 Score = 53.5 bits (127), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 46/75 (61%), Gaps = 2/75 (2%)

Query: 157 GSSYRPLNVK--DALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 214
           GS+ +P +V+   A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF
Sbjct: 329 GSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILF 388

Query: 215 QGYPTLIQGFNTFLP 229
           Q  P L+  F  FLP
Sbjct: 389 QNAPDLLDDFKKFLP 403

 Score = 33.9 bits (76), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648
           LN+ +  S+ ++ K ++     IY  FL I+  +    +D   ++E+V     G P L  
Sbjct: 188 LNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFKGYPNLIQ 247

Query: 649 WFKSFV--GYQ 657
            F +F+  GY+
Sbjct: 248 GFNTFLPQGYR 258

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1040 bits (2689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/859 (60%), Positives = 621/859 (72%), Gaps = 32/859 (3%)

Query: 562  ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNL 621
            E   RPEIDLDPS+VP+IPEP +P+E+ + LVEE SFF+K KK+I +K IY EFLK+LNL
Sbjct: 713  EAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772

Query: 622  YSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEAC 681
            YSQDLL    LV +V +Y+    ELFDWFK+FVGY E P  IENI+HEKH+LDLDLCEA 
Sbjct: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832

Query: 682  GPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIE 741
            GPSYK+LPK DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIE
Sbjct: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892

Query: 742  EERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRKVY 801
            EERHEYDF+IE+NLRTIQTLETIANKI NMT EEK  FKLP GLGHTS TIYKKVIRKVY
Sbjct: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952

Query: 802  DKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 861
            DK+RG+EIIDALHE+PA  VPI+L+RLK+KDEEWRRAQREWNKVWRELEQKV++KSLDHL
Sbjct: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012

Query: 862  GLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNL 921
            GLTFKQADKKLLT KQLISEISSI+VDQNNKRIH LTPK KSQLD  F D ++  DIL+L
Sbjct: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072

Query: 922  AIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRDAAXXXXXXXXXXXX 981
            A VF+++ +TYS  +KERLKDF + FI LF S P  +I+K L+ ++              
Sbjct: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKN-------DEKFEKG 1125

Query: 982  XXXKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGGR---NSPRGDSS--------- 1029
                          KKR+ E  D  L DVL + K QK      N    +S+         
Sbjct: 1126 SSSSSSTSNSTPSAKKRSLE-LDIPLADVLRKYKYQKIKEKVINELENNSNEYDERDEEF 1184

Query: 1030 ---ISAXXXXXXXXXXXXXXXAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFR 1086
               +                  K PWLLGS++D+   HG +ENR  FNLFANTNIYVFFR
Sbjct: 1185 DEELKRQQQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFR 1244

Query: 1087 HLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQ 1146
            H  TIYERL+E+K++ND+VT+EI +RKV  FAKDL LISTQLT MGLDFK  D+Y++LL 
Sbjct: 1245 HWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLN 1304

Query: 1147 LSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLF 1206
            L++ LI  D+EHQWFEESLRQAY NKAFK+YT DKVIQALVKHA++I+TD+K  EIM LF
Sbjct: 1305 LTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALF 1364

Query: 1207 EKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKS 1266
            EKDR   ST+T+DQI+YRLQ R++M+N ENMFRIE+N  T HVCIQ++AV+DLTL+   +
Sbjct: 1365 EKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPT 1424

Query: 1267 LKDKWQYYLTSYSLSHPTEGISHDNLRSPFLXXXXXXX---------XXXXXXXXXXYSP 1317
             K+ W+YY+TSY+L HPTEG+  + L+ PFL                           SP
Sbjct: 1425 TKETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISP 1484

Query: 1318 EGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVDIRXXXXXXXXXXXXRFLN 1377
            EG++TS LK+KID  TY+++VE GS D+FSRK++NKFP                  +FL+
Sbjct: 1485 EGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAKKIESSIKEKSEAFNKFLS 1544

Query: 1378 SNSGWKKDLSAKQIAEVEK 1396
            S  GW       Q+A +E+
Sbjct: 1545 SKRGWNNQFKPDQVAGIEE 1563

 Score =  167 bits (424), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 82/91 (90%)

Query: 160 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPT 219
           YRPLNVKDALSYLEQVK QFNS+P +YN FLDIMKDFKSQ IDTPGVIERVSTLF+GYP 
Sbjct: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329

Query: 220 LIQGFNTFLPQGYNIECSSDPNDPIKVTTPF 250
           LIQGFNTFLPQGY I CS +P+DP++VTTP 
Sbjct: 330 LIQGFNTFLPQGYTIHCSDNPDDPVRVTTPM 360

 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/55 (81%), Positives = 51/55 (92%)

Query: 351 DVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405
           +VEFS AI+YVNKIKTR+ADQP IYKHFLEILQTYQRE+KPI+EVY QVTVLF +
Sbjct: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFND 518

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 40/63 (63%)

Query: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227
           A++Y+ ++K ++  +P +Y HFL+I++ ++ +      V E+V+ LF   P L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 228 LPQ 230
           LP+
Sbjct: 530 LPE 532

 Score = 37.0 bits (84), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%)

Query: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 404
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648
           LN+ +  S+ ++ K ++     IY +FL I+  +    +D   ++E+V     G P L  
Sbjct: 273 LNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQ 332

Query: 649 WFKSFV--GY 656
            F +F+  GY
Sbjct: 333 GFNTFLPQGY 342

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
           {ON} weakly similar to uniprot|P22579 Saccharomyces
           cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  239 bits (609), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 142/384 (36%), Positives = 211/384 (54%), Gaps = 38/384 (9%)

Query: 585 PLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCP 644
           P++   N+ E   +F   +  + ++ IY EFLK++NL++Q L+D     ++   +     
Sbjct: 196 PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252

Query: 645 ELFDWFKSFVG-YQEKPKHIENIVHEKHRLDL-DLCEACGPSYKRLPKADTFMPCSGRDE 702
            L   F + +  Y++  + ++  +      D+ D     GPSYKRL   +T   C GRD 
Sbjct: 253 GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312

Query: 703 MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLE 762
           +C EVLNDEWVGHPVWASE+ GFIAH+KNQYE+TLFK+EEERHEYDF+          L 
Sbjct: 313 LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFF----------LL 362

Query: 763 TIANKIANMTPEEKATFKLP---------------PGLGHTSVTIYKKVIRKVYDKDRGY 807
           ++ + I   T  EK+  +L                P +   S+T  +KVIR++Y  + G 
Sbjct: 363 SVEHLIVKFTEYEKS-LQLSKDDGRRRNRVSSPKEPMISLNSIT--EKVIRRLYGIEHGN 419

Query: 808 EIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQ 867
            +IDA+   P   VP +LK  K+K ++W  A+ EWNK WRE+EQK ++KSLDHLGL FK 
Sbjct: 420 ILIDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKN 479

Query: 868 ADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDILNLAIVFLE 927
           A+K+ L  KQL+ E  S K D+  K  +        +  ++F D  V YD+ ++ +  L 
Sbjct: 480 AEKRFLNDKQLLLEYKSEKQDKLLKEHYD-----NYEYKYEFFDKSVLYDVKDIILCGLR 534

Query: 928 NNNTYSAPDKERLKDFFKGFISLF 951
           +N++ S   K      F+ F  L 
Sbjct: 535 SNSSTSESQKNLYCQIFEAFFDLL 558

 Score =  134 bits (336), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 149/290 (51%), Gaps = 10/290 (3%)

Query: 1069 NRKTFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEI--ANRKVVQFAKDLNLIST 1126
            NR+  N+F + NI   F ++ T+YER  +VK     + K++    R+    AK L L+  
Sbjct: 619  NRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPM 678

Query: 1127 QLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQAL 1186
            QL+D GL+   +D YE +   S+  ++G+L+HQWFEESLR  ++NKA+K+YT+D+VI+ +
Sbjct: 679  QLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNI 738

Query: 1187 VKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLT 1246
            +     I      ++I+ L   +   L+T+   Q+ YR +VR  M  + +MFR+E  R +
Sbjct: 739  LGVITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDS 798

Query: 1247 AHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPF--LXXXXXXX 1304
              +  Q++ VDDL   +    K +   Y   Y  +  T+ +  D L +P+  L       
Sbjct: 799  NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREE 858

Query: 1305 XXXXXXXXXXYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKF 1354
                      Y P      +L V I+P+ Y +++  GS DI S   + K 
Sbjct: 859  QNIPFMNGNIYKP------HLSVNINPLDYVVDIAPGSIDICSSTHITKL 902

>CAGL0L04928g Chr12 complement(560846..563920) [3075 bp, 1024 aa] {ON}
            similar to uniprot|Q02630 Saccharomyces cerevisiae
            YMR047c NUP116 or uniprot|Q02629 Saccharomyces cerevisiae
            YKL068w
          Length = 1024

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 63/136 (46%), Gaps = 11/136 (8%)

Query: 1162 EESLRQAYK--NKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKD 1219
            + SL  AY+   +A  + + DK    L  H+ +  + N T EI  L  ++ T+ S S  D
Sbjct: 712  DSSLTSAYRLAPRALFMSSDDKTTSTLRSHSASKDSKNST-EITHLPLENITNTSRSLGD 770

Query: 1220 QILYRLQVRSNMSNI-------ENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQ 1272
            Q+L+    +S  S I       E +   EY R+T     +   VD+  LE P++      
Sbjct: 771  QLLFNPDKKSFRSLIIKNKKVPEKIANSEYKRITFEAKNKNQGVDESELESPRN-DTPSP 829

Query: 1273 YYLTSYSLSHPTEGIS 1288
            Y  TS  +S P++ ++
Sbjct: 830  YVNTSGRISTPSKAMA 845

>KAFR0A04880 Chr1 complement(964742..965776) [1035 bp, 344 aa] {ON} 
          Length = 344

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 16/107 (14%)

Query: 1084 FFRHLATIYERLVE----VKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDF---- 1135
            F  +LAT+Y +L E    +K +  ++ KE+     V+  K   L   Q+TD  + F    
Sbjct: 209  FESNLATLYRKLNECEDHLKGVYKDIEKEVGKNNKVEILKKFYLFGNQITDTDIRFYTTA 268

Query: 1136 -KGEDAYEKLLQLSRSLIAGDLE--HQWFEESLRQAYKN-KAFKIYT 1178
             + + ++ + L+ +  +I  D    H W    LR  Y N KAF++ T
Sbjct: 269  IRFDSSHAQHLKCNWRIIRDDYPYIHLW----LRNLYWNHKAFRLTT 311

>Suva_2.328 Chr2 complement(576063..578237) [2175 bp, 724 aa] {ON}
            YDR164C (REAL)
          Length = 724

 Score = 33.1 bits (74), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 1074 NLFANTNIYVFFRHLATIYE---RLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTD 1130
            N+   T++     HL    E   RL+  K + DE  KE A RK+     D++ I   L+ 
Sbjct: 344  NVKNTTDLLSVVAHLKDFDEERRRLILHKTLIDECLKENAERKLA----DMSTIEQSLSG 399

Query: 1131 MGLDFKGE 1138
             GLDF GE
Sbjct: 400  FGLDFNGE 407

>Suva_7.477 Chr7 complement(817323..823175) [5853 bp, 1950 aa] {ON}
            YGR184C (REAL)
          Length = 1950

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 17/107 (15%)

Query: 586  LEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPE 645
            +E+EL       F DKA + I +K+ + +  K      Q ++     +EK+ +   G  +
Sbjct: 1608 VEEELEFEGLPGFVDKALRLITDKESFVDLFKT----KQAIVPSHPYLEKIPYEYCGIVK 1663

Query: 646  LFD---WFKSFVG-------YQEKPKHIENIVHEKHRLDLDLCEACG 682
            L D   +  ++V         +E+ +H++N     +RLD  +C  CG
Sbjct: 1664 LIDLSNFLNTYVTQSKEIKLREERSQHMKN---ADNRLDFKICLTCG 1707

>Kpol_1025.35 s1025 complement(81457..85011) [3555 bp, 1184 aa] {ON}
            complement(81457..85011) [3555 nt, 1185 aa]
          Length = 1184

 Score = 33.1 bits (74), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 19/144 (13%)

Query: 1121 LNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVD 1180
            ++LIS ++   G    G+ A EKL +LS+ L+  D +    E  L   + NK   +Y   
Sbjct: 11   VDLISQEIAYEG----GKIAIEKLYELSKKLLGNDGDDSLNEFILHSIFSNKDILLYKNG 66

Query: 1181 KV------------IQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVR 1228
            +V            IQ+ +    A IT++K  EI+  + K   S+  S  + +L   + R
Sbjct: 67   EVYIGNDLHSNFMEIQSSLSDFDARITEDKLWEILTGYNKKECSIGNSAFELLLEIAKSR 126

Query: 1229 S---NMSNIENMFRIEYNRLTAHV 1249
                N  ++ N+ + +   +T  +
Sbjct: 127  KKGINTKDLANVTKQDSRSITGRI 150

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 32.7 bits (73), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 605 YIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQ---EKPK 661
           Y G K +Y ++LK+LN   QD       VE          ++ ++  + + YQ   E+ K
Sbjct: 80  YTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKK 139

Query: 662 HIENIVHEK 670
           +I+N +H K
Sbjct: 140 YIDNFIHSK 148

>YDR014W Chr4 (474046..475989) [1944 bp, 647 aa] {ON}  RAD61Subunit
           of a complex (Scc3p, Pds5p, Rad61p) that inhibits sister
           chromatid cohesion; inhibited by Eco1p-acetylated
           cohesin subunits Smc3p and Mcd1p; related to the human
           Wapl protein that controls the association of cohesin
           with chromatin
          Length = 647

 Score = 32.7 bits (73), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 76/355 (21%), Positives = 134/355 (37%), Gaps = 84/355 (23%)

Query: 510 QAPNMNLNQGHPAHIITQGMSNQKIPISDLRTTADTSYRPAEYSQGQDTQYMETNARPEI 569
           +A  ++LN    ++   +G+++     ++L+   DT     +Y    D +++ +N++   
Sbjct: 232 KANTLSLNNADNSNAEKEGLTSTN-HYNELKNMGDT----IKYQD--DIEFLLSNSKSN- 283

Query: 570 DLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKILNLYSQDLLDK 629
             D + VP+     K L   L ++ +  FF  AK+Y   + I   F +  + + + +L +
Sbjct: 284 --DNTTVPINEYFKKLLNLSLMIINDEEFFQYAKRYFKKEIIKLSFAQFRSDFPELILLQ 341

Query: 630 ERLVEKVGHYLSGCPELFDWFKSFVGYQE------KPKHIENIVH--------------- 668
             L+ KV    S  P  FD F   +   +      K KHI+ + H               
Sbjct: 342 GYLLHKVSESQSDFPPSFDNFSIELSKDDGKIRTKKNKHIKKLSHLNFEDFLRKTQFKTG 401

Query: 669 --------EKH-RLDLDLCEACG--PSYKRL--PKADTFMPCSGR----DEMCWEVLNDE 711
                   E H  L LD+ +      S K L      TF+P   +     E C       
Sbjct: 402 LYYSLSLWEMHGNLSLDIIKRISILASNKDLFSRHVKTFIPLLEKLITASEFCH-----M 456

Query: 712 WVGHPVWASEDSGFIAHRKNQY-----EDTLFKI-----EEERHEYDFYIEANLRTIQTL 761
           ++  P         I++  NQ+     +D+L KI       E H Y  + EA++    ++
Sbjct: 457 YIEQPEMF---DSLISNLNNQFKDMLDDDSLIKILILLTNMEVHNYTLWKEADMIFQSSM 513

Query: 762 ETIANKI------------------ANMTPEEKATFKLPPGLGHTSVTIYKKVIR 798
            TI   I                   N+   E +  KL   L +   TI+ K+IR
Sbjct: 514 NTILESIHPLTDAKVDNILLHLGLCLNICSRENSRLKLDGKLWYDMKTIFVKMIR 568

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 135,499,702
Number of extensions: 5721967
Number of successful extensions: 17493
Number of sequences better than 10.0: 41
Number of HSP's gapped: 17854
Number of HSP's successfully gapped: 148
Length of query: 1474
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1351
Effective length of database: 39,377,481
Effective search space: 53198976831
Effective search space used: 53198976831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)